Citrus Sinensis ID: 037538


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MELITVPELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPKEV
cccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccEEcccHHHHcccccccEEcccccccccccHHHHccccccccccccccccccccccccccEEEEcccccEEcccHHHHccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccHHHHHcHHccccEEEcccEEEEcccccccccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccc
cccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccEEEEEEccccccEEEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccccccccEEEEcccccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEcccccccccccccccccHHHccccccEEEEcccccccccccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccccc
MELITVPELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFknhltqdplqimsswndSVHFCNWvgvtcspsngrvTVLKLESKQlvgsipasignltnltginlfqnrfhgqipeeIGRLQKLQDLNLTYNYlsgkiptnlshctelrsFEASANDFIGQIPDQLISLTKLEIIRLgtsnltgnipawVGNFSSLQVLLLARNnlhgsipnelgqlsalgFFTLYENFIsdvgltlpnlkifaggvnyftgsipvslsnasnlqvldfaengltgtipenfgslKDLVRLnfdqnelgsreigdlNFLKFLANCTSLEVLglaqngfggempiSIANLSTHLRILTMGYnlmhgnipvgIENLVNLSLLglegnnlsgsvPEVIGRLNkleglelnankfsgfmpsslgnlTVLSRLLMEenrfegsippslgnckklQVLNLssnnlngtipkev
melitvpelqMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKfsgfmpsslGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVlnlssnnlngtipkev
MELITVPELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIenlvnlsllglegnnlsgsvPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVlnlssnnlnGTIPKEV
*******ELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRF********GNCKKLQVL***************
*******ELQMDKLLQLALPFESLYSKNLE***IEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPK**
MELITVPELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPKEV
**LITVPELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELITVPELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPKEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query461 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.928 0.423 0.432 3e-89
C0LGT6 1031 LRR receptor-like serine/ no no 0.926 0.414 0.428 7e-86
Q9SD62 1025 Putative receptor-like pr no no 0.991 0.445 0.412 1e-79
Q9LHP4 1141 Receptor-like protein kin no no 0.787 0.318 0.364 3e-58
Q9FL28 1173 LRR receptor-like serine/ no no 0.930 0.365 0.340 8e-58
C0LGQ5 1249 LRR receptor-like serine/ no no 0.921 0.340 0.343 3e-56
C0LGV1 1135 LRR receptor-like serine/ no no 0.804 0.326 0.374 9e-56
O22938 890 Leucine-rich repeat recep no no 0.850 0.440 0.337 1e-53
O49318 1124 Probable leucine-rich rep no no 0.908 0.372 0.339 2e-51
C0LGS2 1136 Probable LRR receptor-lik no no 0.904 0.367 0.347 2e-51
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  329 bits (843), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 198/458 (43%), Positives = 268/458 (58%), Gaps = 30/458 (6%)

Query: 33  TIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVG 92
           T E D+ ALL FK+ +++D   ++SSWN S   CNW GVTC   N RVT L+L   QL G
Sbjct: 21  TDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGG 80

Query: 93  SIPASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTEL 152
            I  SIGNL+ L  ++L++N F G IP+E+G+L +L+ L++  NYL G IP  L +C+ L
Sbjct: 81  VISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRL 140

Query: 153 RSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHG 212
            +    +N   G +P +L SLT L  + L  +N+ G +P  +GN + L+ L L+ NNL G
Sbjct: 141 LNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEG 200

Query: 213 SIPNELGQLSALGFFTLYENFIS-----------------------------DVGLTLPN 243
            IP+++ QL+ +    L  N  S                             D+G+ LPN
Sbjct: 201 EIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPN 260

Query: 244 LKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELG 303
           L  F  G NYFTGSIP +LSN S L+ L   EN LTG+IP  FG++ +L  L    N LG
Sbjct: 261 LLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIP-TFGNVPNLKLLFLHTNSLG 319

Query: 304 SREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPV 363
           S    DL FL  L NCT LE LG+ +N  GG++PISIANLS  L  L +G  L+ G+IP 
Sbjct: 320 SDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPY 379

Query: 364 GIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLL 423
            I NL+NL  L L+ N LSG +P  +G+L  L  L L +N+ SG +P+ +GN+T+L  L 
Sbjct: 380 DIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLD 439

Query: 424 MEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPKEV 461
           +  N FEG +P SLGNC  L  L +  N LNGTIP E+
Sbjct: 440 LSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEI 477





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
449483694 1005 PREDICTED: probable LRR receptor-like se 0.926 0.424 0.576 1e-141
449440277 1088 PREDICTED: probable LRR receptor-like se 0.926 0.392 0.572 1e-140
356566660 1020 PREDICTED: probable LRR receptor-like se 0.926 0.418 0.569 1e-129
357505893 1003 Receptor kinase-like protein [Medicago t 0.926 0.425 0.555 1e-125
224139072 970 predicted protein [Populus trichocarpa] 0.837 0.397 0.619 1e-123
449440275 821 PREDICTED: probable LRR receptor-like se 0.960 0.539 0.501 1e-121
449483707 938 PREDICTED: probable LRR receptor-like se 0.928 0.456 0.516 1e-121
449483698 1099 PREDICTED: probable LRR receptor-like se 0.984 0.413 0.491 1e-121
449440267 938 PREDICTED: probable LRR receptor-like se 0.928 0.456 0.516 1e-121
449483700 1343 PREDICTED: LOW QUALITY PROTEIN: putative 0.926 0.317 0.512 1e-120
>gi|449483694|ref|XP_004156662.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 263/456 (57%), Positives = 332/456 (72%), Gaps = 29/456 (6%)

Query: 35  EADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSI 94
           E+D+L LLD K  +  DPL+IMSSWNDS+HFC+WVGVTCSP+  +V VL LE++QL GSI
Sbjct: 7   ESDRLVLLDLKRRVLDDPLKIMSSWNDSIHFCDWVGVTCSPTIRKVMVLNLEARQLTGSI 66

Query: 95  PASIGNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRS 154
           P+S+GNLT+LT I L  N F G IP+E+G+L  L  LNL++N   G+I +N+SHCTEL  
Sbjct: 67  PSSLGNLTHLTEIRLGNNNFLGAIPQELGKLLLLHHLNLSFNNFDGEIASNISHCTELLV 126

Query: 155 FEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSI 214
            E S N+F+GQIP Q  +L+KLE I  G +NL G IP W+GNFSSL  L  A N+  GSI
Sbjct: 127 LELSRNEFVGQIPHQFFTLSKLERIGFGGNNLVGTIPPWIGNFSSLFSLSFALNSFQGSI 186

Query: 215 PNELGQLSALGFFTLYENFIS-----------------------------DVGLTLPNLK 245
           P+ELG+LS L  F++Y N+++                             DVG TLPNL+
Sbjct: 187 PSELGRLSRLKLFSVYGNYLTGTVPPSIYNITSLTYFSLTQNRLRGTLPPDVGFTLPNLQ 246

Query: 246 IFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSR 305
           +FAGGVN F G IP SL+N S LQVLDFAEN L GT+P + G+LK+LVR NFD N LGS 
Sbjct: 247 VFAGGVNNFGGPIPTSLANISGLQVLDFAENSLIGTLPHDLGNLKELVRFNFDDNRLGSG 306

Query: 306 EIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGI 365
           ++ DLN ++ L NCTSL VLGL+ N FGG +P+SI+NLS  L ILT+G NL+ G IPVGI
Sbjct: 307 KVDDLNVIRSLTNCTSLSVLGLSGNRFGGTLPLSISNLSNQLTILTLGRNLLSGGIPVGI 366

Query: 366 ENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLME 425
           +NL+NL LLG+EGNNL+GSVP  IG+ +KL  L +N NK SG +PSS+GNL++L++L ME
Sbjct: 367 DNLINLQLLGVEGNNLNGSVPSNIGKFHKLAALYVNNNKLSGTIPSSIGNLSLLTKLFME 426

Query: 426 ENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPKEV 461
           +NR EGSIPPSLG CK+LQVL+LS NNL+GTIPKEV
Sbjct: 427 DNRLEGSIPPSLGQCKRLQVLDLSGNNLSGTIPKEV 462




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449440277|ref|XP_004137911.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356566660|ref|XP_003551548.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Back     alignment and taxonomy information
>gi|357505893|ref|XP_003623235.1| Receptor kinase-like protein [Medicago truncatula] gi|355498250|gb|AES79453.1| Receptor kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224139072|ref|XP_002322973.1| predicted protein [Populus trichocarpa] gi|222867603|gb|EEF04734.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449440275|ref|XP_004137910.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483707|ref|XP_004156666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483698|ref|XP_004156663.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440267|ref|XP_004137906.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483700|ref|XP_004156664.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein kinase At3g47110-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.993 0.563 0.344 1.8e-62
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.850 0.388 0.381 5.6e-59
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.976 0.439 0.342 7.4e-58
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.939 0.428 0.332 8.5e-57
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.915 0.409 0.353 2e-56
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.852 0.389 0.351 7.2e-54
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.954 0.352 0.328 2.6e-51
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.848 0.381 0.351 6.4e-51
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.678 0.331 0.326 1.9e-50
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.809 0.326 0.332 5e-50
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
 Score = 638 (229.6 bits), Expect = 1.8e-62, P = 1.8e-62
 Identities = 161/467 (34%), Positives = 233/467 (49%)

Query:     3 LITVPELQMDKLLQLALPFESLYSKNLESATIEADKLALLDFKNHLTQDPLQIMSSWNDS 62
             +I++P L         L F S  S +        D+LALL FK+ L     Q ++SWN S
Sbjct:     1 MISLPLLLFVLFFSALLLFPSS-SDDDGGGDAAGDELALLSFKSSLLYQGGQSLASWNTS 59

Query:    63 VH--FCNWVGVTCSPSNG-RVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNRFHGQIP 119
              H   C WVGV C   +  RV  L+L S  L G I  S+GNL+ L  + L  N   G+IP
Sbjct:    60 GHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIP 119

Query:   120 EEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEII 179
             +E+ RL +LQ L L +N LSG+IP  L + T L   E + N   G IP  L  LT L  +
Sbjct:   120 QELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDL 179

Query:   180 RLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGL 239
              L  + L+G+IP+  G    L  L LA NNL G+IP+ +  +S+L  F +  N +S    
Sbjct:   180 ALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLP 239

Query:   240 T-----LPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVR 294
             T     LP+L+      N F G IP S+ NASN+ +     N  +G +P   G +++L R
Sbjct:   240 TNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQR 299

Query:   295 LNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLSTHLRILTMGY 354
             L   +    + E  D  F+  L NC++L+ + L    FGG +P S++NLS+ L  L++  
Sbjct:   300 LELPETLSEAEETNDWKFMTALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRD 359

Query:   355 NLMHGNIPVGIXXXXXXXXXXXXXXXXXXXXPEVIGRLNKLEGLELNANKFSGFMPSSLG 414
             N + G++P  I                    P    +L  L  L ++ NK  G +P ++G
Sbjct:   360 NKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIG 419

Query:   415 NLTVLSRLLMEENRFEGSIPPSLGNCKKLQVXXXXXXXXXGTIPKEV 461
             NLT L+ + ++ N F G+IP +LGN  KL           G IP E+
Sbjct:   420 NLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEI 466


GO:0004672 "protein kinase activity" evidence=IDA
GO:0006468 "protein phosphorylation" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=IMP
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-68
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-58
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-55
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-23
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  232 bits (594), Expect = 9e-68
 Identities = 150/434 (34%), Positives = 222/434 (51%), Gaps = 33/434 (7%)

Query: 29  LESATIEADKLALL-DFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLES 87
           L  + + A++L LL  FK+ +  DPL+ +S+WN S   C W G+TC+ S+ RV  + L  
Sbjct: 21  LNFSMLHAEELELLLSFKSSI-NDPLKYLSNWNSSADVCLWQGITCNNSS-RVVSIDLSG 78

Query: 88  KQLVGSIPASIGNLTNLTGINLFQNRFHGQIPEEIGRL-QKLQDLNLTYNYLSGKIPTNL 146
           K + G I ++I  L  +  INL  N+  G IP++I      L+ LNL+ N  +G IP   
Sbjct: 79  KNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGS 138

Query: 147 SHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLA 206
                L + + S N   G+IP+ + S + L+++ LG + L G IP  + N +SL+ L LA
Sbjct: 139 IPN--LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLA 196

Query: 207 RNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLSNAS 266
            N L G IP ELGQ+                     +LK    G N  +G IP  +   +
Sbjct: 197 SNQLVGQIPRELGQMK--------------------SLKWIYLGYNNLSGEIPYEIGGLT 236

Query: 267 NLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLG 326
           +L  LD   N LTG IP + G+LK+L  L   QN+L S  I    F     +   L  L 
Sbjct: 237 SLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKL-SGPIPPSIF-----SLQKLISLD 290

Query: 327 LAQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVP 386
           L+ N   GE+P  +  L   L IL +  N   G IPV + +L  L +L L  N  SG +P
Sbjct: 291 LSDNSLSGEIPELVIQLQN-LEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIP 349

Query: 387 EVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVL 446
           + +G+ N L  L+L+ N  +G +P  L +   L +L++  N  EG IP SLG C+ L+ +
Sbjct: 350 KNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRV 409

Query: 447 NLSSNNLNGTIPKE 460
            L  N+ +G +P E
Sbjct: 410 RLQDNSFSGELPSE 423


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 461
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
PLN03150623 hypothetical protein; Provisional 99.59
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.25
PLN03150623 hypothetical protein; Provisional 99.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.13
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.61
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.59
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.44
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.42
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.18
PRK15386 426 type III secretion protein GogB; Provisional 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.79
PRK15386426 type III secretion protein GogB; Provisional 97.72
KOG4341483 consensus F-box protein containing LRR [General fu 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.45
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.14
KOG4341483 consensus F-box protein containing LRR [General fu 97.03
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.02
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.95
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.9
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.78
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.2
KOG4308 478 consensus LRR-containing protein [Function unknown 96.09
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.43
KOG4308 478 consensus LRR-containing protein [Function unknown 95.29
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.92
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.46
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.67
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.1
smart0037026 LRR Leucine-rich repeats, outliers. 90.1
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.95
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.01
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 82.87
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.5e-52  Score=457.07  Aligned_cols=421  Identities=34%  Similarity=0.535  Sum_probs=281.0

Q ss_pred             cHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCcceeeEEecCCCCcEEEEEcCCCCcccccCccccCCCCCCEEecCCCC
Q 037538           34 IEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQNR  113 (461)
Q Consensus        34 ~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~L~l~~~~l~~~~~~~l~~l~~L~~L~L~~n~  113 (461)
                      .+.|+.||++||+++. +|...+.+|....+||.|.||+|+.. ++|+.|+++++.+.+.++..+..+++|++|++++|+
T Consensus        27 ~~~~~~~l~~~~~~~~-~~~~~~~~w~~~~~~c~w~gv~c~~~-~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~  104 (968)
T PLN00113         27 HAEELELLLSFKSSIN-DPLKYLSNWNSSADVCLWQGITCNNS-SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQ  104 (968)
T ss_pred             CHHHHHHHHHHHHhCC-CCcccCCCCCCCCCCCcCcceecCCC-CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCc
Confidence            5689999999999985 77777899998889999999999853 799999999999999999999999999999999999


Q ss_pred             CcccCchhcc-CCCCCCEEeCCCCCCCCCCCcCCCCCCCCCEEEccCCcCCCcCchhhcCCCCCcEEEccCCCCcccCCc
Q 037538          114 FHGQIPEEIG-RLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPA  192 (461)
Q Consensus       114 ~~~~~~~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~  192 (461)
                      +.+.+|..+. .+++|++|++++|++++.+|.  +.+++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|.
T Consensus       105 ~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~  182 (968)
T PLN00113        105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN  182 (968)
T ss_pred             cCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCCh
Confidence            9988887655 788888888888888766664  3466677777777777666666677777777777777766666666


Q ss_pred             cCCCCCCCCEEECccCCCcccCChhhhcCCCCcEEecCCCCchh----hccCCCCCcEEEccCccCccccChhhcCCCCC
Q 037538          193 WVGNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISD----VGLTLPNLKIFAGGVNYFTGSIPVSLSNASNL  268 (461)
Q Consensus       193 ~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~----~~~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L  268 (461)
                      .+.++++|++|++++|.+.+.+|..++++++|++|++++|.+..    ....+++|++|++++|.+++.+|..++++++|
T Consensus       183 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  262 (968)
T PLN00113        183 SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNL  262 (968)
T ss_pred             hhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCC
Confidence            66666777777777776666666666666666666666665532    12345566666666666666666666666666


Q ss_pred             CEEEcccccccccCCccCCCCCCCCEEEcccCcCcccCCCCc------------------hhhhhhcCCCCCCEEEccCC
Q 037538          269 QVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDL------------------NFLKFLANCTSLEVLGLAQN  330 (461)
Q Consensus       269 ~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~------------------~~~~~l~~~~~L~~L~L~~n  330 (461)
                      ++|++++|.+.+..|..+..+++|++|++++|.+.+..+..+                  ..+..+..+++|+.|++++|
T Consensus       263 ~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n  342 (968)
T PLN00113        263 QYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSN  342 (968)
T ss_pred             CEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCC
Confidence            666666666665555555566666666666665554110000                  22333444445555555555


Q ss_pred             cCccccchHHHhccccccEEEccCCcCcccCchhhhcCCCCCeeecccCcCccccchhhhcCCCCCeeccccccCcccCC
Q 037538          331 GFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMP  410 (461)
Q Consensus       331 ~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~~~~L~~L~L~~n~l~~~~~  410 (461)
                      .+++.+|..+..+. +|+.|++++|.+++.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++.+|
T Consensus       343 ~l~~~~p~~l~~~~-~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p  421 (968)
T PLN00113        343 KFSGEIPKNLGKHN-NLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELP  421 (968)
T ss_pred             CCcCcCChHHhCCC-CCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECC
Confidence            55544554444443 45555555555555555555555555555555555555555555556666666666666666666


Q ss_pred             hhhhcCccCCeeecccccccccCCccCCCCCCCCEEEccCCCCcccCCC
Q 037538          411 SSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPK  459 (461)
Q Consensus       411 ~~~~~l~~L~~L~l~~n~l~~~~p~~l~~l~~L~~L~ls~N~l~~~ip~  459 (461)
                      ..+..++.|+.|++++|.+++.+|..+..+++|+.|++++|++.|.+|.
T Consensus       422 ~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~  470 (968)
T PLN00113        422 SEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPD  470 (968)
T ss_pred             hhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCc
Confidence            6666666666666666666666666556666666666666666666664



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-29
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-29
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-11
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 4e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-06
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 6e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 9e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 9e-05
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 124 bits (311), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 118/417 (28%), Positives = 192/417 (46%), Gaps = 19/417 (4%) Query: 53 LQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGSIPASIGNLTNLTGINLFQN 112 L+++ +S+ N VG S G + L + ++ G + + NL +++ N Sbjct: 153 LEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLDVSSN 210 Query: 113 RFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLIS 172 F IP +G LQ L+++ N LSG +S CTEL+ S+N F+G IP + Sbjct: 211 NFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--LP 267 Query: 173 LTKLEIIRLGTSNLTGNIPAWV-GNFSSLQVLLLARNNLHGSIPNELGQLSALGFFTLYE 231 L L+ + L + TG IP ++ G +L L L+ N+ +G++P G S L L Sbjct: 268 LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSS 327 Query: 232 NFIS-----DVGLTLPNLKIFAGGVNYFTGSIPVSLSN-ASNLQVLDFAENGLTGTI-PE 284 N S D L + LK+ N F+G +P SL+N +++L LD + N +G I P Sbjct: 328 NNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPN 387 Query: 285 NFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANLS 344 + K+ ++ + QN + +I L+NC+ L L L+ N G +P S+ +LS Sbjct: 388 LCQNPKNTLQELYLQNNGFTGKIP-----PTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 442 Query: 345 THLRILTMGYNLMHGNIPVGIXXXXXXXXXXXXXXXXXXXXPEVIGRLNKLEGLELNANK 404 LR L + N++ G IP + P + L + L+ N+ Sbjct: 443 -KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNR 501 Query: 405 FSGFMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVXXXXXXXXXGTIPKEV 461 +G +P +G L L+ L + N F G+IP LG+C+ L GTIP + Sbjct: 502 LTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 558
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-80
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-78
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-32
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-59
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-36
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-52
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-42
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-33
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-30
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-30
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 8e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  277 bits (711), Expect = 1e-85
 Identities = 102/389 (26%), Positives = 162/389 (41%), Gaps = 40/389 (10%)

Query: 81  TVLKLESKQLVGSIPASI---GNLTNLTGINLFQNRFHGQIPEEIGRLQKLQDLNLTYNY 137
            VL L +  + G+             L  + +  N+  G +   + R   L+ L+++ N 
Sbjct: 154 EVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNN 211

Query: 138 LSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNF 197
            S  IP  L  C+ L+  + S N   G     + + T+L+++ + ++   G IP      
Sbjct: 212 FSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PL 268

Query: 198 SSLQVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGS 257
            SLQ L LA N   G IP+ L                         L       N+F G+
Sbjct: 269 KSLQYLSLAENKFTGEIPDFLSGA-------------------CDTLTGLDLSGNHFYGA 309

Query: 258 IPVSLSNASNLQVLDFAENGLTGTIP-ENFGSLKDLVRLNFDQNELG---SREIGDLNFL 313
           +P    + S L+ L  + N  +G +P +    ++ L  L+   NE        + +L   
Sbjct: 310 VPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL--- 366

Query: 314 KFLANCTSLEVLGLAQNGFGGEMPISIANLS-THLRILTMGYNLMHGNIPVGIENLVNLS 372
                  SL  L L+ N F G +  ++       L+ L +  N   G IP  + N   L 
Sbjct: 367 -----SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 421

Query: 373 LLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSGFMPSSLGNLTVLSRLLMEENRFEGS 432
            L L  N LSG++P  +G L+KL  L+L  N   G +P  L  +  L  L+++ N   G 
Sbjct: 422 SLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGE 481

Query: 433 IPPSLGNCKKLQVLNLSSNNLNGTIPKEV 461
           IP  L NC  L  ++LS+N L G IPK +
Sbjct: 482 IPSGLSNCTNLNWISLSNNRLTGEIPKWI 510


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.2
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.93
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.88
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.66
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.49
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.35
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-56  Score=474.22  Aligned_cols=424  Identities=30%  Similarity=0.462  Sum_probs=283.3

Q ss_pred             ccCcHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCcceeeEEecCCCCcEEEEEcCCCCcccc---cC------------
Q 037538           31 SATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCNWVGVTCSPSNGRVTVLKLESKQLVGS---IP------------   95 (461)
Q Consensus        31 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~L~l~~~~l~~~---~~------------   95 (461)
                      +++.++|++||++||+++. ||. .+++|..+++||.|.||+|+  .++|++|+++++.+.|.   ++            
T Consensus         7 ~~~~~~~~~all~~k~~~~-~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l   82 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLP-DKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESL   82 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCS-CTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEE
T ss_pred             ccCCHHHHHHHHHHHhhCC-Ccc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCccccc
Confidence            3457889999999999997 777 88999988899999999998  48999999999988776   33            


Q ss_pred             -----------ccccCCCCCCEEecCCCCCcccCch--hccCCCCCCEEeCCCCCCCCCCCcCC-CCCCCCCEEEccCCc
Q 037538           96 -----------ASIGNLTNLTGINLFQNRFHGQIPE--EIGRLQKLQDLNLTYNYLSGKIPTNL-SHCTELRSFEASAND  161 (461)
Q Consensus        96 -----------~~l~~l~~L~~L~L~~n~~~~~~~~--~l~~l~~L~~L~Ls~n~l~~~~p~~~-~~l~~L~~L~l~~n~  161 (461)
                                 ..+..+++|++|+|++|.+.|.+|.  .++.+++|++|++++|.+.+.+|..+ .++++|++|++++|.
T Consensus        83 ~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~  162 (768)
T 3rgz_A           83 FLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS  162 (768)
T ss_dssp             ECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSC
T ss_pred             CCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCc
Confidence                       5678889999999999999988888  89999999999999999887777765 778888888888887


Q ss_pred             CCCcCchh---h----------------------cCCCCCcEEEccCCCCcccCCccCCCCCCCCEEECccCCCcccCCh
Q 037538          162 FIGQIPDQ---L----------------------ISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLARNNLHGSIPN  216 (461)
Q Consensus       162 ~~~~~~~~---l----------------------~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~  216 (461)
                      +++..|..   +                      .++++|++|++++|.+.+.+|. ++++++|++|++++|.+++.+|.
T Consensus       163 l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~  241 (768)
T 3rgz_A          163 ISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSR  241 (768)
T ss_dssp             CEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHH
T ss_pred             cCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccH
Confidence            77655544   3                      3456666666777777665665 77778888888888888777777


Q ss_pred             hhhcCCCCcEEecCCCCchhhc--cCCCCCcEEEccCccCccccChhhcCC-CCCCEEEcccccccccCCccCC------
Q 037538          217 ELGQLSALGFFTLYENFISDVG--LTLPNLKIFAGGVNYFTGSIPVSLSNA-SNLQVLDFAENGLTGTIPENFG------  287 (461)
Q Consensus       217 ~l~~l~~L~~L~l~~n~l~~~~--~~l~~L~~L~l~~n~~~~~~~~~l~~~-~~L~~L~l~~n~l~~~~~~~~~------  287 (461)
                      .+..+++|++|++++|.+....  ..+++|++|++++|.+++.+|..+... ++|++|++++|.+++.+|..++      
T Consensus       242 ~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~  321 (768)
T 3rgz_A          242 AISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLE  321 (768)
T ss_dssp             HTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCC
T ss_pred             HHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCcc
Confidence            7888888888888777663211  123444455555544444444444332 4444444444444444444444      


Q ss_pred             -------------------CCCCCCEEEcccCcCcccCCCCch-------------------hhhhhcC--CCCCCEEEc
Q 037538          288 -------------------SLKDLVRLNFDQNELGSREIGDLN-------------------FLKFLAN--CTSLEVLGL  327 (461)
Q Consensus       288 -------------------~l~~L~~L~L~~n~l~~~~~~~~~-------------------~~~~l~~--~~~L~~L~L  327 (461)
                                         .+++|++|++++|++.+..+..+.                   .+..+..  +++|++|++
T Consensus       322 ~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L  401 (768)
T 3rgz_A          322 SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL  401 (768)
T ss_dssp             EEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEEC
T ss_pred             EEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEEC
Confidence                               444444555544444432111100                   0011111  334555555


Q ss_pred             cCCcCccccchHHHhccccccEEEccCCcCcccCchhhhcCCCCCeeecccCcCccccchhhhcCCCCCeeccccccCcc
Q 037538          328 AQNGFGGEMPISIANLSTHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNNLSGSVPEVIGRLNKLEGLELNANKFSG  407 (461)
Q Consensus       328 ~~n~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~~~~L~~L~L~~n~l~~  407 (461)
                      ++|.+++.+|..+..++ +|++|++++|.+++.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++
T Consensus       402 ~~n~l~~~~p~~l~~l~-~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~  480 (768)
T 3rgz_A          402 QNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTG  480 (768)
T ss_dssp             CSSEEEEECCGGGGGCT-TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             CCCccccccCHHHhcCC-CCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccC
Confidence            55555555555555544 56666666666665566666666666666666666666666666666666666666666666


Q ss_pred             cCChhhhcCccCCeeecccccccccCCccCCCCCCCCEEEccCCCCcccCCCC
Q 037538          408 FMPSSLGNLTVLSRLLMEENRFEGSIPPSLGNCKKLQVLNLSSNNLNGTIPKE  460 (461)
Q Consensus       408 ~~~~~~~~l~~L~~L~l~~n~l~~~~p~~l~~l~~L~~L~ls~N~l~~~ip~~  460 (461)
                      .+|..+.++++|+.|++++|++++.+|.++..+++|+.|++++|++.|.+|.+
T Consensus       481 ~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~  533 (768)
T 3rgz_A          481 EIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAE  533 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGG
T ss_pred             cCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHH
Confidence            66666666666666666666666666666666666666666666666666643



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 461
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-28
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score =  111 bits (277), Expect = 4e-28
 Identities = 75/301 (24%), Positives = 107/301 (35%), Gaps = 37/301 (12%)

Query: 34  IEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCN--WVGVTCSPSNG--RVTVLKLESKQ 89
              DK ALL  K  L       +SSW  +   CN  W+GV C       RV  L L    
Sbjct: 4   NPQDKQALLQIKKDLGNPT--TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 90  LVG--SIPASIGNLTNLTGINLFQN-RFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNL 146
           L     IP+S+ NL  L  + +       G IP  I +L +L  L +T+  +SG IP  L
Sbjct: 62  LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL 121

Query: 147 SHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTSNLTGNIPAWVGNFSSLQVLLLA 206
           S    L + + S N   G +P  + SL  L  I    + ++G IP   G+FS L   +  
Sbjct: 122 SQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTI 181

Query: 207 RNN---------------------------LHGSIPNELGQLSALGFFTLYENFISDVGL 239
             N                               +         +        F      
Sbjct: 182 SRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVG 241

Query: 240 TLPNLKIFAGGVNYFTGSIPVSLSNASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQ 299
              NL       N   G++P  L+    L  L+ + N L G IP+  G+L+      +  
Sbjct: 242 LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYAN 300

Query: 300 N 300
           N
Sbjct: 301 N 301


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.5
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=2.6e-40  Score=312.00  Aligned_cols=293  Identities=32%  Similarity=0.505  Sum_probs=199.5

Q ss_pred             cCcHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCcc--eeeEEecCCC--CcEEEEEcCCCCccc--ccCccccCCCCCC
Q 037538           32 ATIEADKLALLDFKNHLTQDPLQIMSSWNDSVHFCN--WVGVTCSPSN--GRVTVLKLESKQLVG--SIPASIGNLTNLT  105 (461)
Q Consensus        32 ~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~--w~gv~c~~~~--~~v~~L~l~~~~l~~--~~~~~l~~l~~L~  105 (461)
                      .|.++|++||++||+++. +|. .+++|..++|||.  |.||+|+..+  .||++|+|+++++.|  .+|++++++++|+
T Consensus         2 ~c~~~e~~aLl~~k~~~~-~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~   79 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLG-NPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT-CCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             CCCHHHHHHHHHHHHHCC-CCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcccc
Confidence            599999999999999997 443 5889998899994  9999998643  489999999998876  4678888888888


Q ss_pred             EEecCC-CCCcccCchhccCCCCCCEEeCCCCCCCCCCCcCCCCCCCCCEEEccCCcCCCcCchhhcCCCCCcEEEccCC
Q 037538          106 GINLFQ-NRFHGQIPEEIGRLQKLQDLNLTYNYLSGKIPTNLSHCTELRSFEASANDFIGQIPDQLISLTKLEIIRLGTS  184 (461)
Q Consensus       106 ~L~L~~-n~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n  184 (461)
                      +|+|++ |+++|.+|.+|+++++|++|++++|++.+..+..+..+.+|+++++++|.+.+.+|..+.++++|+++++++|
T Consensus        80 ~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n  159 (313)
T d1ogqa_          80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccc
Confidence            888876 6787788888888888888888888887777777777777888888777777777777777777777777777


Q ss_pred             CCcccCCccCCCCCCC-CEEECccCCCcccCChhhhcCCCCcEEecCCCCchhhccCCCCCcEEEccCccCccccChhhc
Q 037538          185 NLTGNIPAWVGNFSSL-QVLLLARNNLHGSIPNELGQLSALGFFTLYENFISDVGLTLPNLKIFAGGVNYFTGSIPVSLS  263 (461)
Q Consensus       185 ~l~~~~~~~l~~l~~L-~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~l~~L~~L~l~~n~~~~~~~~~l~  263 (461)
                      .+.+.+|..+..+.++ +.++++.|++++..|..                                            +.
T Consensus       160 ~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~--------------------------------------------~~  195 (313)
T d1ogqa_         160 RISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPT--------------------------------------------FA  195 (313)
T ss_dssp             CCEEECCGGGGCCCTTCCEEECCSSEEEEECCGG--------------------------------------------GG
T ss_pred             cccccccccccccccccccccccccccccccccc--------------------------------------------cc
Confidence            7777677666666554 56666666665544433                                            33


Q ss_pred             CCCCCCEEEcccccccccCCccCCCCCCCCEEEcccCcCcccCCCCchhhhhhcCCCCCCEEEccCCcCccccchHHHhc
Q 037538          264 NASNLQVLDFAENGLTGTIPENFGSLKDLVRLNFDQNELGSREIGDLNFLKFLANCTSLEVLGLAQNGFGGEMPISIANL  343 (461)
Q Consensus       264 ~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~l~~~~~L~~L~L~~n~~~~~~~~~~~~~  343 (461)
                      .+. ...++++++...+.+|..+..+++++.++++++.+.+      .. ..+..+++|+.|++++|+++|.+|..+..+
T Consensus       196 ~l~-~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~------~~-~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L  267 (313)
T d1ogqa_         196 NLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF------DL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQL  267 (313)
T ss_dssp             GCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECC------BG-GGCCCCTTCCEEECCSSCCEECCCGGGGGC
T ss_pred             ccc-ccccccccccccccccccccccccccccccccccccc------cc-cccccccccccccCccCeecccCChHHhCC
Confidence            332 3356666666666666666666666666666665543      11 123444555555555555555555544444


Q ss_pred             cccccEEEccCCcCcccCchhhhcCCCCCeeecccCc
Q 037538          344 STHLRILTMGYNLMHGNIPVGIENLVNLSLLGLEGNN  380 (461)
Q Consensus       344 ~~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~Ls~n~  380 (461)
                      + +|++|++++|+++|.+|+ ++++++|+.+++++|+
T Consensus       268 ~-~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         268 K-FLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             T-TCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             C-CCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            3 455555555555544442 3444445555555544



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure