Citrus Sinensis ID: 037554

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFVEAPRNDNEANWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSNFKKAVEKKY
cccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccHHHHHHHHHHHHcHHHHHHHHc
cccccHHHHHHHHHHHHHHcccEEEEEcEcccccccccccccEccHHHHHHHHHHHHHHccccccEEEccccccHHHccccEEEEEccccccccHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcc
tgggnalnVQRTVKDLVAAGAagcfledqswpkkcghmhgkqiipaEEHAAKIASArdaigdsdFVLARADasfveaprndneanwvwghtlhtpeeLKAMGFHLTVHPLTALYASARALVDVLKTLKesgttrdhlekmgtfeefnqlVNLESWFEIEGRYSNFKKAVEKKY
tgggnalnvqRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFveaprndneaNWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESgttrdhlekmgtfeefnqlVNLESWFEiegrysnfkkavekky
TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFVEAPRNDNEANWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSNFKKAVEKKY
********VQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFVEAPRNDNEANWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSNF********
TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFVEAPRNDNEANWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSN*********
TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFVEAPRNDNEANWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSNFKKAVEKKY
**GGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFVEAPRNDNEANWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSNFKKAV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVLARADASFVEAPRNDNEANWVWGHTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSNFKKAVEKKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
O49290339 Carboxyvinyl-carboxyphosp yes no 0.976 0.498 0.644 1e-72
Q05957318 Petal death protein OS=Di N/A no 0.919 0.5 0.535 3e-54
Q0QLE4289 2,3-dimethylmalate lyase N/A no 0.947 0.567 0.359 4e-27
P54528301 Methylisocitrate lyase OS yes no 0.953 0.548 0.314 8e-19
Q9YFM7308 Methylisocitrate lyase OS yes no 0.890 0.5 0.316 2e-18
P11435295 Carboxyvinyl-carboxyphosp yes no 0.930 0.545 0.310 3e-17
Q9Z9T7300 Methylisocitrate lyase OS yes no 0.959 0.553 0.291 3e-16
P77541296 Methylisocitrate lyase OS N/A no 0.924 0.540 0.321 5e-16
Q8NSH8305 Probable methylisocitrate yes no 0.965 0.547 0.265 6e-14
Q56062295 Methylisocitrate lyase OS yes no 0.947 0.555 0.313 7e-14
>sp|O49290|CPPM_ARATH Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic OS=Arabidopsis thaliana GN=At1g77060 PE=1 SV=2 Back     alignment and function desciption
 Score =  271 bits (694), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 152/211 (72%), Gaps = 42/211 (19%)

Query: 1   TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAI 60
           TGGGNALN+QRTVKDL+AAGAAGCFLEDQ+WPKKCGHM GKQ+IPAEEHAAKIASARDAI
Sbjct: 124 TGGGNALNIQRTVKDLIAAGAAGCFLEDQAWPKKCGHMRGKQVIPAEEHAAKIASARDAI 183

Query: 61  GDSDFVL---------------------------ARADASFVEAPRNDNEANWVWGHT-- 91
           GDSDF L                           A ADASFVEAPR+D+E   +   T  
Sbjct: 184 GDSDFFLVARTDVRATSAKSGLEDAIARVNLYMEAGADASFVEAPRDDDELKEIGKRTKG 243

Query: 92  -------------LHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLE 138
                        LHTP+ELK MGFHL VHPLTALYAS RALVDVLKTLKE+G+TRDHL+
Sbjct: 244 YRVCNMIEGGVTPLHTPDELKEMGFHLIVHPLTALYASTRALVDVLKTLKENGSTRDHLQ 303

Query: 139 KMGTFEEFNQLVNLESWFEIEGRYSNFKKAV 169
           KM TFEEFN LV+L+SWFE+E RYSN + A+
Sbjct: 304 KMATFEEFNSLVDLDSWFELEARYSNLRNAL 334

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 8EC: .EC: 2EC: 3
>sp|Q05957|PDP_DIACA Petal death protein OS=Dianthus caryophyllus GN=PDP PE=1 SV=1 Back     alignment and function description
>sp|Q0QLE4|DML_EUBBA 2,3-dimethylmalate lyase OS=Eubacterium barkeri GN=Dml PE=1 SV=1 Back     alignment and function description
>sp|P54528|PRPB_BACSU Methylisocitrate lyase OS=Bacillus subtilis (strain 168) GN=prpB PE=3 SV=1 Back     alignment and function description
>sp|Q9YFM7|PRPB_AERPE Methylisocitrate lyase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prpB PE=3 SV=2 Back     alignment and function description
>sp|P11435|CPPM_STRHY Carboxyvinyl-carboxyphosphonate phosphorylmutase OS=Streptomyces hygroscopicus GN=bcpA PE=1 SV=3 Back     alignment and function description
>sp|Q9Z9T7|PRPB_BACHD Methylisocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prpB PE=3 SV=1 Back     alignment and function description
>sp|P77541|PRPB_ECOLI Methylisocitrate lyase OS=Escherichia coli (strain K12) GN=prpB PE=1 SV=3 Back     alignment and function description
>sp|Q8NSH8|PRPB1_CORGL Probable methylisocitrate lyase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpB1 PE=3 SV=1 Back     alignment and function description
>sp|Q56062|PRPB_SALTY Methylisocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpB PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
18411340 339 putative carboxyvinyl-carboxyphosphonate 0.976 0.498 0.644 5e-71
18252195 337 putative carboxyphosphonoenolpyruvate mu 0.976 0.501 0.644 5e-71
2829913 335 putative carboxyphosphonoenolpyruvate mu 0.976 0.504 0.644 6e-71
297842473 335 hypothetical protein ARALYDRAFT_476868 [ 0.976 0.504 0.639 8e-70
30687359 336 phosphoenolpyruvate carboxylase-like pro 0.976 0.502 0.620 5e-68
297850562 334 mutase family protein [Arabidopsis lyrat 0.976 0.505 0.606 1e-66
9454574 304 Similar carboxyphosphonoenolpyruvate pho 0.890 0.506 0.568 1e-55
125536016 357 hypothetical protein OsI_37721 [Oryza sa 0.942 0.456 0.554 2e-54
125578736 356 hypothetical protein OsJ_35468 [Oryza sa 0.942 0.457 0.554 2e-54
77553225 356 Carboxyvinyl-carboxyphosphonate phosphor 0.942 0.457 0.554 2e-54
>gi|18411340|ref|NP_565148.1| putative carboxyvinyl-carboxyphosphonate phosphorylmutase [Arabidopsis thaliana] gi|148886630|sp|O49290.2|CPPM_ARATH RecName: Full=Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic; AltName: Full=Carboxyphosphonoenolpyruvate phosphonomutase; Short=CPEP phosphonomutase; Flags: Precursor gi|21537183|gb|AAM61524.1| carboxyphosphonoenolpyruvate mutase, putative [Arabidopsis thaliana] gi|332197807|gb|AEE35928.1| putative carboxyvinyl-carboxyphosphonate phosphorylmutase [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 152/211 (72%), Gaps = 42/211 (19%)

Query: 1   TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAI 60
           TGGGNALN+QRTVKDL+AAGAAGCFLEDQ+WPKKCGHM GKQ+IPAEEHAAKIASARDAI
Sbjct: 124 TGGGNALNIQRTVKDLIAAGAAGCFLEDQAWPKKCGHMRGKQVIPAEEHAAKIASARDAI 183

Query: 61  GDSDFVL---------------------------ARADASFVEAPRNDNEANWVWGHT-- 91
           GDSDF L                           A ADASFVEAPR+D+E   +   T  
Sbjct: 184 GDSDFFLVARTDVRATSAKSGLEDAIARVNLYMEAGADASFVEAPRDDDELKEIGKRTKG 243

Query: 92  -------------LHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLE 138
                        LHTP+ELK MGFHL VHPLTALYAS RALVDVLKTLKE+G+TRDHL+
Sbjct: 244 YRVCNMIEGGVTPLHTPDELKEMGFHLIVHPLTALYASTRALVDVLKTLKENGSTRDHLQ 303

Query: 139 KMGTFEEFNQLVNLESWFEIEGRYSNFKKAV 169
           KM TFEEFN LV+L+SWFE+E RYSN + A+
Sbjct: 304 KMATFEEFNSLVDLDSWFELEARYSNLRNAL 334

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18252195|gb|AAL61930.1| putative carboxyphosphonoenolpyruvate mutase [Arabidopsis thaliana] gi|21386949|gb|AAM47878.1| putative carboxyphosphonoenolpyruvate mutase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2829913|gb|AAC00621.1| putative carboxyphosphonoenolpyruvate mutase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297842473|ref|XP_002889118.1| hypothetical protein ARALYDRAFT_476868 [Arabidopsis lyrata subsp. lyrata] gi|297334959|gb|EFH65377.1| hypothetical protein ARALYDRAFT_476868 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30687359|ref|NP_173565.2| phosphoenolpyruvate carboxylase-like protein [Arabidopsis thaliana] gi|63003786|gb|AAY25422.1| At1g21440 [Arabidopsis thaliana] gi|66841372|gb|AAY57323.1| At1g21440 [Arabidopsis thaliana] gi|110741086|dbj|BAE98637.1| hypothetical protein [Arabidopsis thaliana] gi|332191981|gb|AEE30102.1| phosphoenolpyruvate carboxylase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297850562|ref|XP_002893162.1| mutase family protein [Arabidopsis lyrata subsp. lyrata] gi|297339004|gb|EFH69421.1| mutase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|9454574|gb|AAF87897.1|AC015447_7 Similar carboxyphosphonoenolpyruvate phosphonomutases [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|125536016|gb|EAY82504.1| hypothetical protein OsI_37721 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|125578736|gb|EAZ19882.1| hypothetical protein OsJ_35468 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|77553225|gb|ABA96021.1| Carboxyvinyl-carboxyphosphonate phosphorylmutase, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2025272339 AT1G77060 [Arabidopsis thalian 0.687 0.351 0.595 2e-33
TAIR|locus:2027022336 AT1G21440 [Arabidopsis thalian 0.647 0.333 0.593 9.8e-32
UNIPROTKB|Q0QLE4289 Dml "2,3-dimethylmalate lyase" 0.416 0.249 0.520 7.4e-28
TIGR_CMR|SPO_1470287 SPO_1470 "isocitrate lyase fam 0.439 0.264 0.519 7e-22
UNIPROTKB|P77541296 prpB "2-methylisocitrate lyase 0.427 0.25 0.506 5.1e-20
ASPGD|ASPL0000059587 454 AN9369 [Emericella nidulans (t 0.416 0.158 0.527 6.9e-19
TIGR_CMR|SO_0345292 SO_0345 "methylisocitrate lyas 0.439 0.260 0.428 1.1e-15
UNIPROTKB|Q9KSC2308 prpB "Methylisocitrate lyase" 0.439 0.246 0.428 1.6e-15
TIGR_CMR|VC_1336308 VC_1336 "methylisocitrate lyas 0.439 0.246 0.428 1.6e-15
TIGR_CMR|CBU_0771290 CBU_0771 "methylisocitrate lya 0.433 0.258 0.402 9e-14
TAIR|locus:2025272 AT1G77060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
 Identities = 81/136 (59%), Positives = 97/136 (71%)

Query:    50 AAKIASARDAIGDSDFVL-ARADASFVEAPRNDNE-------------ANWVWGHT--LH 93
             +AK +   DAI   +  + A ADASFVEAPR+D+E              N + G    LH
Sbjct:   200 SAK-SGLEDAIARVNLYMEAGADASFVEAPRDDDELKEIGKRTKGYRVCNMIEGGVTPLH 258

Query:    94 TPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLE 153
             TP+ELK MGFHL VHPLTALYAS RALVDVLKTLKE+G+TRDHL+KM TFEEFN LV+L+
Sbjct:   259 TPDELKEMGFHLIVHPLTALYASTRALVDVLKTLKENGSTRDHLQKMATFEEFNSLVDLD 318

Query:   154 SWFEIEGRYSNFKKAV 169
             SWFE+E RYSN + A+
Sbjct:   319 SWFELEARYSNLRNAL 334
GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA
TAIR|locus:2027022 AT1G21440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0QLE4 Dml "2,3-dimethylmalate lyase" [Eubacterium barkeri (taxid:1528)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1470 SPO_1470 "isocitrate lyase family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P77541 prpB "2-methylisocitrate lyase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
ASPGD|ASPL0000059587 AN9369 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0345 SO_0345 "methylisocitrate lyase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KSC2 prpB "Methylisocitrate lyase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1336 VC_1336 "methylisocitrate lyase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0771 CBU_0771 "methylisocitrate lyase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
TIGR02317285 TIGR02317, prpB, methylisocitrate lyase 4e-36
COG2513289 COG2513, PrpB, PEP phosphonomutase and related enz 3e-35
cd00377243 cd00377, ICL_PEPM, Members of the ICL/PEPM enzyme 5e-35
PRK11320292 PRK11320, prpB, 2-methylisocitrate lyase; Provisio 4e-25
TIGR02319294 TIGR02319, CPEP_Pphonmut, carboxyvinyl-carboxyphos 1e-20
pfam13714238 pfam13714, PEP_mutase, Phosphoenolpyruvate phospho 6e-19
COG2224433 COG2224, AceA, Isocitrate lyase [Energy production 1e-13
TIGR01346 527 TIGR01346, isocit_lyase, isocitrate lyase 4e-13
PRK15063428 PRK15063, PRK15063, isocitrate lyase; Provisional 5e-13
pfam00463 526 pfam00463, ICL, Isocitrate lyase family 4e-11
PLN02892 570 PLN02892, PLN02892, isocitrate lyase 1e-10
TIGR02321290 TIGR02321, Pphn_pyruv_hyd, phosphonopyruvate hydro 7e-07
TIGR02320285 TIGR02320, PEP_mutase, phosphoenolpyruvate phospho 2e-04
PRK06498 531 PRK06498, PRK06498, isocitrate lyase; Provisional 0.002
>gnl|CDD|131370 TIGR02317, prpB, methylisocitrate lyase Back     alignment and domain information 
 Score =  125 bits (317), Expect = 4e-36
 Identities = 66/192 (34%), Positives = 93/192 (48%), Gaps = 39/192 (20%)

Query: 1   TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAI 60
           TG G A NV RTV+++  AGAA   +EDQ  PK+CGH+ GK+++  EE   KIA+A DA 
Sbjct: 82  TGFGEAFNVARTVREMEDAGAAAVHIEDQVLPKRCGHLPGKELVSREEMVDKIAAAVDAK 141

Query: 61  GDSDFVL------------------------ARADASFVEAPRNDNE------------- 83
            D DFV+                        A AD  F EA  +  E             
Sbjct: 142 RDEDFVIIARTDARAVEGLDAAIERAKAYVEAGADMIFPEALTSLEEFRQFAKAVKVPLL 201

Query: 84  ANWV-WGHT-LHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMG 141
           AN   +G T L T +EL+  G+ + ++P+TA  A  +A   V   +KE GT +  L+ M 
Sbjct: 202 ANMTEFGKTPLFTADELREAGYKMVIYPVTAFRAMNKAAEAVYNEIKEHGTQKGSLDDMQ 261

Query: 142 TFEEFNQLVNLE 153
           T +E  +L+   
Sbjct: 262 TRKELYELIGYY 273

Members of this family are methylisocitrate lyase, also called (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate pyruvate-lyase. This enzyme acts in propionate metabolism. It cleaves a carbon-carbon bond to convert 2-methylisocitrate to pyruvate plus succinate. Some members of this family have been annotated, incorrectly it seems, as the related protein carboxyphosphoenolpyruvate phosphomutase, which is involved in synthesizing the antibiotic bialaphos in Streptomyces hygroscopicus. Length = 285
>gnl|CDD|225311 COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119340 cd00377, ICL_PEPM, Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>gnl|CDD|183086 PRK11320, prpB, 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>gnl|CDD|131372 TIGR02319, CPEP_Pphonmut, carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>gnl|CDD|222337 pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase Back     alignment and domain information
>gnl|CDD|225134 COG2224, AceA, Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233364 TIGR01346, isocit_lyase, isocitrate lyase Back     alignment and domain information
>gnl|CDD|237893 PRK15063, PRK15063, isocitrate lyase; Provisional Back     alignment and domain information
>gnl|CDD|201244 pfam00463, ICL, Isocitrate lyase family Back     alignment and domain information
>gnl|CDD|215482 PLN02892, PLN02892, isocitrate lyase Back     alignment and domain information
>gnl|CDD|131374 TIGR02321, Pphn_pyruv_hyd, phosphonopyruvate hydrolase Back     alignment and domain information
>gnl|CDD|233820 TIGR02320, PEP_mutase, phosphoenolpyruvate phosphomutase Back     alignment and domain information
>gnl|CDD|180592 PRK06498, PRK06498, isocitrate lyase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 100.0
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 100.0
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 100.0
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 100.0
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 100.0
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 100.0
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 100.0
PRK15063428 isocitrate lyase; Provisional 99.97
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 99.97
PRK06498 531 isocitrate lyase; Provisional 99.89
TIGR01346 527 isocit_lyase isocitrate lyase. Isocitrate lyase an 99.85
KOG1260492 consensus Isocitrate lyase [Energy production and 99.83
PLN02892 570 isocitrate lyase 99.82
COG2224433 AceA Isocitrate lyase [Energy production and conve 99.81
PF00463526 ICL: Isocitrate lyase family; InterPro: IPR000918 99.78
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 99.28
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 98.91
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 98.81
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 98.24
PLN02424332 ketopantoate hydroxymethyltransferase 97.25
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 95.44
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 95.18
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 94.05
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 92.56
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 92.34
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 92.07
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 92.06
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 92.01
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 91.78
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 91.62
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 91.33
PLN02417280 dihydrodipicolinate synthase 91.32
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 91.26
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 90.75
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 90.32
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 90.31
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 90.2
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 90.17
PRK04147293 N-acetylneuraminate lyase; Provisional 90.15
PRK03170292 dihydrodipicolinate synthase; Provisional 89.95
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 89.71
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 89.51
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 89.29
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 89.2
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 89.01
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 88.93
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 88.84
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 88.79
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 88.66
PLN02746347 hydroxymethylglutaryl-CoA lyase 88.46
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 88.29
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 88.04
PF00682237 HMGL-like: HMGL-like of this family is not conserv 88.02
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 87.99
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 87.81
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 87.74
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 87.63
PLN02460338 indole-3-glycerol-phosphate synthase 87.59
PLN02424332 ketopantoate hydroxymethyltransferase 87.22
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 87.11
PRK12330 499 oxaloacetate decarboxylase; Provisional 87.1
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 86.91
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 86.67
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 86.59
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 86.58
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 86.51
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 86.5
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 86.08
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 85.81
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 85.61
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 85.42
PRK12581 468 oxaloacetate decarboxylase; Provisional 85.14
PRK12331 448 oxaloacetate decarboxylase; Provisional 85.02
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 85.01
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 84.86
PRK14041 467 oxaloacetate decarboxylase; Provisional 84.64
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 84.5
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 84.24
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 84.13
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 83.97
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 83.41
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 82.98
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 82.92
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 82.89
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 82.72
PLN02334229 ribulose-phosphate 3-epimerase 82.61
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 82.27
PRK11177575 phosphoenolpyruvate-protein phosphotransferase; Pr 82.17
PRK11613282 folP dihydropteroate synthase; Provisional 81.81
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 81.75
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 81.74
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 81.48
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 81.4
PLN03228 503 methylthioalkylmalate synthase; Provisional 81.31
PLN02591250 tryptophan synthase 81.27
PRK14042 596 pyruvate carboxylase subunit B; Provisional 81.17
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 81.03
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 80.96
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 80.94
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 80.58
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 80.47
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.4e-46  Score=313.72  Aligned_cols=164  Identities=38%  Similarity=0.514  Sum_probs=157.6

Q ss_pred             CCCCChHHHHHHHHHHHHhCceEEEeccCCCCccCCCCCCCcccCHHHHHHHHHHHHHhcCCCCEEE-------------
Q 037554            1 TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVL-------------   67 (173)
Q Consensus         1 tGyG~~~~v~rtv~~~~~aGvagi~iEDq~~pKrcg~~~g~~l~~~ee~~~kI~Aa~~a~~~~d~~I-------------   67 (173)
                      ||||++.|++|||++++++|++|||||||++||||||++||+|+|++||+.||+||++++.++||||             
T Consensus        87 tGfG~~~nvartV~~~~~aG~agi~iEDq~~pk~cgh~~gk~l~~~~e~v~rIkAa~~a~~~~~fvi~ARTda~~~~~ld  166 (289)
T COG2513          87 TGFGEALNVARTVRELEQAGAAGIHIEDQVGPKRCGHLPGKELVSIDEMVDRIKAAVEARRDPDFVIIARTDALLVEGLD  166 (289)
T ss_pred             CCCCcHHHHHHHHHHHHHcCcceeeeeecccchhcCCCCCCCcCCHHHHHHHHHHHHHhccCCCeEEEeehHHHHhccHH
Confidence            7999999999999999999999999999999999999999999999999999999999999999999             


Q ss_pred             -----------ecCCcccccCCCCHHHHhhh----------h----c-CCCCCHHHHHhCCccEEEechHHHHHHHHHHH
Q 037554           68 -----------ARADASFVEAPRNDNEANWV----------W----G-HTLHTPEELKAMGFHLTVHPLTALYASARALV  121 (173)
Q Consensus        68 -----------AGAD~ifv~g~~~~e~i~~i----------~----g-~p~~~~~eL~~lGv~~v~~~~~~~~aa~~a~~  121 (173)
                                 ||||+||+|+++|.+++++|          |    + +|++|.++|+++||++||||++.+|++++++.
T Consensus       167 ~AI~Ra~AY~eAGAD~if~~al~~~e~i~~f~~av~~pl~~N~t~~g~tp~~~~~~L~~~Gv~~V~~~~~~~raa~~a~~  246 (289)
T COG2513         167 DAIERAQAYVEAGADAIFPEALTDLEEIRAFAEAVPVPLPANITEFGKTPLLTVAELAELGVKRVSYGLTAFRAALKAAE  246 (289)
T ss_pred             HHHHHHHHHHHcCCcEEccccCCCHHHHHHHHHhcCCCeeeEeeccCCCCCcCHHHHHhcCceEEEECcHHHHHHHHHHH
Confidence                       99999999999999999999          2    3 78899999999999999999999999999999


Q ss_pred             HHHHHHHHcCCcccccccCCCHHHHHHhcChhhHHHHHhcccc
Q 037554          122 DVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSN  164 (173)
Q Consensus       122 ~~~~~l~~~g~~~~~~~~~~~~~e~~~l~g~~~~~~~~~~y~~  164 (173)
                      +.++.|+++|+.....+.|.+.+++++++++++|.+.+.+|.+
T Consensus       247 ~~~~~i~~~gt~~~~~d~m~~r~~l~~~~~y~~~~~~~~~~~~  289 (289)
T COG2513         247 QAAREIRREGTQANVLDKMQTRKELYDLINYYDYEAKDDELFP  289 (289)
T ss_pred             HHHHHHHhcCchhhHHHHHHHHHHHHHhhcHHHHHHHHHhhcC
Confidence            9999999999998888888899999999999999999988753

>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK06498 isocitrate lyase; Provisional Back     alignment and domain information
>TIGR01346 isocit_lyase isocitrate lyase Back     alignment and domain information
>KOG1260 consensus Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>PLN02892 isocitrate lyase Back     alignment and domain information
>COG2224 AceA Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>PF00463 ICL: Isocitrate lyase family; InterPro: IPR000918 Isocitrate lyase (4 Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>PRK11177 phosphoenolpyruvate-protein phosphotransferase; Provisional Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
1zlp_A318 Petal Death Protein Psr132 With Cysteine-Linked Glu 2e-55
4iqd_A305 Crystal Structure Of Carboxyvinyl-carboxyphosphonat 1e-17
1mum_A295 Structure Of The 2-Methylisocitrate Lyase (Prpb) Fr 5e-17
1xg3_A295 Crystal Structure Of The C123s 2-Methylisocitrate L 7e-16
1ujq_A305 Crystal Structure Of 2-Methylisocitrate Lyase (Prpb 3e-15
3eoo_A298 2.9a Crystal Structure Of Methyl-Isocitrate Lyase F 2e-11
3lye_A307 Crystal Structure Of Oxaloacetate Acetylhydrolase L 4e-10
3i4e_A439 Crystal Structure Of Isocitrate Lyase From Burkhold 8e-10
1f61_A429 Crystal Structure Of Isocitrate Lyase From Mycobact 1e-09
3fa3_A302 Crystal Structure Of 2,3-Dimethylmalate Lyase, A Pe 1e-08
1f8i_A429 Crystal Structure Of Isocitrate Lyase:nitropropiona 1e-08
1igw_A434 Crystal Structure Of The Isocitrate Lyase From The 4e-08
1dqu_A 538 Crystal Structure Of The Isocitrate Lyase From Aspe 8e-08
3eol_A 433 2.0a Crystal Structure Of Isocitrate Lyase From Bru 9e-08
3lg3_A435 1.4a Crystal Structure Of Isocitrate Lyase From Yer 1e-07
3e5b_A 433 2.4 A Crystal Structure Of Isocitrate Lyase From Br 1e-07
1m1b_A295 Crystal Structure Of Phosphoenolpyruvate Mutase Com 3e-05
1s2u_A295 Crystal Structure Of The D58a Phosphoenolpyruvate M 3e-05
1pym_A295 Phosphoenolpyruvate Mutase From Mollusk In With Bou 4e-05
3b8i_A287 Crystal Structure Of Oxaloacetate Decarboxylase Fro 6e-05
>pdb|1ZLP|A Chain A, Petal Death Protein Psr132 With Cysteine-Linked Glutaraldehyde Forming A Thiohemiacetal Adduct Length = 318 Back     alignment and structure 
Iteration: 1

 Score =  211 bits (536), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/198 (53%), Positives = 132/198 (66%), Gaps = 39/198 (19%)
Query: 7   LNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFV 66
           LNVQR +++L++AGA G FLEDQ WPKKCGHM GK ++PAEEHA KIA+AR+AIGDSDF 
Sbjct: 116 LNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRGKAVVPAEEHALKIAAAREAIGDSDFF 175
Query: 67  L------------------------ARADASFVEAPRNDNE-------------ANWVWG 89
           L                        A ADA+FVEAP N +E             AN + G
Sbjct: 176 LVARTDARAPHGLEEGIRRANLYKEAGADATFVEAPANVDELKEVSAKTKGLRIANMIEG 235
Query: 90  --HTLHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMGTFEEFN 147
               LHTPEE K MGFHL  H LTA+YA+ARALV+++K LKE GTTRD L++M TF EFN
Sbjct: 236 GKTPLHTPEEFKEMGFHLIAHSLTAVYATARALVNIMKILKEKGTTRDDLDQMATFSEFN 295
Query: 148 QLVNLESWFEIEGRYSNF 165
           +L++LESW+E+E ++ NF
Sbjct: 296 ELISLESWYEMESKFKNF 313
>pdb|4IQD|A Chain A, Crystal Structure Of Carboxyvinyl-carboxyphosphonate Phosphorylmutase From Bacillus Anthracis Length = 305 Back     alignment and structure
>pdb|1MUM|A Chain A, Structure Of The 2-Methylisocitrate Lyase (Prpb) From Escherichia Coli Length = 295 Back     alignment and structure
>pdb|1XG3|A Chain A, Crystal Structure Of The C123s 2-Methylisocitrate Lyase Mutant From Escherichia Coli In Complex With The Reaction Product, Mg(Ii)-Pyruvate And Succinate Length = 295 Back     alignment and structure
>pdb|1UJQ|A Chain A, Crystal Structure Of 2-Methylisocitrate Lyase (Prpb) From Salmonella Enterica Serovar Typhimurium Length = 305 Back     alignment and structure
>pdb|3EOO|A Chain A, 2.9a Crystal Structure Of Methyl-Isocitrate Lyase From Burkholderia Pseudomallei Length = 298 Back     alignment and structure
>pdb|3LYE|A Chain A, Crystal Structure Of Oxaloacetate Acetylhydrolase Length = 307 Back     alignment and structure
>pdb|3I4E|A Chain A, Crystal Structure Of Isocitrate Lyase From Burkholderia Pseudomallei Length = 439 Back     alignment and structure
>pdb|1F61|A Chain A, Crystal Structure Of Isocitrate Lyase From Mycobacterium Tuberculosis Length = 429 Back     alignment and structure
>pdb|3FA3|A Chain A, Crystal Structure Of 2,3-Dimethylmalate Lyase, A Pep MutaseISOCITRATE Lyase Superfamily Member, Trigonal Crystal Form Length = 302 Back     alignment and structure
>pdb|1F8I|A Chain A, Crystal Structure Of Isocitrate Lyase:nitropropionate:glyoxylate Complex From Mycobacterium Tuberculosis Length = 429 Back     alignment and structure
>pdb|1IGW|A Chain A, Crystal Structure Of The Isocitrate Lyase From The A219c Mutant Of Escherichia Coli Length = 434 Back     alignment and structure
>pdb|1DQU|A Chain A, Crystal Structure Of The Isocitrate Lyase From Aspergillus Nidulans Length = 538 Back     alignment and structure
>pdb|3EOL|A Chain A, 2.0a Crystal Structure Of Isocitrate Lyase From Brucella Melitensis (P43212) Length = 433 Back     alignment and structure
>pdb|3LG3|A Chain A, 1.4a Crystal Structure Of Isocitrate Lyase From Yersinia Pestis Co92 Length = 435 Back     alignment and structure
>pdb|3E5B|A Chain A, 2.4 A Crystal Structure Of Isocitrate Lyase From Brucella Melitensis Length = 433 Back     alignment and structure
>pdb|1M1B|A Chain A, Crystal Structure Of Phosphoenolpyruvate Mutase Complexed With Sulfopyruvate Length = 295 Back     alignment and structure
>pdb|1S2U|A Chain A, Crystal Structure Of The D58a Phosphoenolpyruvate Mutase Mutant Protein Length = 295 Back     alignment and structure
>pdb|1PYM|A Chain A, Phosphoenolpyruvate Mutase From Mollusk In With Bound Mg2-oxalate Length = 295 Back     alignment and structure
>pdb|3B8I|A Chain A, Crystal Structure Of Oxaloacetate Decarboxylase From Pseudomonas Aeruginosa (Pa4872) In Complex With Oxalate And Mg2+. Length = 287 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 4e-63
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 2e-60
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 1e-59
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 2e-58
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 2e-57
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 3e-55
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 1e-53
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 1e-51
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 3e-48
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 6e-33
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 3e-20
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 2e-13
1dqu_A 538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 5e-13
3i4e_A 439 Isocitrate lyase; structural genomics, seattle str 9e-13
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 1e-11
3eol_A433 Isocitrate lyase; seattle structural center for in 6e-10
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Length = 318 Back     alignment and structure
 Score =  196 bits (499), Expect = 4e-63
 Identities = 112/206 (54%), Positives = 138/206 (66%), Gaps = 39/206 (18%)

Query: 1   TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAI 60
           TGGG  LNVQR +++L++AGA G FLEDQ WPKKCGHM GK ++PAEEHA KIA+AR+AI
Sbjct: 110 TGGGGPLNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRGKAVVPAEEHALKIAAAREAI 169

Query: 61  GDSDFVL-AR-----------------------ADASFVEAPRNDNE------------- 83
           GDSDF L AR                       ADA+FVEAP N +E             
Sbjct: 170 GDSDFFLVARTDARAPHGLEEGIRRANLYKEAGADATFVEAPANVDELKEVSAKTKGLRI 229

Query: 84  ANWV-WGHT-LHTPEELKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMG 141
           AN +  G T LHTPEE K MGFHL  H LTA+YA+ARALV+++K LKE GTTRD L++M 
Sbjct: 230 ANMIEGGKTPLHTPEEFKEMGFHLIAHSLTAVYATARALVNIMKILKEKGTTRDDLDQMA 289

Query: 142 TFEEFNQLVNLESWFEIEGRYSNFKK 167
           TF EFN+L++LESW+E+E ++ NF  
Sbjct: 290 TFSEFNELISLESWYEMESKFKNFTP 315
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} Length = 298 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Length = 302 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Length = 295 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Length = 307 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Length = 295 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Length = 290 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Length = 287 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Length = 275 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Length = 255 Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} PDB: 1igw_A Length = 435 Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Length = 538 Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Length = 439 Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Length = 429 Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 100.0
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 100.0
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 100.0
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 100.0
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 100.0
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 100.0
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 100.0
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 100.0
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 100.0
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 100.0
3eol_A433 Isocitrate lyase; seattle structural center for in 100.0
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 99.98
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 99.97
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 99.97
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 99.93
1dqu_A 538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 99.92
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 99.08
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 98.75
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 98.74
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 98.54
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 93.36
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 92.61
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 92.51
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 92.44
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 92.4
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 92.38
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 92.24
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 92.16
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 92.03
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 91.95
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 91.8
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 91.69
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 91.56
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 91.48
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 91.42
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 90.9
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 90.85
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 90.82
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 90.77
1dqu_A538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 90.58
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 90.58
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 90.54
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 90.48
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 90.45
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 90.31
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 90.24
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 89.51
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 89.44
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 89.37
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 89.27
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 89.24
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 89.22
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 89.03
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 88.99
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 88.53
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 88.52
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 88.47
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 88.28
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 88.26
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 87.23
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 87.14
3ble_A337 Citramalate synthase from leptospira interrogans; 87.12
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 86.88
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 85.46
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 84.58
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 84.38
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 84.23
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 84.16
2hmc_A 344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 84.05
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 83.76
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 83.68
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 83.37
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 83.27
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 83.24
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 83.22
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 83.05
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 82.65
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 82.59
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 82.38
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 81.71
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 81.71
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 81.21
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 81.07
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 80.62
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 80.44
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
Probab=100.00  E-value=8.4e-45  Score=308.33  Aligned_cols=165  Identities=31%  Similarity=0.430  Sum_probs=157.1

Q ss_pred             CCCCChHHHHHHHHHHHHhCceEEEeccCCCCccCCCCCCCcccCHHHHHHHHHHHHHhcCCCCEEE-------------
Q 037554            1 TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVL-------------   67 (173)
Q Consensus         1 tGyG~~~~v~rtv~~~~~aGvagi~iEDq~~pKrcg~~~g~~l~~~ee~~~kI~Aa~~a~~~~d~~I-------------   67 (173)
                      +|||++.|+.+||++|+++||+|||||||++||||||+.+++|+|.+||++||+||++|+.++||+|             
T Consensus        92 ~Gyg~~~~v~~~v~~l~~aGaagv~iEDq~~~k~cGh~~gk~l~~~~e~~~ri~Aa~~A~~~~~~~I~ARTDa~~~~gld  171 (298)
T 3eoo_A           92 TGWGGAFNIARTIRSFIKAGVGAVHLEDQVGQKRCGHRPGKECVPAGEMVDRIKAAVDARTDETFVIMARTDAAAAEGID  171 (298)
T ss_dssp             TCSSSHHHHHHHHHHHHHTTCSEEEEECBCCCCCTTCCCCCCBCCHHHHHHHHHHHHHHCSSTTSEEEEEECTHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHhCCeEEEECCCCCCcccCCCCCCeecCHHHHHHHHHHHHHhccCCCeEEEEeehhhhhcCHH
Confidence            6999999999999999999999999999999999999999999999999999999999999899999             


Q ss_pred             -----------ecCCcccccCCCCHHHHhhh----------h----c-CCCCCHHHHHhCCccEEEechHHHHHHHHHHH
Q 037554           68 -----------ARADASFVEAPRNDNEANWV----------W----G-HTLHTPEELKAMGFHLTVHPLTALYASARALV  121 (173)
Q Consensus        68 -----------AGAD~ifv~g~~~~e~i~~i----------~----g-~p~~~~~eL~~lGv~~v~~~~~~~~aa~~a~~  121 (173)
                                 ||||+||+|+++|.+++++|          |    | +|.++.+||+++||++||||++++++++.+|+
T Consensus       172 eai~Ra~ay~~AGAD~if~~~~~~~ee~~~~~~~~~~Pl~~n~~~~g~tp~~~~~eL~~lGv~~v~~~~~~~raa~~a~~  251 (298)
T 3eoo_A          172 AAIERAIAYVEAGADMIFPEAMKTLDDYRRFKEAVKVPILANLTEFGSTPLFTLDELKGANVDIALYCCGAYRAMNKAAL  251 (298)
T ss_dssp             HHHHHHHHHHHTTCSEEEECCCCSHHHHHHHHHHHCSCBEEECCTTSSSCCCCHHHHHHTTCCEEEECSHHHHHHHHHHH
T ss_pred             HHHHHHHhhHhcCCCEEEeCCCCCHHHHHHHHHHcCCCeEEEeccCCCCCCCCHHHHHHcCCeEEEEchHHHHHHHHHHH
Confidence                       99999999999999999999          1    2 57889999999999999999999999999999


Q ss_pred             HHHHHHHHcCCcccccccCCCHHHHHHhcChhhHHHHHhcccch
Q 037554          122 DVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFEIEGRYSNF  165 (173)
Q Consensus       122 ~~~~~l~~~g~~~~~~~~~~~~~e~~~l~g~~~~~~~~~~y~~~  165 (173)
                      +++++|+++|++....+.+++++|+++++|+++|.+++++|...
T Consensus       252 ~~~~~i~~~g~~~~~~~~~~~~~el~~l~~~~~~~~~~~~~~~~  295 (298)
T 3eoo_A          252 NFYETVRRDGTQKAAVPTMQTRAQLYDYLGYYAYEEKLDQLFNQ  295 (298)
T ss_dssp             HHHHHHHHHSSSGGGGGGSCCHHHHHHHTTHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHcCCccchhhcCCCHHHHHHHcCHHHHHHHHHHHhcc
Confidence            99999999999998888889999999999999999988888543
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1muma_289 c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichi 6e-23
d1s2wa_275 c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mus 7e-20
d1igwa_416 c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [ 1e-18
d1dqua_ 519 c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidula 2e-16
d1f61a_418 c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tube 5e-16
d1f61a_418 c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tube 1e-05
d2p10a1197 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 2e-09
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Phosphoenolpyruvate mutase/Isocitrate lyase-like
domain: 2-methylisocitrate lyase
species: Escherichia coli [TaxId: 562]

 Score = 90.2 bits (223), Expect = 6e-23
 Identities = 56/203 (27%), Positives = 86/203 (42%), Gaps = 40/203 (19%)

Query: 1   TGGGNALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAI 60
             G +A NV RTVK ++ AGAAG  +EDQ   K+CGH   K I+  EE   +I +A DA 
Sbjct: 87  GFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAK 146

Query: 61  GDSDFVL-ARADASFVEAPRNDNE---------ANWVWGHTLHTPEE------------- 97
            D DFV+ AR DA  VE      E         A  ++   +                  
Sbjct: 147 TDPDFVIMARTDALAVEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPIL 206

Query: 98  ----------------LKAMGFHLTVHPLTALYASARALVDVLKTLKESGTTRDHLEKMG 141
                           L++    + ++PL+A  A  RA   V   L++ GT +  ++ M 
Sbjct: 207 ANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQ 266

Query: 142 TFEEFNQLVNLESWFE-IEGRYS 163
           T  E  + +N   + E ++  ++
Sbjct: 267 TRNELYESINYYQYEEKLDNLFA 289
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 275 Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure
>d1dqua_ c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidulans [TaxId: 162425]} Length = 519 Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 418 Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 418 Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Length = 197 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 100.0
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 100.0
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 100.0
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 99.97
d1dqua_ 519 Isocitrate lyase {Aspergillus nidulans [TaxId: 162 99.91
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 99.35
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 93.88
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 93.44
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 92.54
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 92.04
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 91.52
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 91.51
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 90.91
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 87.91
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 84.2
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 83.51
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 83.36
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Phosphoenolpyruvate mutase/Isocitrate lyase-like
domain: 2-methylisocitrate lyase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.1e-43  Score=296.75  Aligned_cols=163  Identities=36%  Similarity=0.504  Sum_probs=154.6

Q ss_pred             CCCCC-hHHHHHHHHHHHHhCceEEEeccCCCCccCCCCCCCcccCHHHHHHHHHHHHHhcCCCCEEE------------
Q 037554            1 TGGGN-ALNVQRTVKDLVAAGAAGCFLEDQSWPKKCGHMHGKQIIPAEEHAAKIASARDAIGDSDFVL------------   67 (173)
Q Consensus         1 tGyG~-~~~v~rtv~~~~~aGvagi~iEDq~~pKrcg~~~g~~l~~~ee~~~kI~Aa~~a~~~~d~~I------------   67 (173)
                      ||||+ +.||+|||++|+++||+|||||||++||||||..++.++|.++++.||+||++++.++||+|            
T Consensus        86 ~GyG~~~~~v~~~v~~~~~aGvagi~iEDq~~pk~~g~~~~~~~~~~~e~~~ki~aa~~a~~~~d~~IiARTDa~~~~g~  165 (289)
T d1muma_          86 IGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTDALAVEGL  165 (289)
T ss_dssp             TCSSSSHHHHHHHHHHHHHHTCSEEEEECBCCCSSTTCCSCCCBCCHHHHHHHHHHHHHTCSSTTSEEEEEECCHHHHCH
T ss_pred             ccccccchHHHHHHHHHHHCCCCEEEecCcccccccccccccceecHHHHHHHHHHHHHhcCCcchhheeccccccccCH
Confidence            79997 78999999999999999999999999999999999999999999999999999999999988            


Q ss_pred             ------------ecCCcccccCCCCHHHHhhh----------h----c-CCCCCHHHHHhCCccEEEechHHHHHHHHHH
Q 037554           68 ------------ARADASFVEAPRNDNEANWV----------W----G-HTLHTPEELKAMGFHLTVHPLTALYASARAL  120 (173)
Q Consensus        68 ------------AGAD~ifv~g~~~~e~i~~i----------~----g-~p~~~~~eL~~lGv~~v~~~~~~~~aa~~a~  120 (173)
                                  ||||+||++++++.++++++          +    + +|++|++||.++||++++||++++++++++|
T Consensus       166 ~eAi~R~~aY~eAGAD~vf~~~~~~~~~~~~~~~~~~~Pl~~~~~~~~~~p~~s~~eL~~~Gv~~v~~~~~~~~aa~~a~  245 (289)
T d1muma_         166 DAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRAA  245 (289)
T ss_dssp             HHHHHHHHHHHHTTCSEEEETTCCCHHHHHHHHHHHCSCBEEECCSSSSSCCCCHHHHHHTTCSEEEESSHHHHHHHHHH
T ss_pred             HHHHHHHHHhhhcCCcEEEecCCCCHHHHHHHHHhcCCCEEEeecCcCCCccchHHHHHHhccceEEechHHHHHHHHHH
Confidence                        99999999999999999999          1    2 6788999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCcccccccCCCHHHHHHhcChhhHHH-HHhccc
Q 037554          121 VDVLKTLKESGTTRDHLEKMGTFEEFNQLVNLESWFE-IEGRYS  163 (173)
Q Consensus       121 ~~~~~~l~~~g~~~~~~~~~~~~~e~~~l~g~~~~~~-~~~~y~  163 (173)
                      ++.++.|+++|+.....+.|.+++++++++|+++|++ ++++|.
T Consensus       246 ~~~~~~l~~~G~~~~~~~~m~~~~el~~l~g~~~~ee~~~~~~a  289 (289)
T d1muma_         246 EHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQYEEKLDNLFA  289 (289)
T ss_dssp             HHHHHHHHHHSSSGGGGGGSCCHHHHHHHTTTHHHHHHHHHHCC
T ss_pred             HHHHHHHHHcCCcccchhcccCHHHHHHhcCHHHHHHHHHhhcC
Confidence            9999999999999888888999999999999999987 788773
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqua_ c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure