Citrus Sinensis ID: 037497

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
PRGTYIMLASISARSLTISSLFLSSSSPKYGRCKSRNLMSETESWNKTKARSMSLKVSNSSSKDDVQVGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSQISCSSDCRTGNLGDIFC
ccccEEEEEEEEEEccccEEEEEEcccccccccccccccccccccccccEEEcccEEccccccccccccccEEEEEEccccccEEEEEEccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEEEEccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccccHHHHccccccccccHHHHccccccccccccccccccEEccHHHHHHHccccccccEEEEEcHHHHHHHHHHHccccccEEEEEcccccccccccccccc
cccEEEEEEEEEEEEEEEEcEEccccccccccccccccccccccccccEEEEEEEccccccccccccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHEEEEcccccEEEEEEccccccccccEEEccccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHcccccccccHHHHcccccHHHcccHHHHHHcccHHHcccccccccccccccHHHHHHHccccccccEEEEEcccHHHHHHHHHHEEEcccEEEEcccccccccccccccc
PRGTYIMLASISARSLTISSLFlsssspkygrcksrnlmseteswnktkarsmslkvsnssskddvqVGERLYlgmdfgtsgarfaiinkdgtilsegkkeypkftteESIDWLRSWKVTLFSLLEAVPVNLRPLIAsisidgtsattiiidsnsgeplwrpflynescpdalpvvksiapanhtvcsgtsTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGklglsdynnalkvgydpelesyppwllsqpysqllpsvqapgtsigylkegirtEFGMFLFHLtchwwkptehqTIVFLCICIVINnkfsqiscssdcrtgnlgdifc
PRGTYIMLASISARSLTISSLflsssspkygrcksrnlmseteswnktkarsmslkvsnssskddvqVGERLYLGMDFGTSGARFAIINKdgtilsegkkeypkfTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSqiscssdcrtgnlgdifc
PRGTYIMLASISARsltisslflssssPKYGRCKSRNLMSETESWNKTKARsmslkvsnsssKDDVQVGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESalllhqadwllwllhgklglSDYNNALKVGYDPELESYppwllsqpysqllpsvqAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSQISCSSDCRTGNLGDIFC
****YIMLASISARSLTISSLF*********************************************VGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSQISCSSDCRTGNLG****
**GTYIMLASISARSLTISSLFLSSS*********************************************LYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSQISCSSDCRTGNLGDIFC
PRGTYIMLASISARSLTISSLFLSSSSPKYGRCKSRNLMSETE**********************VQVGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSQISCSSDCRTGNLGDIFC
PRGTYIMLASISARSLTISSLFLSSSSPKYGR*****LMSETESWNKTKARSMSLKVSNS*******VGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSQISCSSDCRTGNLGDIFC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PRGTYIMLASISARSLTISSLFLSSSSPKYGRCKSRNLMSETESWNKTKARSMSLKVSNSSSKDDVQVGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWKPTEHQTIVFLCICIVINNKFSQISCSSDCRTGNLGDIFC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query333 2.2.26 [Sep-21-2011]
A8F679 499 Glycerol kinase OS=Thermo yes no 0.609 0.406 0.256 3e-05
A9KQC2 499 Glycerol kinase OS=Clostr yes no 0.606 0.404 0.251 3e-05
Q3K7I5 500 Glycerol kinase OS=Pseudo yes no 0.597 0.398 0.217 4e-05
A4J8E6 501 Glycerol kinase OS=Desulf yes no 0.678 0.451 0.252 4e-05
B0K754 497 Glycerol kinase OS=Thermo yes no 0.588 0.394 0.267 5e-05
C0QVC0 494 Glycerol kinase OS=Brachy yes no 0.483 0.325 0.240 7e-05
A8Z1X0 498 Glycerol kinase OS=Staphy yes no 0.597 0.399 0.262 7e-05
A6QGJ8 498 Glycerol kinase OS=Staphy yes no 0.597 0.399 0.262 7e-05
Q5HGD2 498 Glycerol kinase OS=Staphy yes no 0.597 0.399 0.262 7e-05
Q2FYZ5 498 Glycerol kinase OS=Staphy yes no 0.597 0.399 0.262 7e-05
>sp|A8F679|GLPK_THELT Glycerol kinase OS=Thermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / TMO) GN=glpK PE=3 SV=1 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 100/238 (42%), Gaps = 35/238 (14%)

Query: 68  VGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTE------ESIDWLRSWKVTL 121
           + E+  L +D GT+ +R  I N+ G  +    +E+P+   E      + +D + S     
Sbjct: 1   MAEKYILALDQGTTSSRAIIFNQAGETVCMVNQEFPQLYPEPGWVEHDPVDIIESQISVA 60

Query: 122 FSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYN-----ESCPD--ALP 174
              +E   +N    IA+I +     TTI+ D N+ +P++   ++        C     L 
Sbjct: 61  KKAIEIASINPDQ-IAAIGVTNQRETTIVWDKNTSKPVYNAIVWQCRRTASMCDQFKKLG 119

Query: 175 VVKSIAPANHTVCSGTSTLCKLVSWW--NTEGENRES---ALLLHQAD-WLLW-LLHGKL 227
              +I      V     +  KL  W   N EG  +++    LL    D WL+W L  GK+
Sbjct: 120 YEDTIRKKTGLVLDAYFSATKL-KWILDNVEGARQKAERGELLFGTVDSWLIWNLTGGKI 178

Query: 228 GLSDYNNALK--------VGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGI 277
             +DY+NA +        + +D EL      L + P  Q+LP V    T  GY  + I
Sbjct: 179 HATDYSNASRTMLFNIHSLNWDEELLE----LFNIP-EQMLPDVLPSSTVYGYTHKEI 231
Key enzyme in the regulation of glycerol uptake and metabolism.
Thermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / TMO) (taxid: 416591)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 3EC: 0
>sp|A9KQC2|GLPK_CLOPH Glycerol kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=glpK PE=3 SV=1 Back     alignment and function description
>sp|Q3K7I5|GLPK_PSEPF Glycerol kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=glpK PE=3 SV=1 Back     alignment and function description
>sp|A4J8E6|GLPK_DESRM Glycerol kinase OS=Desulfotomaculum reducens (strain MI-1) GN=glpK PE=3 SV=1 Back     alignment and function description
>sp|B0K754|GLPK_THEP3 Glycerol kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glpK PE=3 SV=1 Back     alignment and function description
>sp|C0QVC0|GLPK_BRAHW Glycerol kinase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=glpK PE=3 SV=1 Back     alignment and function description
>sp|A8Z1X0|GLPK_STAAT Glycerol kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glpK PE=3 SV=1 Back     alignment and function description
>sp|A6QGJ8|GLPK_STAAE Glycerol kinase OS=Staphylococcus aureus (strain Newman) GN=glpK PE=3 SV=1 Back     alignment and function description
>sp|Q5HGD2|GLPK_STAAC Glycerol kinase OS=Staphylococcus aureus (strain COL) GN=glpK PE=1 SV=1 Back     alignment and function description
>sp|Q2FYZ5|GLPK_STAA8 Glycerol kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=glpK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
297744751 518 unnamed protein product [Vitis vinifera] 0.822 0.528 0.676 1e-103
224105323 439 predicted protein [Populus trichocarpa] 0.684 0.519 0.774 1e-103
359474918 447 PREDICTED: xylulose kinase-like [Vitis v 0.687 0.512 0.760 1e-102
255543821 435 xylulose kinase, putative [Ricinus commu 0.681 0.521 0.757 1e-101
449464860 468 PREDICTED: xylulose kinase-like [Cucumis 0.651 0.463 0.764 8e-98
449521675 435 PREDICTED: LOW QUALITY PROTEIN: xylulose 0.663 0.508 0.745 5e-96
357473461336 hypothetical protein MTR_4g071230 [Medic 0.714 0.708 0.713 2e-94
357473463337 hypothetical protein MTR_4g071230 [Medic 0.747 0.738 0.694 3e-94
356538722 474 PREDICTED: xylulose kinase-like [Glycine 0.786 0.552 0.629 3e-93
30681377 478 xylulose kinase-1 [Arabidopsis thaliana] 0.642 0.447 0.747 8e-92
>gi|297744751|emb|CBI38013.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/291 (67%), Positives = 232/291 (79%), Gaps = 17/291 (5%)

Query: 3   GTYIMLASISARSLTISSLFLSSSSPKYGRCKS-----RNLMSETESWNKTKARSMSLKV 57
           G   M ASI   + +  SL   S+  K G C S     R+ + +T +  K KAR M   +
Sbjct: 22  GRREMHASIQQPTCSFPSLCPPSA--KQGCCNSKKPFWRHQLHKTAT--KAKARMM---M 74

Query: 58  SNSSSKDDV----QVGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPK-FTTEESID 112
           +  S+KDD     QVG RLYLGMDFGTSGARF +I+K GTI ++GK+EYP  + +EE++D
Sbjct: 75  NPGSNKDDGEVSGQVGHRLYLGMDFGTSGARFVLIDKQGTIQAQGKREYPLLYMSEETMD 134

Query: 113 WLRSWKVTLFSLLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDA 172
           W+ SWK TLFSLLE VPV+LRPLIASISIDGTSATT+IIDS +GEPLWRPFLYNESCPDA
Sbjct: 135 WVSSWKKTLFSLLEDVPVSLRPLIASISIDGTSATTLIIDSTTGEPLWRPFLYNESCPDA 194

Query: 173 LPVVKSIAPANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDY 232
           LP+VKSIAPANHTVCSG+STLCKLVSWWN++  N+E ALLLHQADWLLWLLHGKLG+SDY
Sbjct: 195 LPIVKSIAPANHTVCSGSSTLCKLVSWWNSDDSNKEHALLLHQADWLLWLLHGKLGISDY 254

Query: 233 NNALKVGYDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGM 283
           NNALKVGYDPE +SYP WLLSQPYS++LPSV+APG SIGYL+E IRT+FG 
Sbjct: 255 NNALKVGYDPEHDSYPSWLLSQPYSRVLPSVKAPGASIGYLQEDIRTQFGF 305

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224105323|ref|XP_002313768.1| predicted protein [Populus trichocarpa] gi|222850176|gb|EEE87723.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359474918|ref|XP_002265772.2| PREDICTED: xylulose kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255543821|ref|XP_002512973.1| xylulose kinase, putative [Ricinus communis] gi|223547984|gb|EEF49476.1| xylulose kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449464860|ref|XP_004150147.1| PREDICTED: xylulose kinase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449521675|ref|XP_004167855.1| PREDICTED: LOW QUALITY PROTEIN: xylulose kinase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357473461|ref|XP_003607015.1| hypothetical protein MTR_4g071230 [Medicago truncatula] gi|355508070|gb|AES89212.1| hypothetical protein MTR_4g071230 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357473463|ref|XP_003607016.1| hypothetical protein MTR_4g071230 [Medicago truncatula] gi|355508071|gb|AES89213.1| hypothetical protein MTR_4g071230 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356538722|ref|XP_003537850.1| PREDICTED: xylulose kinase-like [Glycine max] Back     alignment and taxonomy information
>gi|30681377|ref|NP_179732.2| xylulose kinase-1 [Arabidopsis thaliana] gi|22531118|gb|AAM97063.1| putative xylulose kinase [Arabidopsis thaliana] gi|23198004|gb|AAN15529.1| putative xylulose kinase [Arabidopsis thaliana] gi|51969456|dbj|BAD43420.1| xylulose kinase like protein [Arabidopsis thaliana] gi|330252072|gb|AEC07166.1| xylulose kinase-1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
TAIR|locus:2050029 478 XK-1 "AT2G21370" [Arabidopsis 0.639 0.445 0.605 6.7e-65
TAIR|locus:2050029 XK-1 "AT2G21370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 661 (237.7 bits), Expect = 6.7e-65, P = 6.7e-65
 Identities = 129/213 (60%), Positives = 149/213 (69%)

Query:    70 ERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTTEESIDWLRSWKVTLFSLLEAVP 129
             E+LYLGMDFGTSG RF +I++ G I ++GK+EYP F  EES+ W  SWK TLFSLLE +P
Sbjct:    53 EKLYLGMDFGTSGGRFTVIDEQGEIKAQGKREYPPFMKEESMGWASSWKATLFSLLEDIP 112

Query:   130 VNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSIAPANHTVCSG 189
             V +R L++SIS+DGTSATT+I++S SGE L +P+LYN+SCPDALP VKSIAPANHTVCSG
Sbjct:   113 VTVRSLVSSISLDGTSATTLILNSESGEVLCQPYLYNQSCPDALPEVKSIAPANHTVCSG 172

Query:   190 TSTLCKLVSWWNTEGENRESXXXXXXXXXXXXXXXXXXXXSDYNNALKVGYDPELESYXX 249
             TSTLCKLVSWWNTE  NRES                    SDYNNALKVGYDPE ESY  
Sbjct:   173 TSTLCKLVSWWNTEVPNRESAVLLHQADWLLWLLHGRLGVSDYNNALKVGYDPESESYPS 232

Query:   250 XXXXXXXXXXXXXXXAPGTSIGYLKEGIRTEFG 282
                            APGTSIG LKE    +FG
Sbjct:   233 WLLGQPYSQLLPKVQAPGTSIGNLKESFTRQFG 265


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.134   0.426    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      333       272   0.00099  114 3  11 22  0.50    33
                                                     32  0.40    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  616 (65 KB)
  Total size of DFA:  230 KB (2125 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  20.53u 0.09s 20.62t   Elapsed:  00:00:01
  Total cpu time:  20.53u 0.09s 20.62t   Elapsed:  00:00:01
  Start:  Mon May 20 22:21:27 2013   End:  Mon May 20 22:21:28 2013
GO:0004856 "xylulokinase activity" evidence=ISS;IDA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009536 "plastid" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
COG1070 502 COG1070, XylB, Sugar (pentulose and hexulose) kina 3e-21
cd07803 482 cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup 1e-11
cd00366 435 cd00366, FGGY, FGGY family of carbohydrate kinases 6e-11
cd07768 465 cd07768, FGGY_RBK_like, Ribulokinase-like carbohyd 3e-09
pfam00370245 pfam00370, FGGY_N, FGGY family of carbohydrate kin 4e-09
cd07804 492 cd07804, FGGY_XK_like_1, uncharacterized xylulose 2e-06
cd07783 484 cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase 3e-06
cd07811 493 cd07811, FGGY_D-XK_3, D-xylulose kinases, subgroup 1e-05
cd07781 498 cd07781, FGGY_RBK, Ribulokinases; belongs to the F 2e-05
COG1069 544 COG1069, AraB, Ribulose kinase [Energy production 3e-05
cd07779 488 cd07779, FGGY_ygcE_like, uncharacterized ygcE-like 6e-05
cd07805 514 cd07805, FGGY_XK_like_2, uncharacterized xylulose 1e-04
TIGR01311 493 TIGR01311, glycerol_kin, glycerol kinase 4e-04
TIGR01312 481 TIGR01312, XylB, D-xylulose kinase 6e-04
cd07774 430 cd07774, FGGY_1, uncharacterized subgroup; belongs 6e-04
cd07786 486 cd07786, FGGY_EcGK_like, Escherichia coli glycerol 0.002
COG0554 499 COG0554, GlpK, Glycerol kinase [Energy production 0.002
>gnl|CDD|223996 COG1070, XylB, Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score = 94.0 bits (234), Expect = 3e-21
 Identities = 58/234 (24%), Positives = 94/234 (40%), Gaps = 26/234 (11%)

Query: 71  RLYLGMDFGTSGARFAIINKD-GTILSEGKKEYPKFT-----TEESIDWLRSW-KVTLFS 123
           +  LG+D GT+  +  + ++D G +++  + E P  T      E+  D L       L  
Sbjct: 4   KYVLGIDIGTTSVKAVLFDEDGGEVVATARFENPVSTPQPGWAEQDPDELWQAILEALRQ 63

Query: 124 LLEAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALPVVKSI---- 179
           LLE   ++    IA+I I G     +++D+N GEPL    L+N     A   V+ +    
Sbjct: 64  LLEESKIDPD-AIAAIGISGQGHGLVLLDAN-GEPLRPAILWN--DTRAAEEVEELEERL 119

Query: 180 APANHTVCSG-----TSTLCKLVSWW--NTEGENRESALLLHQADWLLWLLHGKLGLSDY 232
                   +G       T  KL+ W   N      ++A +L   D+L + L G+      
Sbjct: 120 GGEALYARTGLQAMPGFTAPKLL-WLKENEPDLFAKAAKILLIKDYLRYRLTGEFATEIS 178

Query: 233 NNALKVGYDPELESYPPWLLSQ---PYSQLLPSVQAPGTSIGYLKEGIRTEFGM 283
           + +     D     +   LL+    P   LLP V  PG  +G L      E G+
Sbjct: 179 DASGTGLLDIRTRKWDWELLAALGLPERDLLPPVVEPGEVLGTLTPEAAEELGL 232

Length = 502
>gnl|CDD|198371 cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|212658 cd00366, FGGY, FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198346 cd07768, FGGY_RBK_like, Ribulokinase-like carbohydrate kinases; a subfamily of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|215880 pfam00370, FGGY_N, FGGY family of carbohydrate kinases, N-terminal domain Back     alignment and domain information
>gnl|CDD|198372 cd07804, FGGY_XK_like_1, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198360 cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase and ribulose-phosphate 3-epimerase fusion proteins-like; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198377 cd07811, FGGY_D-XK_3, D-xylulose kinases, subgroup 3; members of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198358 cd07781, FGGY_RBK, Ribulokinases; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|223995 COG1069, AraB, Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|212662 cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins Back     alignment and domain information
>gnl|CDD|198373 cd07805, FGGY_XK_like_2, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|233353 TIGR01311, glycerol_kin, glycerol kinase Back     alignment and domain information
>gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|198352 cd07774, FGGY_1, uncharacterized subgroup; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198361 cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|223628 COG0554, GlpK, Glycerol kinase [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 333
PF00370245 FGGY_N: FGGY family of carbohydrate kinases, N-ter 100.0
PRK10331 470 L-fuculokinase; Provisional 100.0
COG1070 502 XylB Sugar (pentulose and hexulose) kinases [Carbo 100.0
TIGR01314 505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 100.0
TIGR02628 465 fuculo_kin_coli L-fuculokinase. Members of this fa 100.0
PRK15027 484 xylulokinase; Provisional 100.0
PRK10939 520 autoinducer-2 (AI-2) kinase; Provisional 100.0
PRK00047 498 glpK glycerol kinase; Provisional 100.0
PTZ00294 504 glycerol kinase-like protein; Provisional 100.0
PLN02669 556 xylulokinase 100.0
PLN02295 512 glycerol kinase 100.0
TIGR01234 536 L-ribulokinase L-ribulokinase. This enzyme catalyz 100.0
PRK04123 548 ribulokinase; Provisional 100.0
TIGR01315 541 5C_CHO_kinase FGGY-family pentulose kinase. This m 100.0
TIGR01311 493 glycerol_kin glycerol kinase. This model describes 100.0
TIGR01312 481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 100.0
COG0554 499 GlpK Glycerol kinase [Energy production and conver 100.0
TIGR02627 454 rhamnulo_kin rhamnulokinase. This model describes 100.0
COG1069 544 AraB Ribulose kinase [Energy production and conver 100.0
PRK10640 471 rhaB rhamnulokinase; Provisional 100.0
KOG2517 516 consensus Ribulose kinase and related carbohydrate 99.97
KOG2531 545 consensus Sugar (pentulose and hexulose) kinases [ 99.9
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 98.46
PRK13311256 N-acetyl-D-glucosamine kinase; Provisional 98.35
PRK09698302 D-allose kinase; Provisional 98.27
PRK09557301 fructokinase; Reviewed 98.24
PRK13310303 N-acetyl-D-glucosamine kinase; Provisional 98.22
COG1940314 NagC Transcriptional regulator/sugar kinase [Trans 98.07
PF00480179 ROK: ROK family; InterPro: IPR000600 A family of b 98.04
TIGR00744318 ROK_glcA_fam ROK family protein (putative glucokin 97.99
PRK12408336 glucokinase; Provisional 97.84
PRK00292316 glk glucokinase; Provisional 97.81
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF 97.8
PRK05082291 N-acetylmannosamine kinase; Provisional 97.78
PRK14101 638 bifunctional glucokinase/RpiR family transcription 97.58
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 97.48
PRK13318258 pantothenate kinase; Reviewed 97.45
PRK13321256 pantothenate kinase; Reviewed 97.45
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 97.23
COG2971301 Predicted N-acetylglucosamine kinase [Carbohydrate 97.19
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 97.18
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 96.93
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 96.93
TIGR02259 432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 96.6
PF05378176 Hydant_A_N: Hydantoinase/oxoprolinase N-terminal r 96.59
TIGR00749316 glk glucokinase, proteobacterial type. This model 96.5
PF14574 412 DUF4445: Domain of unknown function (DUF4445); PDB 96.1
PTZ00288 405 glucokinase 1; Provisional 96.05
smart00842187 FtsA Cell division protein FtsA. FtsA is essential 96.03
PF00349206 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo 95.95
PRK15080267 ethanolamine utilization protein EutJ; Provisional 95.75
PRK09472 420 ftsA cell division protein FtsA; Reviewed 95.51
TIGR01174 371 ftsA cell division protein FtsA. This bacterial ce 95.39
TIGR03123318 one_C_unchar_1 probable H4MPT-linked C1 transfer p 94.45
PRK13324258 pantothenate kinase; Reviewed 93.64
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 93.53
PRK13317277 pantothenate kinase; Provisional 93.3
PLN02914 490 hexokinase 93.3
TIGR02707351 butyr_kinase butyrate kinase. This model represent 93.2
KOG1794336 consensus N-Acetylglucosamine kinase [Carbohydrate 92.78
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 92.34
PLN02596 490 hexokinase-like 92.32
PLN02405 497 hexokinase 92.02
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 91.84
PRK13320244 pantothenate kinase; Reviewed 91.81
PF13941 457 MutL: MutL protein 91.77
COG4820277 EutJ Ethanolamine utilization protein, possible ch 91.54
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 91.43
TIGR00671243 baf pantothenate kinase, type III. This model desc 91.43
PLN02362 509 hexokinase 91.41
PRK13326262 pantothenate kinase; Reviewed 90.73
COG3734306 DgoK 2-keto-3-deoxy-galactonokinase [Carbohydrate 90.58
PTZ00107 464 hexokinase; Provisional 90.57
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 90.26
PF02685316 Glucokinase: Glucokinase; InterPro: IPR003836 Gluc 88.86
COG0849 418 ftsA Cell division ATPase FtsA [Cell division and 87.33
PRK13331251 pantothenate kinase; Reviewed 86.69
COG0145 674 HyuA N-methylhydantoinase A/acetone carboxylase, b 86.65
COG1521251 Pantothenate kinase type III (Bvg accessory factor 86.14
PRK10854 513 exopolyphosphatase; Provisional 83.0
PF07318343 DUF1464: Protein of unknown function (DUF1464); In 82.54
COG4020332 Uncharacterized protein conserved in archaea [Func 80.75
PLN02666 1275 5-oxoprolinase 80.58
>PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information 
Probab=100.00  E-value=2.8e-50  Score=370.77  Aligned_cols=228  Identities=23%  Similarity=0.365  Sum_probs=203.5

Q ss_pred             eEEEEEeCccCceEEEEeCCCcEEEEEEEeecCcCC--ccccccHHHHHHHHHHHHHhchhc---CCCCccEEEEecCCc
Q 037497           72 LYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFTT--EESIDWLRSWKVTLFSLLEAVPVN---LRPLIASISIDGTSA  146 (333)
Q Consensus        72 ~~lGIDiGTTsiKa~l~D~~G~il~~~~~~~~~~~p--g~~e~d~~~~~~~i~~~l~~l~~~---~~~~I~aIgis~~~~  146 (333)
                      |+||||+|||++|++|+|++|++++..+++++...+  |+.++|+++||+.+.++++++.++   ...+|.+|+++++++
T Consensus         1 y~lgiDiGTts~K~~l~d~~g~iv~~~~~~~~~~~~~~g~~e~d~~~~~~~~~~~~~~~~~~~~~~~~~I~aI~is~~~~   80 (245)
T PF00370_consen    1 YYLGIDIGTTSVKAVLFDEDGKIVASASRPYPYYTPEPGWAEQDPDEIWEAICEALKELLSQAGIDPEQIKAIGISGQGH   80 (245)
T ss_dssp             EEEEEEECSSEEEEEEEETTSCEEEEEEEEETEBCSSTTEEEE-HHHHHHHHHHHHHHHHHHCTSCGGGEEEEEEEE-SS
T ss_pred             CEEEEEEcccceEEEEEeCCCCEEEEEEEeeeeccccccccccChHHHHHHHHHHHHHHHhhcCcccceeEEEEeccccC
Confidence            799999999999999999999999999999987764  778999999999999999988764   357899999999999


Q ss_pred             eEEEEeCCCCccccCCcccCCChH-HHHHHHHH------hccCCCCCCCChhHHHHHHHHHHHcCcc--cccceeeehHH
Q 037497          147 TTIIIDSNSGEPLWRPFLYNESCP-DALPVVKS------IAPANHTVCSGTSTLCKLVSWWNTEGEN--RESALLLHQAD  217 (333)
Q Consensus       147 s~v~vD~~~G~pl~p~i~W~D~R~-~~~~~l~~------~~~~~g~~~~~~~~l~kll~Wl~~~~Pe--~k~~~~l~~~d  217 (333)
                      +++++|+ +|+|++|+++|+|.|+ ++++++.+      +++.+|.++++.++++||+ ||++|+|+  +++++|+++.|
T Consensus        81 ~~v~~D~-~~~pl~~~i~w~D~R~~~~~~~l~~~~~~~~~~~~tG~~~~~~~~~~kl~-wl~~~~p~~~~~~~~~~~~~d  158 (245)
T PF00370_consen   81 GLVLLDK-DGKPLRPAILWMDTRAAEEAEELNEEGSPEEIYEKTGLPLSPGYPLAKLL-WLKENEPEIFEKAAKFLTLSD  158 (245)
T ss_dssp             EEEEEET-TSSBSSCEE-TT-CTTHHHHHHHHHHTHHHHHHHHHSS-SSTTSHHHHHH-HHHHHSHHHHHHHHEEEEHHH
T ss_pred             Ccceecc-ccccccccccccccchhhHHHHHHhhcCcceeeeeccccccccchHHHHH-HHHHhCchhhhhhhhcccHHH
Confidence            9999999 9999999999999994 67776643      4567888889999999999 99999999  99999999999


Q ss_pred             HHHHHHhcccceeehhhhhhcC-ccCCCCCCChHhhCC--CcCCCCCCCcCCCccccccCHHHHHHhCCCCCceEEEcCc
Q 037497          218 WLLWLLHGKLGLSDYNNALKVG-YDPELESYPPWLLSQ--PYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWWK  294 (333)
Q Consensus       218 yl~~~LTG~~~~~d~S~As~tg-~d~~~~~W~~~ll~~--~~~~~LP~vv~~g~~iG~l~~~~A~~~GL~~g~pV~~G~~  294 (333)
                      ||.|+|||+.+ +|+|+|+++| ||+++++|++++++.  ++.++||+|+++++++|++++++|+++||++|+||++|++
T Consensus       159 yl~~~LtG~~~-~d~s~as~tgl~d~~~~~w~~~~l~~~gi~~~~lP~i~~~g~~~G~~~~~~a~~~Gl~~~~pV~~g~~  237 (245)
T PF00370_consen  159 YLAYKLTGRAA-TDYSNASRTGLYDIRTGQWDEELLEALGIPEELLPEIVPPGEIIGTLTPEAAKELGLPEGTPVIAGGG  237 (245)
T ss_dssp             HHHHHHHSC-E-EEHHHHCTSSSEETTTTEE-HHHHHHTTSGGGGSCEEE-TTSEEEEEEHHHHHHHTSTTTEEEEEEEE
T ss_pred             HHHhhcccccc-ccccchhccccccccccccCHHHHHhhCCChhhCCcEecCCCeeEEECHHHHHHhCCCCCCEEEEEch
Confidence            99999999998 9999999999 999999999999985  5678999999999999999999999999999999999999


Q ss_pred             chHHhhhh
Q 037497          295 PTEHQTIV  302 (333)
Q Consensus       295 D~~aa~~g  302 (333)
                      |++|+++|
T Consensus       238 D~~aa~lG  245 (245)
T PF00370_consen  238 DQAAAALG  245 (245)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHhhcC
Confidence            99999887

These enzymes include L-fucolokinase (2.7.1.51 from EC) (gene fucK); gluconokinase (2.7.1.12 from EC) (gene gntK); glycerol kinase (2.7.1.30 from EC) (gene glpK); xylulokinase (2.7.1.17 from EC) (gene xylB); and L-xylulose kinase (2.7.1.53 from EC) (gene lyxK). These enzymes are proteins of from 480 to 520 amino acid residues. This entry represents the N-terminal domain of these proteins. It adopts a ribonuclease H-like fold and is structurally related to the C-terminal domain [, ].; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0005975 carbohydrate metabolic process; PDB: 3G25_D 3GE1_D 2NLX_A 2ITM_A 2ZF5_Y 3L0Q_B 3GG4_B 3I8B_A 3H3O_C 3FLC_X ....
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>KOG2517 consensus Ribulose kinase and related carbohydrate kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2531 consensus Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>PRK13311 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00480 ROK: ROK family; InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames [] Back     alignment and domain information
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) Back     alignment and domain information
>PRK12408 glucokinase; Provisional Back     alignment and domain information
>PRK00292 glk glucokinase; Provisional Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>PRK13318 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>COG2971 Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>PF05378 Hydant_A_N: Hydantoinase/oxoprolinase N-terminal region; InterPro: IPR008040 This domain is found at the N terminus of the hydantoinase/oxoprolinase IPR002821 from INTERPRO family Back     alignment and domain information
>TIGR00749 glk glucokinase, proteobacterial type Back     alignment and domain information
>PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X Back     alignment and domain information
>PTZ00288 glucokinase 1; Provisional Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information
>PRK13324 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>PLN02914 hexokinase Back     alignment and domain information
>TIGR02707 butyr_kinase butyrate kinase Back     alignment and domain information
>KOG1794 consensus N-Acetylglucosamine kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>PLN02596 hexokinase-like Back     alignment and domain information
>PLN02405 hexokinase Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PRK13320 pantothenate kinase; Reviewed Back     alignment and domain information
>PF13941 MutL: MutL protein Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>TIGR00671 baf pantothenate kinase, type III Back     alignment and domain information
>PLN02362 hexokinase Back     alignment and domain information
>PRK13326 pantothenate kinase; Reviewed Back     alignment and domain information
>COG3734 DgoK 2-keto-3-deoxy-galactonokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00107 hexokinase; Provisional Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF02685 Glucokinase: Glucokinase; InterPro: IPR003836 Glucokinases 2 Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13331 pantothenate kinase; Reviewed Back     alignment and domain information
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription] Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>PF07318 DUF1464: Protein of unknown function (DUF1464); InterPro: IPR009927 This family consists of several hypothetical archaeal proteins of around 350 residues in length Back     alignment and domain information
>COG4020 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PLN02666 5-oxoprolinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
3h6e_A 482 Carbohydrate kinase, FGGY; novosphingobium aromati 7e-18
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 3e-14
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 8e-14
3ifr_A 508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 4e-13
2uyt_A 489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 9e-13
2itm_A 484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 1e-12
3hz6_A 511 Xylulokinase; xylulose, structural genomic, chromo 8e-11
3ll3_A 504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
3i8b_A 515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 2e-06
1z05_A429 Transcriptional regulator, ROK family; structural 9e-05
1z6r_A406 MLC protein; transcriptional repressor, ROK family 2e-04
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Length = 482 Back     alignment and structure
 Score = 82.9 bits (205), Expect = 7e-18
 Identities = 35/226 (15%), Positives = 73/226 (32%), Gaps = 21/226 (9%)

Query: 70  ERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKF----TTEESIDWLRSWKVTLFSLL 125
               + +D G + ++ ++ + DG +L    +                     +  L  L 
Sbjct: 5   TGATIVIDLGKTLSKVSLWDLDGRMLDRQVRPSIPLEIDGIRRLDAPDT--GRWLLDVLS 62

Query: 126 EAVPVNLRPLIASISIDGTSATTIIIDSNSGEPLWRPFLYNESCPDALP-VVKSIAP--- 181
                     + +I   G  A    +    G   + P  Y +S P+A+    +S      
Sbjct: 63  RY----ADHPVTTIVPVGHGAGIAALT--DGRLAFPPLDYEQSIPEAVMADYRSQRDPFA 116

Query: 182 --ANHTVCSGTSTLCKLVSWWNTEGENRESALLLHQADWLLWLLHGKLGLSDYNNALKVG 239
              +  +  G +   +L        +   +A LL  A +  W L G+   S+  +     
Sbjct: 117 RTGSPALPDGLNIGSQLWWLDQLHPDVMANATLLPWAQYWAWFLTGRAV-SEVTSLGCHS 175

Query: 240 --YDPELESYPPWLLSQPYSQLLPSVQAPGTSIGYLKEGIRTEFGM 283
             +DP+   + P      ++     +   G ++G L   I    G+
Sbjct: 176 DLWDPQDGDFSPMAKRLGWAARFAPIVRAGDTVGALLPAIAERTGL 221
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Length = 554 Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Length = 508 Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Length = 489 Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511 Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Length = 504 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Length = 429 Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Length = 406 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
3ll3_A 504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 100.0
3hz6_A 511 Xylulokinase; xylulose, structural genomic, chromo 100.0
3ifr_A 508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 100.0
2itm_A 484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 100.0
3h6e_A 482 Carbohydrate kinase, FGGY; novosphingobium aromati 100.0
4bc3_A 538 Xylulose kinase; transferase, glucuronate xyluloki 100.0
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 100.0
4e1j_A 520 Glycerol kinase; structural genomics, PSI-biology, 100.0
3i8b_A 515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 100.0
3h3n_X 506 Glycerol kinase; ATP-binding, glycerol metabolism, 100.0
2p3r_A 510 Glycerol kinase; glycerol metabolism, allosteric r 100.0
3g25_A 501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 100.0
2zf5_O 497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 100.0
2dpn_A 495 Glycerol kinase; thermus thermophilus HB8, structu 100.0
3ezw_A 526 Glycerol kinase; glycerol metabolism, allosteric r 100.0
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 100.0
2w40_A 503 Glycerol kinase, putative; closed conformation, ma 100.0
2uyt_A 489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 100.0
2d4w_A 504 Glycerol kinase; alpha and beta protein, ribonucle 100.0
2qm1_A326 Glucokinase; alpha-beta structure, putative helix- 98.8
3vgl_A321 Glucokinase; ROK family, transferase; HET: BGC ANP 98.67
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural gen 98.67
4db3_A327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 98.63
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 98.63
1z05_A429 Transcriptional regulator, ROK family; structural 98.59
2yhw_A343 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N 98.54
1z6r_A406 MLC protein; transcriptional repressor, ROK family 98.53
3htv_A310 D-allose kinase, allokinase; NP_418508.1, structur 98.53
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, gl 98.5
1zc6_A305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_ 98.42
2ap1_A327 Putative regulator protein; zinc binding protein, 98.42
4htl_A297 Beta-glucoside kinase; structural genomics, sugar 98.41
3vov_A302 Glucokinase, hexokinase; ROK, sugar kinase, transf 98.38
3epq_A302 Putative fructokinase; SCRK, ADP binding, PSI2, MC 98.33
1woq_A267 Inorganic polyphosphate/ATP-glucomannokinase; tran 98.33
2aa4_A289 Mannac kinase, putative N-acetylmannosamine kinase 98.32
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, acti 98.3
3mcp_A 366 Glucokinase; structural genomics, joint center for 98.27
2gup_A292 ROK family protein; sugar kinase, streptococcus pn 98.17
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 98.15
3lm2_A226 Putative kinase; structural genomics, joint center 98.09
1zbs_A291 Hypothetical protein PG1100; alpha-beta protein., 97.99
2q2r_A373 Glucokinase 1, putative; ATPase hexose kinase fami 97.82
1sz2_A332 Glucokinase, glucose kinase; ATP-dependent, glucos 97.8
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 97.67
1zxo_A291 Conserved hypothetical protein Q8A1P1; NESG, BTR25 97.64
2yhx_A 457 Hexokinase B; transferase(phosphoryl,alcohol accep 97.49
1saz_A 381 Probable butyrate kinase 2; askha (acetate and sug 97.37
3djc_A266 Type III pantothenate kinase; structural genomics, 97.35
1bdg_A 451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 97.25
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 97.12
3bex_A249 Type III pantothenate kinase; actin-like fold, ATP 96.95
1cza_N 917 Hexokinase type I; structurally homologous domains 96.9
3o8m_A 485 Hexokinase; rnaseh-like fold, glycolysis, glucose 96.65
2h3g_X268 Biosynthetic protein; pantothenate kinase, anthrax 96.52
1cza_N 917 Hexokinase type I; structurally homologous domains 96.38
4a2a_A 419 Cell division protein FTSA, putative; cell cycle, 95.37
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 95.26
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 94.87
3t69_A330 Putative 2-dehydro-3-deoxygalactonokinase; structu 94.23
3hm8_A 445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 94.16
3f9m_A 470 Glucokinase; hexokinase IV, ATP-binding, diabetes 93.82
3nuw_A295 2-OXO-3-deoxygalactonate kinase; structural genomi 92.98
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 92.06
3cet_A334 Conserved archaeal protein; Q6M145, MRR63, NESG, X 91.68
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops compl 90.02
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrol 87.36
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 85.15
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 85.0
2f9w_A271 Pantothenate kinase; COAA, transferase; HET: PAU; 84.76
3mdq_A315 Exopolyphosphatase; structural genomics, joint cen 84.33
1nbw_A 607 Glycerol dehydratase reactivase alpha subunit; mol 83.9
4gni_A 409 Putative heat shock protein; HSP70-type ATPase, AT 83.51
1vhx_A150 Putative holliday junction resolvase; structural g 82.47
3sk3_A 415 Acetate kinase, acetokinase; actin-like ATPase dom 80.72
3bzc_A 785 TEX; helix-turn-helix, helix-hairpin-helix, S1 dom 80.65
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 80.3
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-51  Score=413.06  Aligned_cols=263  Identities=17%  Similarity=0.194  Sum_probs=231.7

Q ss_pred             cCCceEEEEEeCccCceEEEEeCCCcEEEEEEEeecCcC--CccccccHHHHHHHHHHHHHhchhcCCCCccEEEEecCC
Q 037497           68 VGERLYLGMDFGTSGARFAIINKDGTILSEGKKEYPKFT--TEESIDWLRSWKVTLFSLLEAVPVNLRPLIASISIDGTS  145 (333)
Q Consensus        68 M~~~~~lGIDiGTTsiKa~l~D~~G~il~~~~~~~~~~~--pg~~e~d~~~~~~~i~~~l~~l~~~~~~~I~aIgis~~~  145 (333)
                      |+|+|+||||+|||++|++|+|.+|+++++.+.+++..+  ||+.|||+++||+++.++++++..+...+|.+|||++|+
T Consensus         1 M~m~~~lgIDiGtts~K~~l~d~~G~il~~~~~~~~~~~p~~g~~e~dp~~~~~~~~~~i~~~~~~~~~~I~~Igis~q~   80 (504)
T 3ll3_A            1 MSLKYIIGMDVGTTATKGVLYDINGKAVASVSKGYPLIQTKVGQAEEDPKLIFDAVQEIIFDLTQKIDGKIAAISWSSQM   80 (504)
T ss_dssp             -CCEEEEEEEECSSEEEEEEEETTSCEEEEEEEECCCBCSSTTCCEECHHHHHHHHHHHHHHHHHTCSSEEEEEEEEECS
T ss_pred             CCCCEEEEEEecCCceEEEEEcCCCCEEEEEEeecceecCCCCcEEECHHHHHHHHHHHHHHHHHhCCCCeEEEEEECCC
Confidence            556899999999999999999999999999999998765  488999999999999999999876323679999999999


Q ss_pred             ceEEEEeCCCCccccCCcccCCChH-HHHHHHHH------hccCCCCCCCChhHHHHHHHHHHHcCcc--cccceeeehH
Q 037497          146 ATTIIIDSNSGEPLWRPFLYNESCP-DALPVVKS------IAPANHTVCSGTSTLCKLVSWWNTEGEN--RESALLLHQA  216 (333)
Q Consensus       146 ~s~v~vD~~~G~pl~p~i~W~D~R~-~~~~~l~~------~~~~~g~~~~~~~~l~kll~Wl~~~~Pe--~k~~~~l~~~  216 (333)
                      +++|+||+ +|+|++|+|+|+|.|+ ++++++.+      ++..+|.++++.++++||+ |+++|+|+  ++++++++++
T Consensus        81 ~~~v~~D~-~G~pl~~~i~W~D~R~~~~~~~l~~~~~~~~~~~~tG~~~~~~~~~~kl~-wl~~~~pe~~~~~~~~~~~~  158 (504)
T 3ll3_A           81 HSLIGLGS-DDELLTNSITWADNCAKSIVQDAKNRGFAQQIYRKTGMPMHPMAPIYKLL-WLKNKKTEVFSQAQKWIGIK  158 (504)
T ss_dssp             SCBEEECT-TSCBSSCEECTTCCTTHHHHHHHHHHTHHHHHHHHHCCCSCTTSHHHHHH-HHHHHCHHHHHHCCEEECHH
T ss_pred             CcEEEECC-CCCCcccceeCCccCHHHHHHHHHhccCHHHHHHHHCCCCCcccHHHHHH-HHHHcChHHHHHHhheeCHH
Confidence            99999999 9999999999999994 67777754      4566888889999999999 99999999  9999999999


Q ss_pred             HHHHHHHhcccceeehhhhhhcC-ccCCCCCCChHhhCC--CcCCCCCCCcCCCccccccCHHHHHHhCCCCCceEEEcC
Q 037497          217 DWLLWLLHGKLGLSDYNNALKVG-YDPELESYPPWLLSQ--PYSQLLPSVQAPGTSIGYLKEGIRTEFGMFLFHLTCHWW  293 (333)
Q Consensus       217 dyl~~~LTG~~~~~d~S~As~tg-~d~~~~~W~~~ll~~--~~~~~LP~vv~~g~~iG~l~~~~A~~~GL~~g~pV~~G~  293 (333)
                      |||.|+|||+.+ +|+|+|++|+ ||+++++|++++|+.  +++++||+|+++++++|+|++++|+++||++|+||++|+
T Consensus       159 dyl~~~LTG~~~-~d~s~As~t~l~d~~~~~W~~~ll~~~gi~~~~LP~i~~~~~~~G~l~~~~a~~~Gl~~g~pV~~g~  237 (504)
T 3ll3_A          159 EYIIFRLTGKLV-TDTTMAAGTGILNLKTLTWDQELLDILKIKKEQLPKIAQPTKVIFPIKTEYVKKLGIDSDTKIILGA  237 (504)
T ss_dssp             HHHHHHHHSCCE-EEHHHHTTTTCBCTTTSSBCHHHHHHHTCCGGGSCEEECTTCEECCCCHHHHHHHTCCTTCEEEEEE
T ss_pred             HHHHHHHhCCcc-cchhHhhcccCeeCCCCCcCHHHHHHcCCCHHHCCCeeCCcceeeccCHHHHHhcCCCcCCCEEEEc
Confidence            999999999998 9999999999 999999999999986  557899999999999999999999999999999999999


Q ss_pred             cchHHhhhhhcceeee----ecCeEEEE-EecCCcccCCCCCccC
Q 037497          294 KPTEHQTIVFLCICIV----INNKFSQI-SCSSDCRTGNLGDIFC  333 (333)
Q Consensus       294 ~D~~aa~~g~g~~~~~----i~g~~~~i-s~~s~~~~~~~~~~~~  333 (333)
                      +|++++++|+|++..+    .-|+.+.+ ..+.....++.|.+||
T Consensus       238 ~D~~aa~~g~g~~~~g~~~~s~GTs~~~~~~~~~~~~~~~~~~~~  282 (504)
T 3ll3_A          238 SDGYLSTIGVNAIDSDHCALNVGTSGAIRTIVDQPKIDPSASYFC  282 (504)
T ss_dssp             EHHHHHHHTTTCCSTTEEEEEESSSEEEEEEESSCCCCTTCCSEE
T ss_pred             cHHHHHHHhCCCCCCCcEEEEechhhhheeeCCCcccCCCCceEE
Confidence            9999999999986422    34555444 3344445566777665
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes} Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>3lm2_A Putative kinase; structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2, transf; HET: MSE; 1.70A {Agrobacterium tumefaciens} Back     alignment and structure
>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} Back     alignment and structure
>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* Back     alignment and structure
>3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3t69_A Putative 2-dehydro-3-deoxygalactonokinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.55A {Sinorhizobium meliloti} Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>2f9w_A Pantothenate kinase; COAA, transferase; HET: PAU; 1.90A {Pseudomonas aeruginosa} SCOP: c.55.1.13 c.55.1.13 PDB: 2f9t_A* Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Back     alignment and structure
>3sk3_A Acetate kinase, acetokinase; actin-like ATPase domain, askha superfamily of phosphotransf acetokinase, ATP binding, phosphotransferase; HET: CIT; 1.90A {Salmonella enterica subsp} PDB: 3slc_A Back     alignment and structure
>3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 333
d2p3ra1252 c.55.1.4 (A:2-253) Glycerol kinase {Escherichia co 1e-20
d1r59o1252 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus c 3e-19
d1zc6a1114 c.55.1.5 (A:8-121) Probable N-acetylglucosamine ki 1e-04
d2ch5a2117 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAG 4e-04
>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Length = 252 Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Length = 114 Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
d2p3ra1252 Glycerol kinase {Escherichia coli [TaxId: 562]} 100.0
d1r59o1252 Glycerol kinase {Enterococcus casseliflavus [TaxId 100.0
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhim 99.13
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 99.06
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli 99.04
d2hoea3128 N-acetylglucosamine kinase {Thermotoga maritima [T 99.02
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumon 98.89
d1z05a3128 Transcriptional regulator VC2007 {Vibrio cholerae 98.8
d1woqa1129 Inorganic polyphosphate/ATP-glucomannokinase PPGMK 98.7
d1z6ra2129 Mlc protein {Escherichia coli [TaxId: 562]} 98.65
d1xc3a1118 Putative fructokinase YhdR {Bacillus subtilis [Tax 98.57
d2ch5a2117 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 98.56
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 98.3
d1sz2a1319 Glucokinase Glk {Escherichia coli [TaxId: 562]} 98.28
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 98.21
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 97.18
d1zbsa2107 Hypothetical protein PG1100 {Porphyromonas gingiva 96.77
d1bdga1208 Hexokinase {Blood fluke (Schistosoma mansoni) [Tax 96.2
d1ig8a1207 Hexokinase {Baker's yeast (Saccharomyces cerevisia 95.97
d1v4sa1205 Glucokinase {Human (Homo sapiens) [TaxId: 9606]} 95.6
d1czan3205 Mammalian type I hexokinase {Human (Homo sapiens) 95.51
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas 95.27
d1czan1207 Mammalian type I hexokinase {Human (Homo sapiens) 95.13
d3bexa1118 Type III pantothenate kinase, CoaX {Thermotoga mar 94.98
d1e4ft1193 Cell division protein FtsA {Thermotoga maritima [T 94.64
d1nbwa2239 ATPase domain of the glycerol dehydratase reactiva 92.71
d1t6ca1126 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 92.58
d1saza1172 butyrate kinase 2 {Thermotoga maritima [TaxId: 233 91.84
d1u6za2124 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 90.8
d2e1za1189 Propionate kinase {Salmonella typhimurium [TaxId: 88.76
d2d0oa2241 Diol dehydratase-reactivating factor large subunit 87.45
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 85.38
d2f9wa2114 Type III pantothenate kinase, CoaX {Pseudomonas ae 83.3
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 83.3
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 83.04
>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Back     information, alignment and structure
>d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u6za2 c.55.1.8 (A:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e1za1 c.55.1.2 (A:4-192) Propionate kinase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d0oa2 c.55.1.6 (A:1-92,A:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure