Citrus Sinensis ID: 037539


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620--
NQYKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDLSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEESTPGPGTDDDSDTLEDEDDQFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRKFRN
cccccccEEEcccccccccccccccccccccccccccEEcccccccccccccEEEccccccccccccHHHccccccccEEEEcccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHcccccccccccEEEccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccccccHHHHHccccccEEEccccccEEEcccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccEEEEEccccccccccccEEEccccccccccHHHHHHcccccccEEcccccccccccHHHHHHHHHHcccccEEEcccccccccccHHHHccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHcc
ccccEEEEccccccccccccccccHcccEEcccHccccccccccccccHHccEEEEEcccccccccccHHHcccccccEEEcccccccccccccHccHccccccEEEEcccccccccccccccccHHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccHHHHccccEEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccccccccHHHHccHHHccEEEcccccccccccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHcccHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
nqykhiphtsnsqQNFIVDLLINLGQHLEVNIERLQELVLGLgkffetsnintFFLNTVSVTKSSDWFQVVAKLHSLKSLVLfscalppvnpsfiwhfnlstsietldlsdnnlpsssvypwLLNLKAFQHMVSLKSlylsdseleggipkffgnmcSLKKLRLSYNKLSGQYSQVIQNLSFGcvvnsleglylrwndftgpiphlggfssleawSLDVNCLNGTIDKSLSQLskleslsldgnsLRAISLCIltspigisdsipdWFWDLSNKlsylnlsnnhfrgklpdlslrfddlssnllsgglpdcwlhFDRLFILNLANnrlsgkipdsmgflnNIWTlnlhnnrltgklpsplrnfsqlrvldleknaifgeiptwIGESLQNLIVLSlksnkfhgnipyqfeneYKSTLGlvrcldlssnkldgaipEEIMDLVGLIALnlsrnhltgpitpkigeltsldfldlsrnlfsgsipcslsqlsglgvldlsynnlsgkipsgtqlqsfnasvyagnlelcglplanmcldeestpgpgtdddsdtlededdqFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRKFRN
nqykhiphtsnsqqNFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDLSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEESTPGPGTDDDSDTLEDEDDQFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVnisklqrkfrn
NQYKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETldlsdnnlpsssVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKslsqlskleslslDGNSLRAISLCILTSPIGISDSIPDWFWDlsnklsylnlsnnHFRGKLPDLSLRFDDlssnllsgglPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEEstpgpgtdddsdtlededdQFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRKFRN
**************NFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDLSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCL**********************QFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNIS********
*QYKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDLSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLA***************************FITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRKF**
NQYKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDLSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEE************TLEDEDDQFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRKFRN
*QYKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDLSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCL******************DEDDQFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NQYKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFFETSNINTFFLNTVSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDLSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEESTPGPGTDDDSDTLEDEDDQFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRKFRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query622 2.2.26 [Sep-21-2011]
Q42371 976 LRR receptor-like serine/ no no 0.762 0.485 0.315 6e-44
Q8VZG8 1045 Probable LRR receptor-lik no no 0.631 0.376 0.330 5e-43
O49318 1124 Probable leucine-rich rep no no 0.654 0.362 0.333 6e-43
Q9LYN8 1192 Leucine-rich repeat recep no no 0.635 0.331 0.340 1e-42
O65440 992 Leucine-rich repeat recep no no 0.651 0.408 0.327 4e-42
Q9LHP4 1141 Receptor-like protein kin no no 0.575 0.313 0.353 2e-40
C0LGV1 1135 LRR receptor-like serine/ no no 0.644 0.353 0.332 3e-40
C0LGQ5 1249 LRR receptor-like serine/ no no 0.774 0.385 0.316 4e-40
Q9C9H7847 Receptor-like protein 12 no no 0.683 0.501 0.291 6e-40
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.601 0.373 0.325 1e-39
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function desciption
 Score =  179 bits (454), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 181/574 (31%), Positives = 257/574 (44%), Gaps = 100/574 (17%)

Query: 54  FFLNTVSVTKSSDWFQVVAKLHSLKSL--VLFSCALPPVNPSFIWH----FNLSTSIETL 107
           F L+ V+   S +   ++    S K +  VL+     P +   +W      N++ ++  L
Sbjct: 14  FCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVAL 73

Query: 108 DLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKKLRLSYN 167
           +LSD NL    + P + +LK      SL S+ L  + L G IP   G+  SL+ L LS+N
Sbjct: 74  NLSDLNL-DGEISPAIGDLK------SLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFN 126

Query: 168 KLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPH-LGGFSSLEAWSLDVNCLNGTI 226
           +LSG     I  L        LE L L+ N   GPIP  L    +L+   L  N L+G I
Sbjct: 127 ELSGDIPFSISKLK------QLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEI 180

Query: 227 DKSLSQLSKLESLSLDGNSLR---AISLCILTS-------PIGISDSIPDWFWDLSNKLS 276
            + +     L+ L L GN+L    +  LC LT           ++ SIP+   + +    
Sbjct: 181 PRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCT-AFQ 239

Query: 277 YLNLSNNHFRGKLPD----LSLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKI 332
            L+LS N   G++P     L +    L  N LSG +P        L +L+L+ N LSG I
Sbjct: 240 VLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSI 299

Query: 333 PDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGE------ 386
           P  +G L     L LH+N+LTG +P  L N S+L  L+L  N + G IP  +G+      
Sbjct: 300 PPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFD 359

Query: 387 -----------------SLQNLIVLSLKSNKFHGNIPYQFE------------NEYK--- 414
                            S  NL  L++  NKF G IP  F+            N  K   
Sbjct: 360 LNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPI 419

Query: 415 ----STLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDF 470
               S +G +  LDLS+NK++G IP  + DL  L+ +NLSRNH+TG +    G L S+  
Sbjct: 420 PVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIME 479

Query: 471 LDLSRNLFSGSIPCSLSQLS-----------------------GLGVLDLSYNNLSGKIP 507
           +DLS N  SG IP  L+QL                         L VL++S+NNL G IP
Sbjct: 480 IDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIP 539

Query: 508 SGTQLQSFNASVYAGNLELCGLPLANMCLDEEST 541
                  F+   + GN  LCG  L + C D   T
Sbjct: 540 KNNNFSRFSPDSFIGNPGLCGSWLNSPCHDSRRT 573




Receptor kinase that, together with ERL1 and ERL2, regulates aerial architecture, including inflorescence (e.g. shoot apical meristem-originating organ shape, elongation of the internode and pedicels, and adaxial-abaxial polarity), and stomatal patterning (e.g. density and clustering), probably by tuning cell division and expansion. Modulates plant transpiration efficiency by controlling stomatal density, leaf photosynthetic capacity, epidermal cell expansion, mesophyll cell proliferation and cell-cell contact. Probable major trait regulating canalization (maintenance of phenotype despite varying environment) in many aspect of the plant physiology (e.g. plant morphology, light-dependent leaves number, branch number, flowering time, phytate and mineral concentrations) by transducing microenvironmental variation into phenotypic differentiation (ecological amplifier). May maintain development integrity in heat stress conditions. Regulates cell wall composition and structure. Confers resistance to the pathogenic bacteria Ralstonia solanacearum and to the necrotrophic fungi Plectosphaerella cucumerina and Pythium irregulare, and required for callose deposition upon infection. Resistance to P.cucumerina seems cell wall-mediated.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query622
225462661 1485 PREDICTED: LRR receptor-like serine/thre 0.898 0.376 0.362 1e-102
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.778 0.472 0.383 1e-102
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.908 0.581 0.344 1e-100
147834202 1270 hypothetical protein VITISV_011552 [Viti 0.887 0.434 0.378 1e-100
224105895 963 predicted protein [Populus trichocarpa] 0.951 0.614 0.352 2e-98
359490560 1010 PREDICTED: LRR receptor-like serine/thre 0.810 0.499 0.377 3e-96
147795695 1680 hypothetical protein VITISV_022720 [Viti 0.827 0.306 0.375 5e-95
302143722 750 unnamed protein product [Vitis vinifera] 0.797 0.661 0.406 1e-94
224125666 938 predicted protein [Populus trichocarpa] 0.890 0.590 0.369 3e-94
147807651 971 hypothetical protein VITISV_018647 [Viti 0.909 0.582 0.337 2e-93
>gi|225462661|ref|XP_002266475.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 290/799 (36%), Positives = 373/799 (46%), Gaps = 240/799 (30%)

Query: 59  VSVTKSSDWFQVVAKLHSLKSLVLFSCALPPVNPSF-IWHFNLSTSIETLDLSDNNLPSS 117
           V+++K+  W Q V K+ +L  L L +  LPP++P+  I H N STS+  L+L +N+L +S
Sbjct: 168 VNLSKAIHWPQAVKKMPALTELYLSNTQLPPIDPTISISHINSSTSLAVLELFENDL-TS 226

Query: 118 SVYPWLLNLK-------------------AFQHMVSLKSLYLSDSELEGGIPK------- 151
           S+YPWLLN                     AF +M +L  L LS ++LEG IPK       
Sbjct: 227 SIYPWLLNFSSCLVHLDLSNNHLNGSIPDAFGNMTTLAYLDLSFNQLEGEIPKSFSINLV 286

Query: 152 ---------------FFGNMCSLKKLRLSYNKLSGQYSQVIQNLS--------------- 181
                           FGNM +L  L  S N+L G+  + ++ L                
Sbjct: 287 TLDLSWNHLHGSIPDAFGNMATLAYLHFSGNQLEGEIPKSLRGLCDLQILSLSQNNLTGL 346

Query: 182 -----FGCVVNSLEGLYLRWNDFTGPIPHLGGFSSLEAWSLDVNCLNGTIDKSLSQL--- 233
                  C  N+LE L L  N F G  P L GFS L    L+ N LNGT+ +S+ QL   
Sbjct: 347 LEKDFLACSNNTLEVLDLSHNQFKGSFPDLSGFSQLRELHLEFNQLNGTLPESIGQLAQL 406

Query: 234 ----------------------SKLESLSLDGNSL------------RAISL----CIL- 254
                                 SKL  L L  NSL            +AI +    C L 
Sbjct: 407 QVLSLRSNSLRGTVSANHLFGLSKLWDLDLSFNSLTVNISLEQVPQFQAIEIKLASCKLG 466

Query: 255 -----------------TSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLP------- 290
                             S  GI++ +P+WFW  ++ LS+ N+SNNH  G LP       
Sbjct: 467 PHFPNWLRTQKHLSMLDISASGIANVLPNWFWKFTSHLSWFNISNNHISGTLPNLTSHLS 526

Query: 291 -------------------------DLS---------------------LRFDDLSSNLL 304
                                    DLS                     L   DLS+N L
Sbjct: 527 YLGMDISSNCLEGSIPQSLFNAQWLDLSKNMFSGSISLSCGTTNQSSWGLSHLDLSNNRL 586

Query: 305 SGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFS 364
           SG LP C   +  L +LNLANN  SGKI +S+G   ++ TL+L NN LTG LP  L+N  
Sbjct: 587 SGELPKCREQWKDLIVLNLANNNFSGKIKNSIGLSYHMQTLHLRNNSLTGALPWSLKNCR 646

Query: 365 QLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSN--------------KFH-------- 402
            LR+LDL KN + G+IP WIG SL NLIV++L+SN              K H        
Sbjct: 647 DLRLLDLGKNKLSGKIPGWIGGSLSNLIVVNLRSNEFNGSIPLNLCQLKKIHMLDLSSNN 706

Query: 403 --GNIPYQFEN---------------------------------------EYKSTLGLVR 421
             G IP    N                                       EY  TLGLV+
Sbjct: 707 LSGTIPKCLNNLSGMAQNGSLVITYEEDLLFLMSLSYYDNTLVQWKGKELEYNKTLGLVK 766

Query: 422 CLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGS 481
            +D S+NKL G IP E+ DLV L++LNLSRN+L GPI   IG+L SLD LDLSRN   G 
Sbjct: 767 SIDFSNNKLIGEIPTEVTDLVELVSLNLSRNYLIGPIPLMIGQLKSLDSLDLSRNRLHGG 826

Query: 482 IPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEEST 541
           IP SLSQ++ L VLDLS N LSGKIPSGTQLQSFNAS Y GN  LCG PL   C ++E+ 
Sbjct: 827 IPISLSQIARLSVLDLSDNILSGKIPSGTQLQSFNASTYDGNPGLCGPPLLKKCQEDENR 886

Query: 542 PGPGTDDDSDTLEDEDDQFITLGFYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGM 601
               T   ++  ED  D    + FY + +L F +GFWGV GTL+LN SW Y YF FL+ +
Sbjct: 887 EVSFTGLSNE--EDIQDDANNIWFYGNIVLGFIIGFWGVCGTLLLNSSWRYAYFQFLSKI 944

Query: 602 KDWVSVISAVNISKLQRKF 620
           KDW+ V + + +S L+ K 
Sbjct: 945 KDWLYVTTTICMSDLELKL 963




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834202|emb|CAN64227.1| hypothetical protein VITISV_011552 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490560|ref|XP_002266431.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795695|emb|CAN67736.1| hypothetical protein VITISV_022720 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143722|emb|CBI22583.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125666|ref|XP_002329688.1| predicted protein [Populus trichocarpa] gi|222870596|gb|EEF07727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query622
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.336 0.189 0.404 1.7e-38
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.323 0.176 0.390 1.1e-37
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.324 0.179 0.387 7e-37
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.336 0.175 0.376 2.4e-36
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.379 0.188 0.384 8e-36
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.606 0.367 0.318 7.3e-30
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.596 0.296 0.295 1.5e-27
TAIR|locus:2051628 1008 PSKR1 "phytosulfokin receptor 0.348 0.215 0.402 5.2e-35
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.307 0.168 0.409 1.8e-34
UNIPROTKB|Q5Z9N5 994 P0481E08.42 "Os06g0717200 prot 0.334 0.209 0.4 2.8e-34
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 1.7e-38, Sum P(2) = 1.7e-38
 Identities = 89/220 (40%), Positives = 128/220 (58%)

Query:   321 LNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEI 380
             L LA+N  +G++P  +G L+ + TLN+ +N+LTG++PS + N   L+ LD+  N   G +
Sbjct:   510 LQLADNGFTGELPREIGMLSQLGTLNISSNKLTGEVPSEIFNCKMLQRLDMCCNNFSGTL 569

Query:   381 PTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMD 440
             P+ +G SL  L +L L +N   G IP    N     L  +  L +  N  +G+IP E+  
Sbjct:   570 PSEVG-SLYQLELLKLSNNNLSGTIPVALGN-----LSRLTELQMGGNLFNGSIPRELGS 623

Query:   441 LVGL-IALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSY 499
             L GL IALNLS N LTG I P++  L  L+FL L+ N  SG IP S + LS L   + SY
Sbjct:   624 LTGLQIALNLSYNKLTGEIPPELSNLVMLEFLLLNNNNLSGEIPSSFANLSSLLGYNFSY 683

Query:   500 NNLSGKIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEE 539
             N+L+G IP    L++ + S + GN  LCG PL N C+  +
Sbjct:   684 NSLTGPIPL---LRNISMSSFIGNEGLCGPPL-NQCIQTQ 719


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051628 PSKR1 "phytosulfokin receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5Z9N5 P0481E08.42 "Os06g0717200 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query622
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-52
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-38
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  191 bits (488), Expect = 9e-52
 Identities = 162/481 (33%), Positives = 228/481 (47%), Gaps = 89/481 (18%)

Query: 102 TSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNMCSLKK 161
           +S++ LDL  N L    +   L NL       SL+ L L+ ++L G IP+  G M SLK 
Sbjct: 164 SSLKVLDLGGNVL-VGKIPNSLTNLT------SLEFLTLASNQLVGQIPRELGQMKSLKW 216

Query: 162 LRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIP-HLGGFSSLEAWSLDVN 220
           + L YN LSG+    I  L+      SL  L L +N+ TGPIP  LG   +L+   L  N
Sbjct: 217 IYLGYNNLSGEIPYEIGGLT------SLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQN 270

Query: 221 CLNGTIDKSLSQLSKLESLSLDGNSLRAISLCILTSPIGISDSIPDWFWDLSNKLSYLNL 280
            L+G I  S+  L KL SL L  NSL              S  IP+    L N L  L+L
Sbjct: 271 KLSGPIPPSIFSLQKLISLDLSDNSL--------------SGEIPELVIQLQN-LEILHL 315

Query: 281 SNNHFRGKLP-------------------------DL----SLRFDDLSSNLLSGGLPDC 311
            +N+F GK+P                         +L    +L   DLS+N L+G +P+ 
Sbjct: 316 FSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEG 375

Query: 312 WLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPS-----PLRNF--- 363
                 LF L L +N L G+IP S+G   ++  + L +N  +G+LPS     PL  F   
Sbjct: 376 LCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDI 435

Query: 364 ----------------SQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPY 407
                             L++L L +N  FG +P   G     L  L L  N+F G +P 
Sbjct: 436 SNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSK--RLENLDLSRNQFSGAVPR 493

Query: 408 QFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTS 467
           +       +L  +  L LS NKL G IP+E+     L++L+LS N L+G I     E+  
Sbjct: 494 KL-----GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPV 548

Query: 468 LDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELC 527
           L  LDLS+N  SG IP +L  +  L  +++S+N+L G +PS     + NAS  AGN++LC
Sbjct: 549 LSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLC 608

Query: 528 G 528
           G
Sbjct: 609 G 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 622
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.47
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.36
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
PLN03150623 hypothetical protein; Provisional 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.9
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.67
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.41
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.39
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.28
KOG4341483 consensus F-box protein containing LRR [General fu 98.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.24
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.05
KOG4341483 consensus F-box protein containing LRR [General fu 97.99
PRK15386426 type III secretion protein GogB; Provisional 97.98
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.96
PRK15386426 type III secretion protein GogB; Provisional 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.23
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
KOG4308478 consensus LRR-containing protein [Function unknown 96.42
KOG4308478 consensus LRR-containing protein [Function unknown 96.36
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.31
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.75
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.5
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.9
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.65
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.77
smart0037026 LRR Leucine-rich repeats, outliers. 89.77
smart0037026 LRR Leucine-rich repeats, outliers. 88.43
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.43
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 87.54
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 87.1
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.24
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 86.13
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.54
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.99
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.2e-57  Score=525.40  Aligned_cols=497  Identities=33%  Similarity=0.447  Sum_probs=424.6

Q ss_pred             ccccCCCCcccchhhHHHHHhhcccccccCcCCcEEeCCCCCCCC------CCCccEEEcCCcccCCC-CcchHhhcCCC
Q 037539            3 YKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFFE------TSNINTFFLNTVSVTKS-SDWFQVVAKLH   75 (622)
Q Consensus         3 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~n~i~~------~~~L~~L~Ls~n~l~~~-~~~~~~l~~l~   75 (622)
                      +++++.|+++++.+.+.+|..+.    ..+++|++|++++|.+++      +++|++|++++|.+++. +.   .+.+++
T Consensus        92 l~~L~~L~Ls~n~~~~~ip~~~~----~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~---~~~~l~  164 (968)
T PLN00113         92 LPYIQTINLSNNQLSGPIPDDIF----TTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPN---DIGSFS  164 (968)
T ss_pred             CCCCCEEECCCCccCCcCChHHh----ccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCCh---HHhcCC
Confidence            56677778887777556665533    367888888888888764      38888888888888766 66   788889


Q ss_pred             CCCEEEccCCCCCCCCCCcchhccccCcccEEEccCCCCCCCCCchhhhcccccCCCccccEEEeecccCCCCCchhhcC
Q 037539           76 SLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHMVSLKSLYLSDSELEGGIPKFFGN  155 (622)
Q Consensus        76 ~L~~L~Ls~n~l~~~~~~~~~l~~l~~~L~~L~Ls~n~l~~~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~  155 (622)
                      +|++|++++|.+.+..|  ..+.++ ++|++|++++|.+.+ .+|..+      +.+++|++|++++|.+.+.+|..++.
T Consensus       165 ~L~~L~L~~n~l~~~~p--~~~~~l-~~L~~L~L~~n~l~~-~~p~~l------~~l~~L~~L~L~~n~l~~~~p~~l~~  234 (968)
T PLN00113        165 SLKVLDLGGNVLVGKIP--NSLTNL-TSLEFLTLASNQLVG-QIPREL------GQMKSLKWIYLGYNNLSGEIPYEIGG  234 (968)
T ss_pred             CCCEEECccCcccccCC--hhhhhC-cCCCeeeccCCCCcC-cCChHH------cCcCCccEEECcCCccCCcCChhHhc
Confidence            99999999998888777  678888 889999999998876 666655      67888889999988888888888888


Q ss_pred             CccCcEeEeecCCCCCcCchhhhhccccccCCCcCEEEccCCcccccCCC-CCCCCCCCEEEeecccCCccCccccCCCC
Q 037539          156 MCSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPH-LGGFSSLEAWSLDVNCLNGTIDKSLSQLS  234 (622)
Q Consensus       156 l~~L~~L~L~~n~i~~~~~~~~~~l~l~~~~~~L~~L~L~~n~~~~~~~~-l~~l~~L~~L~L~~n~l~~~~~~~l~~l~  234 (622)
                      +++|++|++++|.+.+..|..+.++     ++ |++|++++|.+.+..|. +..+++|++|++++|.+.+.+|..+.+++
T Consensus       235 l~~L~~L~L~~n~l~~~~p~~l~~l-----~~-L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~  308 (968)
T PLN00113        235 LTSLNHLDLVYNNLTGPIPSSLGNL-----KN-LQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQ  308 (968)
T ss_pred             CCCCCEEECcCceeccccChhHhCC-----CC-CCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCC
Confidence            8899999999888888888874444     44 88888888888877776 88888888888888888888888888888


Q ss_pred             CCCEEEccCCCCcccccccc----------cCCCCcccCCchhHHhcCCCCcEEEccCCcCcccCCCC-----cccEEeC
Q 037539          235 KLESLSLDGNSLRAISLCIL----------TSPIGISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPDL-----SLRFDDL  299 (622)
Q Consensus       235 ~L~~L~l~~n~l~~~~~~~~----------~~~~~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~-----~L~~L~l  299 (622)
                      +|++|++++|.+++.....+          ++.+.+.+.+|..+... ++|+.|++++|++.+..|..     .++.+++
T Consensus       309 ~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~-~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l  387 (968)
T PLN00113        309 NLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH-NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLIL  387 (968)
T ss_pred             CCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCC-CCCcEEECCCCeeEeeCChhHhCcCCCCEEEC
Confidence            88888888888775442211          56677777888877654 58899999999888777652     6888999


Q ss_pred             CCCcCccccCccccCCCCCCEEEccCCcccccCCCccCCCCCccEEeeeCCcCCCCCCccccCCCCccEEEccCCccccc
Q 037539          300 SSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGE  379 (622)
Q Consensus       300 s~n~l~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~L~L~~n~i~~~  379 (622)
                      ++|.+.+..|..+..+++|+.|++++|++++..|..+..+++|+.|++++|.+.+..+..+..+++|++|++++|.+.+.
T Consensus       388 ~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~  467 (968)
T PLN00113        388 FSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGG  467 (968)
T ss_pred             cCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeee
Confidence            99999888888899999999999999999988888899999999999999999988888888899999999999998888


Q ss_pred             CchhHHhhcccccEeecCCCcCcccCChhhhHhHhhhcCCccEEECCCCcCCccchHHhhcccccceeecCCccccCCCc
Q 037539          380 IPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPIT  459 (622)
Q Consensus       380 ~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~  459 (622)
                      +|...  ..++|+.|++++|++.+..|..+.     .+++|+.|++++|.+.+.+|+.+..+++|++|+|++|.+++.+|
T Consensus       468 ~p~~~--~~~~L~~L~ls~n~l~~~~~~~~~-----~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p  540 (968)
T PLN00113        468 LPDSF--GSKRLENLDLSRNQFSGAVPRKLG-----SLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIP  540 (968)
T ss_pred             cCccc--ccccceEEECcCCccCCccChhhh-----hhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCC
Confidence            87765  368999999999999988887776     78999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCCEEeCCCCccCccCCccccCCCCCCEEECcCCcCcccCCCCCcCCccCcccccCCcCCCCCC
Q 037539          460 PKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLP  530 (622)
Q Consensus       460 ~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~l~~~~~~~n~~lc~~~  530 (622)
                      ..+..+++|+.|+|++|++++.+|..+..+++|+.|++++|++.+.+|..+++.++....+.||+.+|+.+
T Consensus       541 ~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        541 ASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             hhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query622
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-27
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-08
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-27
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-21
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 6e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 121 bits (304), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 136/456 (29%), Positives = 190/456 (41%), Gaps = 92/456 (20%) Query: 124 LNLKAFQHMVSLKSLYLSDSELEGGIPKFFGNM-CSLKKLRLSYNKLSGQY-SQVIQNLS 181 L + M LK L LS +E G +P+ N+ SL L LS N SG + QN Sbjct: 331 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 390 Query: 182 FGCVVNSLEGLYLRWNDFTGPIP-HLGGFSSLEAWSLDVNCLNGTIDKXXXXXXXXXXXX 240 N+L+ LYL+ N FTG IP L S L + L N L+GTI Sbjct: 391 -----NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL------- 438 Query: 241 XDGNSLRAISLCILTSPIGISDSIPDWFWDXXXXXXXXXXXXXHFRGKLPDLSLRFDDXX 300 + LR + L + + IP + L L L F+D Sbjct: 439 ---SKLRDLKLWLNM----LEGEIPQELM---------------YVKTLETLILDFNDLT 476 Query: 301 XXXXXXXXPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPL 360 P + L ++L+NNRL+G+IP +G L N+ L L NN +G +P+ L Sbjct: 477 GEI-----PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL 531 Query: 361 RNFSQLRVLDLEKNAIFGEIPTWI----GESLQNLIV----------------------- 393 + L LDL N G IP + G+ N I Sbjct: 532 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLL 591 Query: 394 ------------------LSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIP 435 ++ S + G+ F+N G + LD+S N L G IP Sbjct: 592 EFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNN-----GSMMFLDMSYNMLSGYIP 646 Query: 436 EEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVL 495 +EI + L LNL N ++G I ++G+L L+ LDLS N G IP ++S L+ L + Sbjct: 647 KEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEI 706 Query: 496 DLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPL 531 DLS NNLSG IP Q ++F + + N LCG PL Sbjct: 707 DLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPL 742
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query622
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-100
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-84
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-58
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-54
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-51
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-53
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-47
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-41
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  320 bits (823), Expect = e-100
 Identities = 146/493 (29%), Positives = 210/493 (42%), Gaps = 43/493 (8%)

Query: 73  KLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLKAFQHM 132
              +L  L L         P F       + +E+L LS NN         LL ++     
Sbjct: 292 ACDTLTGLDLSGNHFYGAVPPFFGSC---SLLESLALSSNNFSGELPMDTLLKMR----- 343

Query: 133 VSLKSLYLSDSELEGGIPKFFGNMC-SLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEG 191
             LK L LS +E  G +P+   N+  SL  L LS N  SG     +         N+L+ 
Sbjct: 344 -GLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK----NTLQE 398

Query: 192 LYLRWNDFTGPIPH-LGGFSSLEAWSLDVNCLNGTIDKSLSQLSKLESLSLDGNSLRAI- 249
           LYL+ N FTG IP  L   S L +  L  N L+GTI  SL  LSKL  L L  N L    
Sbjct: 399 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 458

Query: 250 --SLCILTSPI-------GISDSIPDWFWDLSNKLSYLNLSNNHFRGKLPD-----LSLR 295
              L  + +          ++  IP    + +N L++++LSNN   G++P       +L 
Sbjct: 459 PQELMYVKTLETLILDFNDLTGEIPSGLSNCTN-LNWISLSNNRLTGEIPKWIGRLENLA 517

Query: 296 FDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGK 355
              LS+N  SG +P        L  L+L  N  +G IP +M       +  +  N + GK
Sbjct: 518 ILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQ----SGKIAANFIAGK 573

Query: 356 LPSPLRNFSQLRVLDLEKNAI--FGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENEY 413
               ++N    +      N +   G     +   L      ++ S  + G+    F    
Sbjct: 574 RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLN-RLSTRNPCNITSRVYGGHTSPTF---- 628

Query: 414 KSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLDL 473
               G +  LD+S N L G IP+EI  +  L  LNL  N ++G I  ++G+L  L+ LDL
Sbjct: 629 -DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDL 687

Query: 474 SRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGLPLAN 533
           S N   G IP ++S L+ L  +DLS NNLSG IP   Q ++F  + +  N  LCG PL  
Sbjct: 688 SSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 747

Query: 534 MCLDEESTPGPGT 546
                        
Sbjct: 748 CDPSNADGYAHHQ 760


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query622
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.14
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.67
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.87
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.55
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.12
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-61  Score=546.06  Aligned_cols=515  Identities=30%  Similarity=0.428  Sum_probs=376.7

Q ss_pred             ccccCCCCcccchhhHHHHHhhcccccccCcCCcEEeCCCCCCC-----------CCCCccEEEcCCcccCCCCcchHhh
Q 037539            3 YKHIPHTSNSQQNFIVDLLINLGQHLEVNIERLQELVLGLGKFF-----------ETSNINTFFLNTVSVTKSSDWFQVV   71 (622)
Q Consensus         3 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~n~i~-----------~~~~L~~L~Ls~n~l~~~~~~~~~l   71 (622)
                      ++++++|+++++.+.+.+|..+    ..++++|++||+++|.++           ++++|++|++++|.+++...    +
T Consensus       125 l~~L~~L~Ls~n~l~~~~~~~~----~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~----~  196 (768)
T 3rgz_A          125 CSGLKFLNVSSNTLDFPGKVSG----GLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD----V  196 (768)
T ss_dssp             CTTCCEEECCSSEEECCSSCCS----CCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB----C
T ss_pred             CCCCCEEECcCCccCCcCCHHH----hccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC----c
Confidence            4566777777776644333222    235666666666666653           22556666666665555422    2


Q ss_pred             cCCCCCCEEEccCCCCCCCCCCcchhccccCcccEEEccCCCCCCCCCchhhhccc----------------ccCCCccc
Q 037539           72 AKLHSLKSLVLFSCALPPVNPSFIWHFNLSTSIETLDLSDNNLPSSSVYPWLLNLK----------------AFQHMVSL  135 (622)
Q Consensus        72 ~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~~L~~L~Ls~n~l~~~~~~~~~~~~~----------------~l~~l~~L  135 (622)
                      .++++|++|++++|.+++..+  . +.++ ++|++|++++|.+++ .+|..+..+.                ....+++|
T Consensus       197 ~~l~~L~~L~Ls~n~l~~~~~--~-l~~l-~~L~~L~Ls~n~l~~-~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L  271 (768)
T 3rgz_A          197 SRCVNLEFLDVSSNNFSTGIP--F-LGDC-SALQHLDISGNKLSG-DFSRAISTCTELKLLNISSNQFVGPIPPLPLKSL  271 (768)
T ss_dssp             TTCTTCCEEECCSSCCCSCCC--B-CTTC-CSCCEEECCSSCCCS-CHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTC
T ss_pred             ccCCcCCEEECcCCcCCCCCc--c-cccC-CCCCEEECcCCcCCC-cccHHHhcCCCCCEEECCCCcccCccCccccCCC
Confidence            455555555555555555444  2 4455 555555555555554 3333331110                00134455


Q ss_pred             cEEEeecccCCCCCchhhcCC-ccCcEeEeecCCCCCcCchhhhhccccccCCCcCEEEccCCcccccCCC--CCCCCCC
Q 037539          136 KSLYLSDSELEGGIPKFFGNM-CSLKKLRLSYNKLSGQYSQVIQNLSFGCVVNSLEGLYLRWNDFTGPIPH--LGGFSSL  212 (622)
Q Consensus       136 ~~L~L~~n~l~~~~~~~l~~l-~~L~~L~L~~n~i~~~~~~~~~~l~l~~~~~~L~~L~L~~n~~~~~~~~--l~~l~~L  212 (622)
                      ++|++++|.+++.+|..+... ++|++|++++|.+++..|..+..     +++ |++|++++|.+.+.+|.  +..+++|
T Consensus       272 ~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~-----l~~-L~~L~L~~n~l~~~ip~~~l~~l~~L  345 (768)
T 3rgz_A          272 QYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS-----CSL-LESLALSSNNFSGELPMDTLLKMRGL  345 (768)
T ss_dssp             CEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGG-----CTT-CCEEECCSSEEEEECCHHHHTTCTTC
T ss_pred             CEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhc-----CCC-ccEEECCCCcccCcCCHHHHhcCCCC
Confidence            555555555555555555443 56666666666665555555333     333 66666666666554443  5666666


Q ss_pred             CEEEeecccCCccCccccCCCC-CCCEEEccCCCCccccccc--------c----cCCCCcccCCchhHHhcCCCCcEEE
Q 037539          213 EAWSLDVNCLNGTIDKSLSQLS-KLESLSLDGNSLRAISLCI--------L----TSPIGISDSIPDWFWDLSNKLSYLN  279 (622)
Q Consensus       213 ~~L~L~~n~l~~~~~~~l~~l~-~L~~L~l~~n~l~~~~~~~--------~----~~~~~l~~~~~~~~~~~~~~L~~L~  279 (622)
                      ++|++++|.+++.+|..+..++ +|++|++++|.+++.....        +    ++.+.+++.+|..+... ++|+.|+
T Consensus       346 ~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~  424 (768)
T 3rgz_A          346 KVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC-SELVSLH  424 (768)
T ss_dssp             CEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGC-TTCCEEE
T ss_pred             CEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcC-CCCCEEE
Confidence            6666666666655666665555 6666666666554322111        1    56666777788777664 5899999


Q ss_pred             ccCCcCcccCCCC-----cccEEeCCCCcCccccCccccCCCCCCEEEccCCcccccCCCccCCCCCccEEeeeCCcCCC
Q 037539          280 LSNNHFRGKLPDL-----SLRFDDLSSNLLSGGLPDCWLHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTG  354 (622)
Q Consensus       280 l~~n~l~~~~~~~-----~L~~L~ls~n~l~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~  354 (622)
                      +++|++.+..|..     +|+.|++++|.+.+.+|..+..+++|++|++++|++++..|..+..+++|++|++++|++++
T Consensus       425 Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~  504 (768)
T 3rgz_A          425 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTG  504 (768)
T ss_dssp             CCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             CcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCC
Confidence            9999988877753     79999999999999999999999999999999999998999999999999999999999999


Q ss_pred             CCCccccCCCCccEEEccCCcccccCchhHHhhcccccEeecCCCcCcccCChhhhHh----------------------
Q 037539          355 KLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLIVLSLKSNKFHGNIPYQFENE----------------------  412 (622)
Q Consensus       355 ~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~----------------------  412 (622)
                      .+|..++.+++|++|++++|.+.+.+|..+. .+++|++|++++|++.+.+|..+...                      
T Consensus       505 ~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~-~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~  583 (768)
T 3rgz_A          505 EIPKWIGRLENLAILKLSNNSFSGNIPAELG-DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGM  583 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEEECCGGGG-GCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSC
T ss_pred             cCChHHhcCCCCCEEECCCCcccCcCCHHHc-CCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccc
Confidence            9999999999999999999999888998877 79999999999999998887654210                      


Q ss_pred             -------------------------------------------HhhhcCCccEEECCCCcCCccchHHhhcccccceeec
Q 037539          413 -------------------------------------------YKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNL  449 (622)
Q Consensus       413 -------------------------------------------~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L  449 (622)
                                                                 .+..+++|+.|||++|++++.+|..+++++.|+.|+|
T Consensus       584 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~L  663 (768)
T 3rgz_A          584 KKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNL  663 (768)
T ss_dssp             CTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEEC
T ss_pred             cccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeC
Confidence                                                       1123578999999999999999999999999999999


Q ss_pred             CCccccCCCccccCCCCCCCEEeCCCCccCccCCccccCCCCCCEEECcCCcCcccCCCCCcCCccCcccccCCcCCCCC
Q 037539          450 SRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGKIPSGTQLQSFNASVYAGNLELCGL  529 (622)
Q Consensus       450 ~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~l~~~~~~~n~~lc~~  529 (622)
                      ++|.+++.+|..++++++|++|||++|++++.+|..+..+++|++||+++|+++|.+|.+.++.++....+.|||.+||.
T Consensus       664 s~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~  743 (768)
T 3rgz_A          664 GHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGY  743 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEEST
T ss_pred             cCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCC
Q 037539          530 PLANMCLDEE  539 (622)
Q Consensus       530 ~~~~~C~~~~  539 (622)
                      |.. .|....
T Consensus       744 ~l~-~C~~~~  752 (768)
T 3rgz_A          744 PLP-RCDPSN  752 (768)
T ss_dssp             TSC-CCCSCC
T ss_pred             CCc-CCCCCc
Confidence            886 785443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 622
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 89.0 bits (219), Expect = 5e-20
 Identities = 72/266 (27%), Positives = 111/266 (41%), Gaps = 15/266 (5%)

Query: 274 KLSYLNLSNNHFRGKLPDLS-------LRFDDLSSNL-LSGGLPDCWLHFDRLFILNLAN 325
           +++ L+LS  +     P  S       L F  +     L G +P       +L  L + +
Sbjct: 51  RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITH 110

Query: 326 NRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIG 385
             +SG IPD +  +  + TL+   N L+G LP  + +   L  +  + N I G IP   G
Sbjct: 111 TNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYG 170

Query: 386 ESLQNLIVLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLI 445
              +    +++  N+  G IP  F N               S  +       +       
Sbjct: 171 SFSKLFTSMTISRNRLTGKIPPTFANLN-------LAFVDLSRNMLEGDASVLFGSDKNT 223

Query: 446 ALNLSRNHLTGPITPKIGELTSLDFLDLSRNLFSGSIPCSLSQLSGLGVLDLSYNNLSGK 505
                  +       K+G   +L+ LDL  N   G++P  L+QL  L  L++S+NNL G+
Sbjct: 224 QKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE 283

Query: 506 IPSGTQLQSFNASVYAGNLELCGLPL 531
           IP G  LQ F+ S YA N  LCG PL
Sbjct: 284 IPQGGNLQRFDVSAYANNKCLCGSPL 309


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query622
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.06
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.66
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.66
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.96  E-value=4.6e-27  Score=240.63  Aligned_cols=168  Identities=25%  Similarity=0.359  Sum_probs=114.5

Q ss_pred             cCCCCCCEEEccCCcccccCCCccCCCCCccEEeeeCCcCCCCCCccccCCCCccEEEccCCcccccCchhHHhhccccc
Q 037539          313 LHFDRLFILNLANNRLSGKIPDSMGFLNNIWTLNLHNNRLTGKLPSPLRNFSQLRVLDLEKNAIFGEIPTWIGESLQNLI  392 (622)
Q Consensus       313 ~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~~l~~L~  392 (622)
                      ..+++|++|++++|++++.  ..+..+++|+.|++++|.+++..  .+..+++|++|++++|.+ ..++..  ..++.++
T Consensus       216 ~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L~l~~~~l-~~~~~~--~~~~~l~  288 (384)
T d2omza2         216 GILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLA--PLSGLTKLTELKLGANQI-SNISPL--AGLTALT  288 (384)
T ss_dssp             GGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCC-CCCGGG--TTCTTCS
T ss_pred             cccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCCC--cccccccCCEeeccCccc-CCCCcc--ccccccc
Confidence            3455667777777766632  24556677777777777776432  366677777777777776 333322  2467777


Q ss_pred             EeecCCCcCcccCChhhhHhHhhhcCCccEEECCCCcCCccchHHhhcccccceeecCCccccCCCccccCCCCCCCEEe
Q 037539          393 VLSLKSNKFHGNIPYQFENEYKSTLGLVRCLDLSSNKLDGAIPEEIMDLVGLIALNLSRNHLTGPITPKIGELTSLDFLD  472 (622)
Q Consensus       393 ~L~L~~n~l~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~  472 (622)
                      .+.+.+|.+.+..  .+.     .++.++.|++++|++++..  .+..+++|++|++++|++++ + ..++++++|++|+
T Consensus       289 ~l~~~~n~l~~~~--~~~-----~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~~-l-~~l~~l~~L~~L~  357 (384)
T d2omza2         289 NLELNENQLEDIS--PIS-----NLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVSD-V-SSLANLTNINWLS  357 (384)
T ss_dssp             EEECCSSCCSCCG--GGG-----GCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCCC-C-GGGGGCTTCCEEE
T ss_pred             ccccccccccccc--ccc-----hhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCCCC-C-hhHcCCCCCCEEE
Confidence            7777777776422  122     5777888888888887543  36778888888888888874 3 3577888888888


Q ss_pred             CCCCccCccCCccccCCCCCCEEECcCC
Q 037539          473 LSRNLFSGSIPCSLSQLSGLGVLDLSYN  500 (622)
Q Consensus       473 Ls~n~l~~~~~~~l~~l~~L~~L~ls~N  500 (622)
                      +++|++++..|  +.++++|+.|++++|
T Consensus       358 l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         358 AGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            88888886544  778888888888876



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure