Citrus Sinensis ID: 037504


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MAHSAPLELHVYSNPPVEEIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFAEEKNNDGLTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGGYKEGIGRLCLTLPNFA
cccHHHHHHHHHccccHHHHcccccHHHHHHHcccHHHHHHHHHHcccHHHccccccccHHHHHHHHcccHHHHHHHHHHcHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
ccccccHHHHccccccHHHHHHccHHHHHHHHcccHHHHHHHHHcccHHHHHHHccccccHHHHHHHcccHHHHHHHHHHccccccccEEEccccccHHHHHHHcccHHHHHHHHHHccccccEcccccccccHHHHHHHcccHHHHHHHHHccccHccccccccHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccccHHHcHHHcccccHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHcHHHHHHHHHcccccccEEEEccccccccHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
mahsaplelhvysnppveeIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATmegneditmvpqddkdrmlpivgaaslghTEVVEFLYRETknslkdddCIELLVKLIETDSYETALHVLARKnltssnqnprGIFQRYFNLGAKAVENERALELVELLWENflfkypdliwkfdenghTIFHIAVSNRMREIFKFIFEISSVADLlfdskdkdgnnilhlagklpplnrlnIVSVAALQLQRELLWFQEVKKVVprkfaeeknndgltpgdlFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAaitvpggykegiGRLCLTLPNFA
mahsaplelhvysnppveeiRTRRLKLYRVALNgdwarakviydehKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAenldlakrnRIGCTALFYAAASGSVELVKATMEGNEDItmvpqddkdrMLPIVGAASLGHTEVVEFLYREtknslkddDCIELLVKLIETDSYETALHVLARknltssnqnprGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHlagklpplnrLNIVSVAALQLQRELLWFQEVKKVvprkfaeeknndgltpgdlFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGGYKEGIGRLCLTLPNFA
MAHSAPLELHVYSNPPVEEIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFAEEKNNDGLTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGGYKEGIGRLCLTLPNFA
**********VY***PVEEIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEG**DITM******DRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFA*******LTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGGYKEGIGRLCLTL****
MAHSAPLELHVYSNPPVEEIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFAE******************************NASSCMIVATLITTVVFGAAITVPGGYKEGIGRLCLT*P***
MAHSAPLELHVYSNPPVEEIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFAEEKNNDGLTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGGYKEGIGRLCLTLPNFA
******LEL*VYSNPPVEEIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFAEEKNNDGLTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGGYK*****LC*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHSAPLELHVYSNPPVEEIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHxxxxxxxxxxxxxxxxxxxxxNLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFAEEKNNDGLTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGGYKEGIGRLCLTLPNFA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query396 2.2.26 [Sep-21-2011]
Q9C7A2 590 Ankyrin repeat-containing no no 0.777 0.522 0.269 2e-13
Q6AWW5 524 Ankyrin repeat-containing no no 0.742 0.561 0.257 6e-10
Q99NH0 2603 Ankyrin repeat domain-con yes no 0.345 0.052 0.255 2e-06
Q5U312 978 Ankycorbin OS=Rattus norv yes no 0.214 0.086 0.372 3e-06
O75179 2603 Ankyrin repeat domain-con no no 0.345 0.052 0.248 5e-06
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.608 0.055 0.259 6e-06
Q5ZLC8 1073 Serine/threonine-protein no no 0.507 0.187 0.295 9e-06
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.608 0.122 0.255 9e-06
Q6F6B3 1849 Protein TANC1 OS=Rattus n no no 0.257 0.055 0.311 2e-05
Q0VGY8 1856 Protein TANC1 OS=Mus musc no no 0.257 0.054 0.293 2e-05
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 96/356 (26%), Positives = 155/356 (43%), Gaps = 48/356 (13%)

Query: 45  EHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAA 104
           E +  I + +  LG+TAL  AA    +D VK+L+K    E+  +AK+NR G   L  AA 
Sbjct: 116 EIRASIVNEVNELGETALFTAADKGHLDVVKELLKYSSRES--IAKKNRSGYDPLHIAAI 173

Query: 105 SGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCI 164
            G   +V+  ++   D T+          P+V AA  GHTEVV  L  +  N L+     
Sbjct: 174 QGHHAIVEVLLD--HDATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLE----- 226

Query: 165 ELLVKLIETDSYETALHVLARKN--------LTSSNQNPRGIFQRYFNLGAKAVENERAL 216
                 I   + + ALH+ AR+         L+   Q  R I ++       AV+ + + 
Sbjct: 227 ------ISRSNNKNALHLAARQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSS- 279

Query: 217 ELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDK 276
           E+V+LL    L   P ++ + D++ +T  H+A   +  EI + +    S+ D   ++  +
Sbjct: 280 EVVKLL----LDADPAIVMQPDKSCNTALHVATRKKRAEIVELLL---SLPDTNANTLTR 332

Query: 277 DGNNILHLAGKLP----------PLNRLNIVSVAALQLQRELL--WFQEVKKVVPRKFAE 324
           D    L +A  LP           L R   +    L   R+ L     ++K  V  +  +
Sbjct: 333 DHKTALDIAEGLPLSEESSYIKECLARSGALRANELNQPRDELRSTVTQIKNDVHIQLEQ 392

Query: 325 EKNNDGLTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAITVPGG 380
            K  +         KE  +L ++G   + +  +S  +VA L  TV F A  TVPGG
Sbjct: 393 TKRTNKNVHN--ISKELRKLHREG---INNATNSVTVVAVLFATVAFAAIFTVPGG 443





Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 Back     alignment and function description
>sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=2 SV=2 Back     alignment and function description
>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 Back     alignment and function description
>sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
224120488 610 predicted protein [Populus trichocarpa] 0.898 0.583 0.419 4e-78
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.962 0.482 0.397 1e-74
297737987 1855 unnamed protein product [Vitis vinifera] 0.954 0.203 0.395 2e-72
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.982 0.229 0.373 2e-71
359473665 602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.904 0.594 0.407 5e-71
225425076 563 PREDICTED: ankyrin repeat-containing pro 0.891 0.626 0.422 7e-71
297738255 532 unnamed protein product [Vitis vinifera] 0.896 0.667 0.407 2e-70
147810947 561 hypothetical protein VITISV_017115 [Viti 0.904 0.638 0.419 4e-69
356532648 739 PREDICTED: uncharacterized protein LOC10 0.901 0.483 0.375 7e-69
224136692 743 predicted protein [Populus trichocarpa] 0.883 0.471 0.386 4e-68
>gi|224120488|ref|XP_002331060.1| predicted protein [Populus trichocarpa] gi|222872990|gb|EEF10121.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  298 bits (762), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 178/424 (41%), Positives = 239/424 (56%), Gaps = 68/424 (16%)

Query: 21  RTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKK 80
           R R L+LY+ AL+GDW  A+ IY     E+   IT+ G+TALH+AAAA    FVK+LV  
Sbjct: 46  RKRHLQLYQAALSGDWDTAEGIYKLCPGEVNARITKRGETALHIAAAAEHTHFVKQLVGM 105

Query: 81  MKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAAS 140
           M  E L  A R+  G TA  +AA SG   L K  M+   D+ M     +  +LPI  A  
Sbjct: 106 MSIEAL--AYRSSAGNTAFCFAAISGVEALAKVMMDKKPDLAMT--RGRGNLLPIYMATL 161

Query: 141 LGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYE---------------------TA 179
           LGH  +V +LY ETK  L D D I+LLV LI +D Y+                     TA
Sbjct: 162 LGHRGMVSYLYDETKEQLTDGDRIKLLVALINSDIYDVAWKMLKEHRGLAYARDEHQLTA 221

Query: 180 LHVLARKNLTSSN---QNPRGIFQRYFNLGAKAVE-----NERALELVELLWENFLFK-- 229
           LH  ++K+   SN   Q+P G + +  N   K  +     +++AL+L++ LWE  +    
Sbjct: 222 LHAFSQKSCMPSNVVDQSPPGFWNKCLNPCFKLAQMKKLMHKQALDLIQYLWEQVVLLDD 281

Query: 230 --------------------------------YPDLIWKFDENGHTIFHIAVSNRMREIF 257
                                           YP+LI+K D+N ++IFHIA+ NR  +I 
Sbjct: 282 STISSQIGKPWPLIFTAAERGNLDLLTILIRLYPELIFKVDQNTYSIFHIAILNRHEDIL 341

Query: 258 KFIFEISSVADLLFDSKDKDGNNILHLAGK-LPPLNRLNIVSVAALQLQRELLWFQEVKK 316
           K I++I S+ +++   KD++GNN+LHLA K L   +RLN +  AALQLQRELLWF+EVKK
Sbjct: 342 KMIYQIGSIKNVMTIYKDREGNNMLHLAAKVLESPSRLNAIPGAALQLQRELLWFEEVKK 401

Query: 317 VVPRKFAEEKNNDGLTPGDLFIKEHEELKKKGETWVKDNASSCMIVATLITTVVFGAAIT 376
           VV  +  EEKN  G TPG LFI++H +L K+GE W++D A SCM+VATLI TVVF AA T
Sbjct: 402 VVQPRHIEEKNFHGKTPGALFIEQHRDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFT 461

Query: 377 VPGG 380
           VPGG
Sbjct: 462 VPGG 465




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738255|emb|CBI27456.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147810947|emb|CAN70012.1| hypothetical protein VITISV_017115 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532648|ref|XP_003534883.1| PREDICTED: uncharacterized protein LOC100814269 [Glycine max] Back     alignment and taxonomy information
>gi|224136692|ref|XP_002322392.1| predicted protein [Populus trichocarpa] gi|222869388|gb|EEF06519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
TAIR|locus:2080240 574 AT3G54070 "AT3G54070" [Arabido 0.813 0.560 0.345 8.4e-42
TAIR|locus:2165174 347 AT5G35810 "AT5G35810" [Arabido 0.406 0.463 0.493 2e-40
TAIR|locus:2175413 669 AT5G04700 "AT5G04700" [Arabido 0.398 0.236 0.420 2.9e-37
TAIR|locus:2180228 625 AT5G04690 "AT5G04690" [Arabido 0.409 0.259 0.414 4.4e-37
TAIR|locus:2175448 603 AT5G04730 "AT5G04730" [Arabido 0.373 0.245 0.422 8.3e-31
TAIR|locus:2165194282 AT5G35830 [Arabidopsis thalian 0.439 0.617 0.381 1.8e-23
TAIR|locus:2092522 590 ITN1 "INCREASED TOLERANCE TO N 0.805 0.540 0.271 1.2e-13
TAIR|locus:2075009 607 AT3G09550 [Arabidopsis thalian 0.767 0.500 0.260 5.6e-12
TAIR|locus:2181768 524 ANK1 "ankyrin-like1" [Arabidop 0.767 0.580 0.258 2.2e-10
TAIR|locus:2045233 662 AT2G31820 [Arabidopsis thalian 0.848 0.507 0.233 2e-09
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 443 (161.0 bits), Expect = 8.4e-42, P = 8.4e-42
 Identities = 118/342 (34%), Positives = 186/342 (54%)

Query:    58 GDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEG 117
             G+T L  AAA   I+  + L+  ++ +  D++    +  T +  AA  G  E+V+     
Sbjct:   120 GNTPLSFAAALGDIETAEMLINMIR-DLPDISNEKTM--TPIHIAALYGHGEMVQYLFSK 176

Query:   118 NEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKN-SLKDDDCIELLVK-LIETDS 175
                 T + +D  D+        +L HT +   +Y    +  L   + ++L  K L    +
Sbjct:   177 ----TSI-KDLNDQQY-----LNLFHTMISADIYGVFADVPLWMLERVDLYRKELALYPN 226

Query:   176 YETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIW 235
                ALH+LARK    S+++   +FQ+  +  +  + +   L  VE+L    +  + DL+W
Sbjct:   227 SNKALHLLARKTSAISHKSQLNLFQQVAS--SWLLFDAAELGNVEIL-VILIRSHLDLLW 283

Query:   236 KFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNN-ILHLAGKLPPLNRL 294
               D N  T+FH+A   R   IF  I+E+  + DL+   K+K   + +LHL  +LPP+NR 
Sbjct:   284 IVDNNNRTLFHVAALYRHENIFSLIYELGGIKDLIASYKEKQSKDTLLHLVARLPPMNRQ 343

Query:   295 NIVSVAALQLQRELLWFQEVKKVVPRKFAEEKNNDGLTPGDLFIKEHEELKKKGETWVKD 354
              + S AAL +Q+ELLWF+ VK++VPR + E KN  G    D+F ++HE L+K+GE W+K+
Sbjct:   344 QVGSGAALHMQKELLWFKAVKEIVPRSYIETKNTKGELAHDIFTEQHENLRKEGERWMKE 403

Query:   355 NASSCMIVATLITTVVFGAAITVPGGYKE-GIGRLCLTLPNF 395
              A++CM+ ATLI TVVF AAIT+PGG  + G     L  PNF
Sbjct:   404 TATACMLGATLIATVVFAAAITIPGGNDDSGDKANTLGFPNF 445


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165194 AT5G35830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181768 ANK1 "ankyrin-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-12
pfam13962114 pfam13962, PGG, Domain of unknown function 2e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 65.5 bits (160), Expect = 3e-13
 Identities = 37/136 (27%), Positives = 59/136 (43%), Gaps = 19/136 (13%)

Query: 52  DVITRLGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELV 111
           +     G T LH+AA+   ++ VK L++       D+  ++  G T L  AA +G +E+V
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLEN----GADVNAKDNDGRTPLHLAAKNGHLEIV 56

Query: 112 KATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLI 171
           K  +E   D+      DKD   P+  AA  G+ +VV+ L       LK    +       
Sbjct: 57  KLLLEKGADVNAR---DKDGNTPLHLAARNGNLDVVKLL-------LKHGADVN-----A 101

Query: 172 ETDSYETALHVLARKN 187
                 T LH+ A+  
Sbjct: 102 RDKDGRTPLHLAAKNG 117


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 396
PHA02946446 ankyin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02859209 ankyrin repeat protein; Provisional 99.97
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02792 631 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02917 661 ankyrin-like protein; Provisional 99.97
PHA02795437 ankyrin-like protein; Provisional 99.96
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02792631 ankyrin-like protein; Provisional 99.95
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.94
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.89
PHA02741169 hypothetical protein; Provisional 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.88
PHA02741169 hypothetical protein; Provisional 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.87
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.86
PHA02884300 ankyrin repeat protein; Provisional 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.84
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.83
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.83
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.73
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.68
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.6
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.59
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.52
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.51
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.5
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.48
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.47
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.47
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.4
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.36
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.36
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.99
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.98
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.94
PF1360630 Ank_3: Ankyrin repeat 98.86
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.85
PF1360630 Ank_3: Ankyrin repeat 98.84
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.81
PF13962113 PGG: Domain of unknown function 98.81
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.73
KOG0522 560 consensus Ankyrin repeat protein [General function 98.72
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.72
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.69
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.69
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.66
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.63
KOG0522 560 consensus Ankyrin repeat protein [General function 98.53
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.5
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.38
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.28
KOG0511 516 consensus Ankyrin repeat protein [General function 98.18
KOG0520975 consensus Uncharacterized conserved protein, conta 98.18
KOG0511 516 consensus Ankyrin repeat protein [General function 98.15
KOG2384223 consensus Major histocompatibility complex protein 98.09
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.07
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.07
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.07
KOG2384223 consensus Major histocompatibility complex protein 97.92
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.07
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.82
KOG2505591 consensus Ankyrin repeat protein [General function 96.17
KOG2505591 consensus Ankyrin repeat protein [General function 96.0
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.96
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.22
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.67
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 90.25
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.95
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 86.96
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.5e-40  Score=313.85  Aligned_cols=282  Identities=13%  Similarity=0.109  Sum_probs=196.6

Q ss_pred             ccccccccCCCcc-cccccchHHHHHHHcCCHHHHHHHHHhCccccccccCCCCchHHHHHHHcC--CHHHHHHHHHHhh
Q 037504            6 PLELHVYSNPPVE-EIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAAN--RIDFVKKLVKKMK   82 (396)
Q Consensus         6 ~~~~~~~~~~~~~-~~~~g~t~Lh~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~A~~~g--~~~~v~~Ll~~~~   82 (396)
                      .+++++..+++.. ++..|.||||+|+..|+.++++.||+. |++++.+ |..|.||||+|+..+  ..+++++|++.| 
T Consensus        54 iv~~Ll~~Gadvn~~d~~G~TpLh~Aa~~g~~eiv~lLL~~-GAdin~~-d~~g~TpLh~A~~~~~~~~e~v~lLl~~G-  130 (446)
T PHA02946         54 FVEELLHRGYSPNETDDDGNYPLHIASKINNNRIVAMLLTH-GADPNAC-DKQHKTPLYYLSGTDDEVIERINLLVQYG-  130 (446)
T ss_pred             HHHHHHHCcCCCCccCCCCCCHHHHHHHcCCHHHHHHHHHC-cCCCCCC-CCCCCCHHHHHHHcCCchHHHHHHHHHcC-
Confidence            4555665554433 466677777777777777777766653 6777666 677777777766654  356677777766 


Q ss_pred             hcccchhc-ccCCCCcHHHHHHHcCCHHHHHHHHhcCCCCccccCCCCCCCcHHHHHHhcC--CHHHHHHHHhhcc-cCC
Q 037504           83 AENLDLAK-RNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLG--HTEVVEFLYRETK-NSL  158 (396)
Q Consensus        83 ~~~~d~~~-~d~~g~tpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~~d~~g~tpLh~A~~~~--~~~~v~~Ll~~~~-~~~  158 (396)
                       +++  +. .|..|.|||| |+..|+.+++++|++.|++   ++.+|..|+||||+|+..+  +.+++++|++.|+ .+.
T Consensus       131 -adi--n~~~d~~g~tpL~-aa~~~~~~vv~~Ll~~gad---~~~~d~~G~t~Lh~A~~~~~~~~~~v~~Ll~~Gadin~  203 (446)
T PHA02946        131 -AKI--NNSVDEEGCGPLL-ACTDPSERVFKKIMSIGFE---ARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSK  203 (446)
T ss_pred             -CCc--ccccCCCCCcHHH-HHHCCChHHHHHHHhcccc---ccccCCCCCCHHHHHHHhcCCCHHHHHHHHHcCCCCcc
Confidence             554  53 4666777775 4455667777777777766   4445566777777666543  3466777777666 444


Q ss_pred             CCcchhHHHHHHhhccchhhHHHHHHhcCCCCCCCCCcchhhhhhhccchhhhhHHHHHHHHHHHHHHHHhCCccccccc
Q 037504          159 KDDDCIELLVKLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFD  238 (396)
Q Consensus       159 ~~~~g~~~l~~~~~~~~~~t~L~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~ll~~~~~~i~~~d  238 (396)
                      .+.+|             .||||+|+..+..                         ..++++.++      .+.++|.+|
T Consensus       204 ~d~~G-------------~TpLH~Aa~~~~~-------------------------~~~iv~lLl------~gadin~~d  239 (446)
T PHA02946        204 PDHDG-------------NTPLHIVCSKTVK-------------------------NVDIINLLL------PSTDVNKQN  239 (446)
T ss_pred             cCCCC-------------CCHHHHHHHcCCC-------------------------cHHHHHHHH------cCCCCCCCC
Confidence            55555             8999999987521                         244554433      367899999


Q ss_pred             CCCCcHHHHHHHcCc-HHHHHHHHhhccccc----------------ccccccc-CCCCchhhhhhcCCCCCcccccc--
Q 037504          239 ENGHTIFHIAVSNRM-REIFKFIFEISSVAD----------------LLFDSKD-KDGNNILHLAGKLPPLNRLNIVS--  298 (396)
Q Consensus       239 ~~g~t~Lh~A~~~~~-~~~v~~Ll~~g~~~~----------------~~~n~~d-~~g~TpLh~A~~~~~~~~~~~l~--  298 (396)
                      ..|+||||+|+..++ .+++++|+++|++..                .+++..+ ..|.||||+|+..|+.+++++|.  
T Consensus       240 ~~G~TpLh~A~~~~~~~~~~~~Ll~~g~~~~~~~~~~a~~~~~~~~~e~l~~~g~~~~~TpLh~Aa~~g~~eivk~Ll~~  319 (446)
T PHA02946        240 KFGDSPLTLLIKTLSPAHLINKLLSTSNVITDQTVNICIFYDRDDVLEIINDKGKQYDSTDFKMAVEVGSIRCVKYLLDN  319 (446)
T ss_pred             CCCCCHHHHHHHhCChHHHHHHHHhCCCCCCCcHHHHHHHcCchHHHHHHHHcCcccCCCHHHHHHHcCCHHHHHHHHHC
Confidence            999999999999988 489999999987420                0122332 46889999999999999999984  


Q ss_pred             ----chhHhHHHHHHHHHHHhhhc-chhhhhhhcCCCCCchhhHHHHhH
Q 037504          299 ----VAALQLQRELLWFQEVKKVV-PRKFAEEKNNDGLTPGDLFIKEHE  342 (396)
Q Consensus       299 ----~~~~~~~~~l~~~~~v~~l~-~~~~~~~~~~~g~tpl~~a~~~~~  342 (396)
                          .++++.+...++.+.++.++ +|++++.+ .+|.||+++|.+...
T Consensus       320 ~~~~~t~L~~A~~~~~~~~v~~Ll~~ga~~n~~-~~G~t~l~~a~~~~~  367 (446)
T PHA02946        320 DIICEDAMYYAVLSEYETMVDYLLFNHFSVDSV-VNGHTCMSECVRLNN  367 (446)
T ss_pred             CCccccHHHHHHHhCHHHHHHHHHHCCCCCCCc-cccccHHHHHHHcCC
Confidence                36788888777777777766 78999986 589999999987543



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 8e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-04
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-04
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-04
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-04
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 6e-04
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 7e-04
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 7/95 (7%) Query: 58 GDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEG 117 G T LH+AA+ ++ V+ L+K D+ + G T L AAA+G +E+V+ ++ Sbjct: 47 GYTPLHLAASNGHLEIVEVLLKN----GADVNASDLTGITPLHLAAATGHLEIVEVLLKH 102 Query: 118 NEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYR 152 D+ D D P+ AA GH E+VE L + Sbjct: 103 GADVNAY---DNDGHTPLHLAAKYGHLEIVEVLLK 134
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
2rfa_A232 Transient receptor potential cation channel subfa 4e-18
2rfa_A232 Transient receptor potential cation channel subfa 4e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-04
2etb_A256 Transient receptor potential cation channel subfam 3e-11
2etb_A256 Transient receptor potential cation channel subfam 3e-10
2etb_A256 Transient receptor potential cation channel subfam 7e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-07
2pnn_A273 Transient receptor potential cation channel subfa 6e-11
2pnn_A273 Transient receptor potential cation channel subfa 1e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
 Score = 81.9 bits (203), Expect = 4e-18
 Identities = 42/258 (16%), Positives = 78/258 (30%), Gaps = 63/258 (24%)

Query: 57  LGDTALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATME 116
           + ++ L +AA  N +  + KL+K       ++ +R  +G TAL  AA   ++E     ME
Sbjct: 2   IWESPLLLAAKENDVQALSKLLKFEGC---EVHQRGAMGETALHIAALYDNLEAAMVLME 58

Query: 117 GNEDITMVPQDDKDRMLPIVG------AASLGHTEVVEFL--YRETKNSLKDDDCIELLV 168
              ++   P   +       G      A    +  +V  L     + ++ +    +    
Sbjct: 59  AAPELVFEPMTSELY----EGQTALHIAVINQNVNLVRALLARGASVSA-RATGSVFHYR 113

Query: 169 KLIETDSYETALHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWE---N 225
                   E  L   A                              + E+V LL E   +
Sbjct: 114 PHNLIYYGEHPLSFAACVG---------------------------SEEIVRLLIEHGAD 146

Query: 226 FLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFE--ISSVAD----LLFDSKDKDGN 279
                   I   D  G+T+ HI +    +     ++   +S         L    +  G 
Sbjct: 147 --------IRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGL 198

Query: 280 NILHLAGKLPPLNRLNIV 297
               LAG       + + 
Sbjct: 199 TPFKLAGV---EGNIVMF 213


>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.98
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.77
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.5e-45  Score=352.36  Aligned_cols=314  Identities=20%  Similarity=0.204  Sum_probs=204.9

Q ss_pred             CCCCccccccccCCCcc-cccccchHHHHHHHcCCHHHHHHHHHhCccccccccCCCCchHHHHHHHcCCHHHHHHHHHH
Q 037504            2 AHSAPLELHVYSNPPVE-EIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKK   80 (396)
Q Consensus         2 ~h~~~~~~~~~~~~~~~-~~~~g~t~Lh~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~   80 (396)
                      ||.+++++|+..+.+.. .+..|.||||+|+..|+.+++++|++. +++++.+ +..|.||||+|+..|+.++|++|++.
T Consensus        25 g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~-g~~~~~~-~~~g~t~L~~A~~~g~~~~v~~Ll~~  102 (437)
T 1n11_A           25 GHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQN-KAKVNAK-AKDDQTPLHCAARIGHTNMVKLLLEN  102 (437)
T ss_dssp             TCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHH-TCCSSCC-CTTSCCHHHHHHHHTCHHHHHHHHHH
T ss_pred             CCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhC-CCCCCCC-CCCCCCHHHHHHHCCCHHHHHHHHhC
Confidence            55666677766654333 455677777777777777777777765 6667666 67777777777777777777777777


Q ss_pred             hhhcccchhcccCCCCcHHHHHHHcCCHHHHHHHHhcCCCCccccCCCCCCCcHHHHHHhcCCHHHHHHHHhhcc-cCCC
Q 037504           81 MKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETK-NSLK  159 (396)
Q Consensus        81 ~~~~~~d~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~~d~~g~tpLh~A~~~~~~~~v~~Ll~~~~-~~~~  159 (396)
                      |  +++  +..|..|.||||+|+..|+.+++++|++++++   ....+..|.||||+|+..|+.+++++|++.++ .+..
T Consensus       103 g--a~~--~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~---~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~  175 (437)
T 1n11_A          103 N--ANP--NLATTAGHTPLHIAAREGHVETVLALLEKEAS---QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAA  175 (437)
T ss_dssp             T--CCT--TCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCC---SCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCC
T ss_pred             C--CCC--CCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCC---CcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCC
Confidence            6  555  66777777777777777777777777777766   33445567777777777777777777777766 4555


Q ss_pred             CcchhHHHHHHhhccc--------------------hhhHHHHHHhcCCCCCCCCCcchhhhhhhccch---------hh
Q 037504          160 DDDCIELLVKLIETDS--------------------YETALHVLARKNLTSSNQNPRGIFQRYFNLGAK---------AV  210 (396)
Q Consensus       160 ~~~g~~~l~~~~~~~~--------------------~~t~L~~a~~~~~~~~~~~~~~~~~~~~~~~~~---------~~  210 (396)
                      +..|.++|+.++..+.                    +.||||+|+..++.       ++.+.+.+.+..         ++
T Consensus       176 ~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~-------~~~~~Ll~~g~~~~~~~~~g~t~  248 (437)
T 1n11_A          176 GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQV-------EVARSLLQYGGSANAESVQGVTP  248 (437)
T ss_dssp             CSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCH-------HHHHHHHHTTCCTTCCCTTCCCH
T ss_pred             CCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCH-------HHHHHHHHcCCCCCCCCCCCCCH
Confidence            6667777766654322                    25677777766632       333333332211         11


Q ss_pred             ----hhHHHHHHHHHHHHHHHHhCCcccccccCCCCcHHHHHHHcCcHHHHHHHHhhccccccccccccCCCCchhhhhh
Q 037504          211 ----ENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHLAG  286 (396)
Q Consensus       211 ----~~~~~~~~~~~ll~~ll~~~~~~i~~~d~~g~t~Lh~A~~~~~~~~v~~Ll~~g~~~~~~~n~~d~~g~TpLh~A~  286 (396)
                          ......+++++++     ..+.+++..|..|+||||+|++.|+.+++++|+++|++    ++.+|..|+||||+|+
T Consensus       249 L~~A~~~g~~~~v~~Ll-----~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~----~~~~~~~g~t~L~~A~  319 (437)
T 1n11_A          249 LHLAAQEGHAEMVALLL-----SKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM----VDATTRMGYTPLHVAS  319 (437)
T ss_dssp             HHHHHHTTCHHHHHHHH-----TTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC----TTCCCSSCCCHHHHHH
T ss_pred             HHHHHHCCCHHHHHHHH-----hcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCcc----CCCCCCCCCCHHHHHH
Confidence                1111234444443     34566677777777777777777777777777777777    6777777777777777


Q ss_pred             cCCCCCccccccc-------------hhHhHHHHHHHHHHHhhhc-chhhhhhhcCCCCCchhhHHHH
Q 037504          287 KLPPLNRLNIVSV-------------AALQLQRELLWFQEVKKVV-PRKFAEEKNNDGLTPGDLFIKE  340 (396)
Q Consensus       287 ~~~~~~~~~~l~~-------------~~~~~~~~l~~~~~v~~l~-~~~~~~~~~~~g~tpl~~a~~~  340 (396)
                      ..|+.+++++|..             ++++.+...+..+.|+.|+ .|++++.+|.+|+||+++|.+.
T Consensus       320 ~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~  387 (437)
T 1n11_A          320 HYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRL  387 (437)
T ss_dssp             HSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHT
T ss_pred             HcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHc
Confidence            7777777777621             4556665555555555555 5677777777777777777654



>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 396
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.002
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 75.0 bits (183), Expect = 2e-15
 Identities = 47/225 (20%), Positives = 81/225 (36%), Gaps = 22/225 (9%)

Query: 60  TALHVAAAANRIDFVKKLVKKMKAENLDLAKRNRIGCTALFYAAASGSVELVKATMEGNE 119
           T LHVA+    +  VK L+++           N    T L  AA +G  E+ K  ++   
Sbjct: 2   TPLHVASFMGHLPIVKNLLQR----GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA 57

Query: 120 DITMVPQDDKDRMLPIVGAASLGHTEVVEFLYRETKNSLKDDDCIELLVKLIETDSYETA 179
            +       KD   P+  AA +GHT +V+ L     N           + +   + +   
Sbjct: 58  KVNAK---AKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVET 114

Query: 180 LHVLARKNLTSSNQNPRGIFQRYFNLGAKAVENERALELVELLWENFLFKYPDLIWKFDE 239
           +  L  K  + +    +G    +      A +  + + + ELL E              +
Sbjct: 115 VLALLEKEASQACMTKKGFTPLHV-----AAKYGK-VRVAELLLER-----DAHPNAAGK 163

Query: 240 NGHTIFHIAVSNRMREIFKFIFEISSVADLLFDSKDKDGNNILHL 284
           NG T  H+AV +   +I K +            S   +G   LH+
Sbjct: 164 NGLTPLHVAVHHNNLDIVKLLLPRG--GSP--HSPAWNGYTPLHI 204


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.7e-40  Score=310.54  Aligned_cols=305  Identities=18%  Similarity=0.173  Sum_probs=227.3

Q ss_pred             CCCCccccccccCCCcc-cccccchHHHHHHHcCCHHHHHHHHHhCccccccccCCCCchHHHHHHHcCCHHHHHHHHHH
Q 037504            2 AHSAPLELHVYSNPPVE-EIRTRRLKLYRVALNGDWARAKVIYDEHKDEIGDVITRLGDTALHVAAAANRIDFVKKLVKK   80 (396)
Q Consensus         2 ~h~~~~~~~~~~~~~~~-~~~~g~t~Lh~A~~~g~~~~v~~ll~~~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~   80 (396)
                      |+.++++.++..+++.. .+..|.||||+|+..|+.+++++||+. |++++.+ +..|+||||+|+..|+.+++++|+..
T Consensus        11 g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~-gadi~~~-~~~g~t~L~~A~~~g~~~~~~~Ll~~   88 (408)
T d1n11a_          11 GHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQN-KAKVNAK-AKDDQTPLHCAARIGHTNMVKLLLEN   88 (408)
T ss_dssp             TCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHH-TCCSSCC-CTTSCCHHHHHHHHTCHHHHHHHHHH
T ss_pred             cCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHC-cCCCCCC-CCCCCCHHHHHHHcCCHHHHHHHHHh
Confidence            55667777777765443 567778888888888888888888875 7777777 77788888888888888888887765


Q ss_pred             hhhc-----------------------------ccchhcccCCCCcHHHHHHHcCCHHHHHHHHhcCCCCccccCCCCCC
Q 037504           81 MKAE-----------------------------NLDLAKRNRIGCTALFYAAASGSVELVKATMEGNEDITMVPQDDKDR  131 (396)
Q Consensus        81 ~~~~-----------------------------~~d~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~g~~~~~~~~~d~~g  131 (396)
                      +...                             ....+..+..+.++|++|+..++.+++++|+++|++   ++..+.+|
T Consensus        89 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~---~~~~~~~~  165 (408)
T d1n11a_          89 NANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH---PNAAGKNG  165 (408)
T ss_dssp             TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC---TTCCCSSC
T ss_pred             hhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCC---CCcCCCcC
Confidence            4110                             011244566777888888888888888888888887   44456689


Q ss_pred             CcHHHHHHhcCCHHHHHHHHhhcc-cCCCCcchhHHHHHHhhccc--------------------hhhHHHHHHhcCCCC
Q 037504          132 MLPIVGAASLGHTEVVEFLYRETK-NSLKDDDCIELLVKLIETDS--------------------YETALHVLARKNLTS  190 (396)
Q Consensus       132 ~tpLh~A~~~~~~~~v~~Ll~~~~-~~~~~~~g~~~l~~~~~~~~--------------------~~t~L~~a~~~~~~~  190 (396)
                      .+|||+|+..|+.+++++|+.+++ .+..+..|.++++.+.....                    +.|||++|+..+.. 
T Consensus       166 ~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~-  244 (408)
T d1n11a_         166 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHA-  244 (408)
T ss_dssp             CCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCH-
T ss_pred             chHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHHHhCcH-
Confidence            999999999999999999999887 55677778888877654322                    26888888887743 


Q ss_pred             CCCCCcchhhhhhhcc----------ch---hhhhHHHHHHHHHHHHHHHHhCCcccccccCCCCcHHHHHHHcCcHHHH
Q 037504          191 SNQNPRGIFQRYFNLG----------AK---AVENERALELVELLWENFLFKYPDLIWKFDENGHTIFHIAVSNRMREIF  257 (396)
Q Consensus       191 ~~~~~~~~~~~~~~~~----------~~---~~~~~~~~~~~~~ll~~ll~~~~~~i~~~d~~g~t~Lh~A~~~~~~~~v  257 (396)
                            ...+......          ..   ........++++++++     .+.+++..+..+.||||.++..++.+++
T Consensus       245 ------~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~-----~g~~~~~~~~~~~t~L~~~~~~~~~~~~  313 (408)
T d1n11a_         245 ------EMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIK-----HGVMVDATTRMGYTPLHVASHYGNIKLV  313 (408)
T ss_dssp             ------HHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHH-----HTCCTTCCCSSCCCHHHHHHHSSCSHHH
T ss_pred             ------hHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHH-----CCCccccccccccccchhhcccCcceee
Confidence                  1111111110          00   1111223455555543     4777888999999999999999999999


Q ss_pred             HHHHhhccccccccccccCCCCchhhhhhcCCCCCccccccchhHhHHHHHHHHHHHhhhcchhhhhhhcCCCCCchhhH
Q 037504          258 KFIFEISSVADLLFDSKDKDGNNILHLAGKLPPLNRLNIVSVAALQLQRELLWFQEVKKVVPRKFAEEKNNDGLTPGDLF  337 (396)
Q Consensus       258 ~~Ll~~g~~~~~~~n~~d~~g~TpLh~A~~~~~~~~~~~l~~~~~~~~~~l~~~~~v~~l~~~~~~~~~~~~g~tpl~~a  337 (396)
                      +++++.|++    +|.+|.+|+||||+|++.|+.+++++|                   +.+|++++.+|++|+|||++|
T Consensus       314 ~~ll~~g~~----in~~d~~G~T~Lh~A~~~g~~~iv~~L-------------------l~~GAd~n~~d~~G~t~L~~A  370 (408)
T d1n11a_         314 KFLLQHQAD----VNAKTKLGYSPLHQAAQQGHTDIVTLL-------------------LKNGASPNEVSSDGTTPLAIA  370 (408)
T ss_dssp             HHHHHTTCC----TTCCCTTSCCHHHHHHHTTCHHHHHHH-------------------HHTTCCSCCCCSSSCCHHHHH
T ss_pred             eeecccccc----ccccCCCCCCHHHHHHHcCCHHHHHHH-------------------HHCCCCCCCCCCCCCCHHHHH
Confidence            999999999    899999999999999999999998887                   779999999999999999999


Q ss_pred             HHH-hHHHHH
Q 037504          338 IKE-HEELKK  346 (396)
Q Consensus       338 ~~~-~~~~~~  346 (396)
                      .+. +.++++
T Consensus       371 ~~~~~~~iv~  380 (408)
T d1n11a_         371 KRLGYISVTD  380 (408)
T ss_dssp             HHTTCHHHHH
T ss_pred             HHcCCHHHHH
Confidence            876 334443



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure