Citrus Sinensis ID: 037558


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MGSPTLSTVVPSLVLLILFFVSSFLITVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVCSSLEA
ccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEEcccccEEEEEEcccccEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEccccEEEccccHHHHcccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccEEcccHHccccccccEEEEcccccEEcccccccccccccEEEEccEEEEcccHHHHccccccEEEccccEEEccccccHHccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccEEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccc
mgsptlstvvPSLVLLILFFVSSFLitvssepneEADTLLKWKASLQsrnqsrlpswtkattnvsskispcawygiscndaGRVINISlrntglsgtlhgfsfssfprlayldltgsglfgtippevgllSHLKFLFidtnkldgsippevgqlsSMEVFFLCsnylngsvppslgnlshislLFIYdnlfsgfipsdignsksifnldlssnqfsgpiplffgnlsnlkSLYLYGnslsspilsslgkfKSLIDLQlnenqftgyiprsfgnltslSTLRLsknelfgsipdeigkmrslsvldlnenqfkgvlppsisnltNLKELALLYNHlsgsippslGNLILRELLLSgnhfagylpynicqggaLEIFTVsenhfqgtiptsvrnCTSLIRVHLngnnltgniSEALaiypnltfidlsrnnfygeissnwgkcpkldtlnvsmnnitggipreignssqlQALDLSLNHIVgeipkelgklnsLTKLILRGNQRAVTLSFINKVCSSLEA
mgsptlstVVPSLVLLILFFVSSFLITVSSEPNEEADTLLKWKASLqsrnqsrlpswtkattnvsskispcaWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLIlrgnqravtLSFINKVCSSLEA
MGsptlstvvpslvllilffvssfliTVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVCSSLEA
*******TVVPSLVLLILFFVSSFLITVS**********L*W*****************ATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVC*****
**********PSLVLLILFFVSSFLITVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVCSSLE*
********VVPSLVLLILFFVSSFLITVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVCSSLEA
**SPTLSTVVPSLVLLILFFVSSFLITVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKA******KISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVC*****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSPTLSTVVPSLVLLILFFVSSFLITVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVCSSLEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query518 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik yes no 0.928 0.460 0.427 1e-105
Q9LP24 1120 Probable leucine-rich rep no no 0.752 0.348 0.488 1e-92
Q9SHI2 1101 Leucine-rich repeat recep no no 0.930 0.437 0.333 6e-69
Q9FRS6 1029 Leucine-rich repeat recep no no 0.945 0.476 0.322 4e-65
C0LGV1 1135 LRR receptor-like serine/ no no 0.934 0.426 0.318 3e-64
C0LGQ5 1249 LRR receptor-like serine/ no no 0.849 0.352 0.360 5e-64
O49318 1124 Probable leucine-rich rep no no 0.752 0.346 0.366 2e-63
Q9LVP0 1102 Probable leucine-rich rep no no 0.936 0.440 0.333 4e-63
P93194 1109 Receptor-like protein kin N/A no 0.758 0.354 0.369 7e-63
Q9SSL9 1123 Leucine-rich repeat recep no no 0.851 0.392 0.315 3e-62
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score =  381 bits (978), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 220/515 (42%), Positives = 311/515 (60%), Gaps = 34/515 (6%)

Query: 14  VLLILFFVSSFLITVSSEPNEEADTLLKWKASLQSR-NQSRLPSWTKATTNVSSKISPC- 71
           VLLI+  V S    VS+   EEA+ LLKWK++  ++ + S+L SW    T+     S C 
Sbjct: 30  VLLIISIVLSCSFAVSATV-EEANALLKWKSTFTNQTSSSKLSSWVNPNTS-----SFCT 83

Query: 72  AWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLS 131
           +WYG++C+  G +I ++L NTG+ GT   F FSS P L ++DL+ +   GTI P  G  S
Sbjct: 84  SWYGVACS-LGSIIRLNLTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFS 142

Query: 132 HLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLF 191
            L++  +  N+L G IPPE+G LS+++   L  N LNGS+P  +G L+ ++ + IYDNL 
Sbjct: 143 KLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLL 202

Query: 192 SGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFK 251
           +G IPS  GN   + NL L  N  SG IP   GNL NL+ L L  N+L+  I SS G  K
Sbjct: 203 TGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLK 262

Query: 252 SLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQF 311
           ++  L + ENQ +G IP   GN+T+L TL L  N+L G IP  +G +++L+VL L  NQ 
Sbjct: 263 NVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQL 322

Query: 312 KGVLPPSISNLTNLKELALLYNHLSGSIPPSLGN------LILRELLLSG---------- 355
            G +PP +  + ++ +L +  N L+G +P S G       L LR+  LSG          
Sbjct: 323 NGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANST 382

Query: 356 ---------NHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNL 406
                    N+F G+LP  IC+GG LE  T+ +NHF+G +P S+R+C SLIRV   GN+ 
Sbjct: 383 ELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSF 442

Query: 407 TGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSS 466
           +G+ISEA  +YP L FIDLS NNF+G++S+NW +  KL    +S N+ITG IP EI N +
Sbjct: 443 SGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMT 502

Query: 467 QLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQ 501
           QL  LDLS N I GE+P+ +  +N ++KL L GN+
Sbjct: 503 QLSQLDLSSNRITGELPESISNINRISKLQLNGNR 537





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
225456161 1037 PREDICTED: probable LRR receptor-like se 0.915 0.457 0.492 1e-123
225456159 1038 PREDICTED: probable LRR receptor-like se 0.915 0.456 0.492 1e-121
359491509 1032 PREDICTED: probable LRR receptor-like se 0.938 0.470 0.468 1e-115
255545702 1008 receptor protein kinase, putative [Ricin 0.932 0.479 0.478 1e-115
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.938 0.470 0.468 1e-115
297846642 1007 hypothetical protein ARALYDRAFT_891227 [ 0.899 0.462 0.469 1e-113
359484867 1217 PREDICTED: probable leucine-rich repeat 0.901 0.383 0.445 1e-106
356553711 1035 PREDICTED: probable LRR receptor-like se 0.888 0.444 0.454 1e-103
297813345 1019 hypothetical protein ARALYDRAFT_489780 [ 0.928 0.472 0.425 1e-103
186511602 1045 Leucine-rich repeat-containing protein [ 0.928 0.460 0.427 1e-103
>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  449 bits (1156), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 321/506 (63%), Gaps = 32/506 (6%)

Query: 28  VSSEPNEEADTLLKWKASLQSRNQSRLPSW-------TKATTNVSSKISPCAWYGISCND 80
           VSS  NEE   LLKWKA+L + N S L SW       T ++T++ +++SPC WYGISCN 
Sbjct: 27  VSSYSNEETQALLKWKATLHNHNHSSLLSWTLYPNNFTNSSTHLGTEVSPCKWYGISCNH 86

Query: 81  AGRVINISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDT 140
           AG VI I+L  +GL GTL  FSFSSFP LAY+D++ + L G IPP++GLLS LK+L +  
Sbjct: 87  AGSVIRINLTESGLGGTLQAFSFSSFPNLAYVDISMNNLSGPIPPQIGLLSKLKYLDLSI 146

Query: 141 NKLDGSIPPEVGQLSSMEVFFLCSNYLN------------------------GSVPPSLG 176
           N+  G IPPE+G L+++EV  L  N LN                        GS+P SLG
Sbjct: 147 NQFSGGIPPEIGLLTNLEVLHLVQNQLNGSIPHEIGQLTSLYELALYTNQLEGSIPASLG 206

Query: 177 NLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYG 236
           NLS+++ L++Y+N  SG IP ++GN  ++  L   +N  +GPIP  FGNL +L  LYL+ 
Sbjct: 207 NLSNLASLYLYENQLSGSIPPEMGNLTNLVQLYSDTNNLTGPIPSTFGNLKHLTVLYLFN 266

Query: 237 NSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIG 296
           NSLS PI   +G  KSL  L L  N  +G IP S  +L+ L+ L L  N+L G IP EIG
Sbjct: 267 NSLSGPIPPEIGNLKSLQGLSLYGNNLSGPIPVSLCDLSGLTLLHLYANQLSGPIPQEIG 326

Query: 297 KMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNL-ILRELLLSG 355
            ++SL  L+L+ENQ  G +P S+ NLTNL+ L L  N LSG  P  +G L  L  L +  
Sbjct: 327 NLKSLVDLELSENQLNGSIPTSLGNLTNLEILFLRDNRLSGYFPQEIGKLHKLVVLEIDT 386

Query: 356 NHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALA 415
           N   G LP  ICQGG+LE FTVS+NH  G IP S++NC +L R    GN LTGN+SE + 
Sbjct: 387 NQLFGSLPEGICQGGSLERFTVSDNHLSGPIPKSLKNCRNLTRALFQGNRLTGNVSEVVG 446

Query: 416 IYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSL 475
             PNL FIDLS N F+GE+S NWG+CP+L  L ++ NNITG IP + G S+ L  LDLS 
Sbjct: 447 DCPNLEFIDLSYNRFHGELSHNWGRCPQLQRLEIAGNNITGSIPEDFGISTNLILLDLSS 506

Query: 476 NHIVGEIPKELGKLNSLTKLILRGNQ 501
           NH+VGEIPK++G L SL  LIL  NQ
Sbjct: 507 NHLVGEIPKKMGSLTSLLGLILNDNQ 532




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545702|ref|XP_002513911.1| receptor protein kinase, putative [Ricinus communis] gi|223546997|gb|EEF48494.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297846642|ref|XP_002891202.1| hypothetical protein ARALYDRAFT_891227 [Arabidopsis lyrata subsp. lyrata] gi|297337044|gb|EFH67461.1| hypothetical protein ARALYDRAFT_891227 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359484867|ref|XP_002273645.2| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553711|ref|XP_003545196.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
>gi|297813345|ref|XP_002874556.1| hypothetical protein ARALYDRAFT_489780 [Arabidopsis lyrata subsp. lyrata] gi|297320393|gb|EFH50815.1| hypothetical protein ARALYDRAFT_489780 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186511602|ref|NP_849538.2| Leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|281185491|sp|Q8VZG8.3|Y4885_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At4g08850; Flags: Precursor gi|18086327|gb|AAL57627.1| AT4g08850/T32A17_160 [Arabidopsis thaliana] gi|224589610|gb|ACN59338.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332657282|gb|AEE82682.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.752 0.348 0.488 7.8e-94
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.799 0.396 0.447 4e-90
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.891 0.369 0.343 7.2e-68
TAIR|locus:4515102753598 AT1G73066 [Arabidopsis thalian 0.893 0.774 0.341 2.2e-66
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.826 0.392 0.371 1.1e-65
TAIR|locus:2207036 977 AT1G72180 [Arabidopsis thalian 0.884 0.468 0.343 2.6e-65
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.816 0.372 0.365 3.9e-65
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.810 0.381 0.360 4.3e-65
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.893 0.474 0.352 4.5e-64
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.818 0.377 0.345 7.5e-64
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 934 (333.8 bits), Expect = 7.8e-94, P = 7.8e-94
 Identities = 191/391 (48%), Positives = 254/391 (64%)

Query:   112 LDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSV 171
             L L+ + L G+IP  +G L +L  L++  N L G IPPE+G + SM    L  N L GS+
Sbjct:   227 LALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSI 286

Query:   172 PPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKS 231
             P SLGNL +++LL ++ N  +G IP  +GN +S+ +L+LS+N+ +G IP   GNL NL  
Sbjct:   287 PSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTI 346

Query:   232 LYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSI 291
             LYLY N L+  I   LG  +S+IDLQLN N+ TG IP SFGNL +L+ L L  N L G I
Sbjct:   347 LYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVI 406

Query:   292 PDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLGNLI-LRE 350
             P E+G M S+  LDL++N+  G +P S  N T L+ L L  NHLSG+IPP + N   L  
Sbjct:   407 PQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVANSSHLTT 466

Query:   351 LLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNI 410
             L+L  N+F G+ P  +C+G  L+  ++  NH +G IP S+R+C SLIR    GN  TG+I
Sbjct:   467 LILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLRDCKSLIRARFLGNKFTGDI 526

Query:   411 SEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQA 470
              EA  IYP+L FID S N F+GEISSNW K PKL  L +S NNITG IP EI N +QL  
Sbjct:   527 FEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNNITGAIPTEIWNMTQLVE 586

Query:   471 LDLSLNHIVGEIPKELGKLNSLTKLILRGNQ 501
             LDLS N++ GE+P+ +G L +L++L L GNQ
Sbjct:   587 LDLSTNNLFGELPEAIGNLTNLSRLRLNGNQ 617


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207036 AT1G72180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-77
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-63
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-53
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-40
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-34
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-13
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 5e-07
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  262 bits (670), Expect = 1e-77
 Identities = 179/518 (34%), Positives = 267/518 (51%), Gaps = 43/518 (8%)

Query: 11  PSLVLLILFFVSSFLITVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISP 70
              ++ +LFF     +  S    EE + LL +K+S+    +  L +W       +S    
Sbjct: 9   CPYLIFMLFF---LFLNFSMLHAEELELLLSFKSSINDPLK-YLSNW-------NSSADV 57

Query: 71  CAWYGISCNDAGRVI-------NIS-----------------LRNTGLSGTLHGFSFSSF 106
           C W GI+CN++ RV+       NIS                 L N  LSG +    F++ 
Sbjct: 58  CLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTS 117

Query: 107 PRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNY 166
             L YL+L+ +   G+IP   G + +L+ L +  N L G IP ++G  SS++V  L  N 
Sbjct: 118 SSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV 175

Query: 167 LNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNL 226
           L G +P SL NL+ +  L +  N   G IP ++G  KS+  + L  N  SG IP   G L
Sbjct: 176 LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGL 235

Query: 227 SNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNE 286
           ++L  L L  N+L+ PI SSLG  K+L  L L +N+ +G IP S  +L  L +L LS N 
Sbjct: 236 TSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNS 295

Query: 287 LFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNHLSGSIPPSLG-- 344
           L G IP+ + ++++L +L L  N F G +P ++++L  L+ L L  N  SG IP +LG  
Sbjct: 296 LSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH 355

Query: 345 -NLILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNG 403
            NL +  L LS N+  G +P  +C  G L    +  N  +G IP S+  C SL RV L  
Sbjct: 356 NNLTV--LDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQD 413

Query: 404 NNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIG 463
           N+ +G +       P + F+D+S NN  G I+S     P L  L+++ N   GG+P   G
Sbjct: 414 NSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG 473

Query: 464 NSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQ 501
            S +L+ LDLS N   G +P++LG L+ L +L L  N+
Sbjct: 474 -SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENK 510


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 518
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PLN03150623 hypothetical protein; Provisional 99.57
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
PLN03150623 hypothetical protein; Provisional 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.14
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.76
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.59
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.46
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.13
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.79
PRK15386 426 type III secretion protein GogB; Provisional 97.74
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.72
KOG4341483 consensus F-box protein containing LRR [General fu 97.7
PRK15386 426 type III secretion protein GogB; Provisional 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.63
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.46
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.1
KOG4341483 consensus F-box protein containing LRR [General fu 97.06
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.45
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.16
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.1
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.96
KOG4308 478 consensus LRR-containing protein [Function unknown 93.94
KOG4308 478 consensus LRR-containing protein [Function unknown 93.19
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.08
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.01
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.65
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.6
KOG0473 326 consensus Leucine-rich repeat protein [Function un 85.16
smart0037026 LRR Leucine-rich repeats, outliers. 80.49
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 80.49
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-59  Score=523.97  Aligned_cols=477  Identities=35%  Similarity=0.586  Sum_probs=300.0

Q ss_pred             CHHHHHHHHHHHHhcCCCCCCCCCCCcCCCCCCCCCCCCCccCceeeCCCCCEEEEEcCCCCCccccCCccCCCCCCCcE
Q 037558           32 PNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGTLHGFSFSSFPRLAY  111 (518)
Q Consensus        32 ~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~w~g~~c~~~~~v~~l~l~~~~~~~~~~~~~l~~l~~L~~  111 (518)
                      .++|++||++||+.+.+ +.+.+.+|+..       .+||.|.|++|+..++|+.|+++++++.|.++. .+..+++|++
T Consensus        27 ~~~~~~~l~~~~~~~~~-~~~~~~~w~~~-------~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~-~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSIND-PLKYLSNWNSS-------ADVCLWQGITCNNSSRVVSIDLSGKNISGKISS-AIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCC-CcccCCCCCCC-------CCCCcCcceecCCCCcEEEEEecCCCccccCCh-HHhCCCCCCE
Confidence            55899999999999964 66677899765       689999999998878999999999999988876 7889999999


Q ss_pred             EeCCCCCCcccCCcccc-CCCCCCEEECCCCCCCcCCC----------------------ccCCCCCCCcEEEccCCCCC
Q 037558          112 LDLTGSGLFGTIPPEVG-LLSHLKFLFIDTNKLDGSIP----------------------PEVGQLSSMEVFFLCSNYLN  168 (518)
Q Consensus       112 L~L~~~~~~~~~~~~~~-~l~~L~~L~l~~n~~~~~~p----------------------~~l~~l~~L~~L~L~~n~~~  168 (518)
                      |+|++|.+.+.+|..+. .+++|++|++++|.+++.+|                      ..++++++|++|++++|.+.
T Consensus        98 L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~  177 (968)
T PLN00113         98 INLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLV  177 (968)
T ss_pred             EECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccc
Confidence            99999998888876654 67777777777776665444                      33444444444444444444


Q ss_pred             ccCCcCCcCCCCCCEEEccCccccccCCccccCCCCCcEEEcccCcCCCCcchhccCCCCCcEEEcccCcCCcccccccc
Q 037558          169 GSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLG  248 (518)
Q Consensus       169 ~~~p~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~  248 (518)
                      +.+|..+.++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++.+++|++|++++|.+.+..|..++
T Consensus       178 ~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~  257 (968)
T PLN00113        178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG  257 (968)
T ss_pred             ccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHh
Confidence            44444444444444444444444444444444444555555555544444444445555555555555555444455555


Q ss_pred             CCCCCCEeeCcCCCCccCCcccccCCCCCcEEEccCCcCcccCccccCCCCCccEEEccCCcccccCCccCcCCCCCCee
Q 037558          249 KFKSLIDLQLNENQFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKEL  328 (518)
Q Consensus       249 ~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L  328 (518)
                      ++++|+.|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|+.|
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L  337 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVL  337 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEE
Confidence            55555555555555554455555555555555555555555555555555555555555555555555555555555555


Q ss_pred             ecccccccccCCccccc-ccCcEEEccCccCcccCchhhcCCCCccEEecCCCcCccccChhhhcCCCCcEEEcccCccc
Q 037558          329 ALLYNHLSGSIPPSLGN-LILRELLLSGNHFAGYLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLT  407 (518)
Q Consensus       329 ~l~~n~l~~~~p~~~~~-~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~  407 (518)
                      ++++|.+.+.+|..+.. .+|+.|++++|.+.+.+|..++..++++.+++++|.+.+.+|..+..+++|+.|++++|+++
T Consensus       338 ~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~  417 (968)
T PLN00113        338 QLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS  417 (968)
T ss_pred             ECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEee
Confidence            55555555555544433 45555666555555555555555455555555555555455555555555555555555555


Q ss_pred             cccChhhhCCCCCCEEecccCccccccCccccC-----------------------CCCCCEEEccCCccccCccccccC
Q 037558          408 GNISEALAIYPNLTFIDLSRNNFYGEISSNWGK-----------------------CPKLDTLNVSMNNITGGIPREIGN  464 (518)
Q Consensus       408 ~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~-----------------------~~~L~~L~ls~n~l~~~~~~~~~~  464 (518)
                      +.+|..+..+++|+.|++++|.+.+.++..+..                       .++|+.|++++|++.+.+|..+..
T Consensus       418 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~  497 (968)
T PLN00113        418 GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGS  497 (968)
T ss_pred             eECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhh
Confidence            555555555555555555555444433332222                       345666666667776777777777


Q ss_pred             CCCCCEEeCcCCcCcccCCccccCCCCCCEEECcCCccccccCccCccCCCCC
Q 037558          465 SSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQRAVTLSFINKVCSSLE  517 (518)
Q Consensus       465 l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~ip~~l~~l~~L~  517 (518)
                      +++|+.|++++|++.+.+|..+..+++|++|++++|.+.+.+|..+.++++|+
T Consensus       498 l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  550 (968)
T PLN00113        498 LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLS  550 (968)
T ss_pred             hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCC
Confidence            88888888888888888888888888888888888888888888888777775



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-40
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-30
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-40
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-30
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-19
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-07
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-07
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-05
3b2d_A 603 Crystal Structure Of Human Rp105MD-1 Complex Length 6e-07
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-06
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 4e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 5e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 4e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-06
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 5e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 6e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 6e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 7e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-06
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-06
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-05
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 1e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-04
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 2e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 4e-04
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 5e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 7e-04
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 164 bits (414), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 175/556 (31%), Positives = 252/556 (45%), Gaps = 108/556 (19%) Query: 34 EEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCND--------AGRVI 85 E L+ +K L +N LP W SS +PC + G++C D + + + Sbjct: 12 REIHQLISFKDVLPDKN--LLPDW-------SSNKNPCTFDGVTCRDDKVTSIDLSSKPL 62 Query: 86 NIS------------------LRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFG--TIPP 125 N+ L N+ ++G++ GF S+ L LDL+ + L G T Sbjct: 63 NVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSA--SLTSLDLSRNSLSGPVTTLT 120 Query: 126 EVGLLSHLKFLFIDTNKLDGSIPPEVG---QLSSMEVFFLCSNYLNGS------VPPSLG 176 +G S LKFL + +N LD P +V +L+S+EV L +N ++G+ + G Sbjct: 121 SLGSCSGLKFLNVSSNTLD--FPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCG 178 Query: 177 NLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYG 236 L H++ I N SG + D+ ++ LD+SSN FS IP F G+ S L+ L + G Sbjct: 179 ELKHLA---ISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLDISG 232 Query: 237 NSLSSPILSSLGK----------------------FKSLIDLQLNENQFTGYIPRSF-GN 273 N LS ++ KSL L L EN+FTG IP G Sbjct: 233 NKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGA 292 Query: 274 LTSLSTLRLSKNELFGSIP-------------------------DEIGKMRSLSVLDLNE 308 +L+ L LS N +G++P D + KMR L VLDL+ Sbjct: 293 CDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF 352 Query: 309 NQFKGVLPPSISNLT-NLKELALLYNHLSGSIPPSLGNL---ILRELLLSGNHFAGYLPY 364 N+F G LP S++NL+ +L L L N+ SG I P+L L+EL L N F G +P Sbjct: 353 NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP 412 Query: 365 NICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFID 424 + L +S N+ GTIP+S+ + + L + L N L G I + L L + Sbjct: 413 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 472 Query: 425 LSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPK 484 L N+ GEI S C L+ +++S N +TG IP+ IG L L LS N G IP Sbjct: 473 LDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA 532 Query: 485 ELGKLNSLTKLILRGN 500 ELG SL L L N Sbjct: 533 ELGDCRSLIWLDLNTN 548
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-111
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-99
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-80
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-70
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-59
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-62
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-55
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-60
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-53
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-53
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-52
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-47
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-45
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-41
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-39
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-30
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-38
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-35
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-36
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-36
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-34
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-33
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-33
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-31
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-18
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-13
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  346 bits (889), Expect = e-111
 Identities = 127/421 (30%), Positives = 197/421 (46%), Gaps = 10/421 (2%)

Query: 87  ISLRNTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEV-GLLSHLKFLFIDTNKLDG 145
           + L      G +    F S   L  L L+ +   G +P +    +  LK L +  N+  G
Sbjct: 299 LDLSGNHFYGAVP-PFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 357

Query: 146 SIPPEVGQLS-SMEVFFLCSNYLNGSVPPSLGN--LSHISLLFIYDNLFSGFIPSDIGNS 202
            +P  +  LS S+    L SN  +G + P+L     + +  L++ +N F+G IP  + N 
Sbjct: 358 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 417

Query: 203 KSIFNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQ 262
             + +L LS N  SG IP   G+LS L+ L L+ N L   I   L   K+L  L L+ N 
Sbjct: 418 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 477

Query: 263 FTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNL 322
            TG IP    N T+L+ + LS N L G IP  IG++ +L++L L+ N F G +P  + + 
Sbjct: 478 LTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDC 537

Query: 323 TNLKELALLYNHLSGSIPPSLGNLILRELLLSGNHFAGYLPYNICQGGALEIFTVSEN-- 380
            +L  L L  N  +G+IP ++         ++ N  AG     I   G  +    + N  
Sbjct: 538 RSLIWLDLNTNLFNGTIPAAMFKQS---GKIAANFIAGKRYVYIKNDGMKKECHGAGNLL 594

Query: 381 HFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLTFIDLSRNNFYGEISSNWGK 440
            FQG     +   ++    ++      G+ S       ++ F+D+S N   G I    G 
Sbjct: 595 EFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGS 654

Query: 441 CPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGN 500
            P L  LN+  N+I+G IP E+G+   L  LDLS N + G IP+ +  L  LT++ L  N
Sbjct: 655 MPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN 714

Query: 501 Q 501
            
Sbjct: 715 N 715


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.22
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.18
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-64  Score=548.50  Aligned_cols=475  Identities=32%  Similarity=0.460  Sum_probs=290.3

Q ss_pred             HhhcCCCCHHHHHHHHHHHHhcCCCCCCCCCCCcCCCCCCCCCCCCCccCceeeCCCCCEEEEEcCCCCCccc---cCC-
Q 037558           25 LITVSSEPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAGRVINISLRNTGLSGT---LHG-  100 (518)
Q Consensus        25 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~w~g~~c~~~~~v~~l~l~~~~~~~~---~~~-  100 (518)
                      +++++++.++|++||++||+++.+ +. .+.+|..+       .|||.|.||+|+ .++|++++|+++++.|.   +++ 
T Consensus         3 ~~~~~~~~~~~~~all~~k~~~~~-~~-~l~~W~~~-------~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~   72 (768)
T 3rgz_A            3 QASPSQSLYREIHQLISFKDVLPD-KN-LLPDWSSN-------KNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSS   72 (768)
T ss_dssp             -----CCHHHHHHHHHHHHTTCSC-TT-SSTTCCTT-------SCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHH
T ss_pred             cCccccCCHHHHHHHHHHHhhCCC-cc-cccCCCCC-------CCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChh
Confidence            445556678899999999999984 55 88999855       689999999998 78999999999998886   332 


Q ss_pred             ---------------------ccCCCCCCCcEEeCCCCCCcccCCc--cccCCCCCCEEECCCCCCCcCCCccC-CCCCC
Q 037558          101 ---------------------FSFSSFPRLAYLDLTGSGLFGTIPP--EVGLLSHLKFLFIDTNKLDGSIPPEV-GQLSS  156 (518)
Q Consensus       101 ---------------------~~l~~l~~L~~L~L~~~~~~~~~~~--~~~~l~~L~~L~l~~n~~~~~~p~~l-~~l~~  156 (518)
                                           ..+..+++|++|+|++|.+.+.+|.  .++.+++|++|++++|.+.+.+|..+ .++++
T Consensus        73 l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~  152 (768)
T 3rgz_A           73 LLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNS  152 (768)
T ss_dssp             TTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTT
T ss_pred             HhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCC
Confidence                                 2678889999999999999888887  88999999999999998887777765 77888


Q ss_pred             CcEEEccCCCCCccCCcC---CcCCCCC----------------------CEEEccCccccccCCccccCCCCCcEEEcc
Q 037558          157 MEVFFLCSNYLNGSVPPS---LGNLSHI----------------------SLLFIYDNLFSGFIPSDIGNSKSIFNLDLS  211 (518)
Q Consensus       157 L~~L~L~~n~~~~~~p~~---l~~l~~L----------------------~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~  211 (518)
                      |++|++++|.+.+..|..   +.++++|                      ++|++++|.+.+.+|. ++++++|++|+++
T Consensus       153 L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls  231 (768)
T 3rgz_A          153 LEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDIS  231 (768)
T ss_dssp             CSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECC
T ss_pred             CCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECc
Confidence            888888888777655544   4444444                      4444444444444443 5555555555555


Q ss_pred             cCcCCCCcchhccCCCCCcEEEcccCcCCccccccccCCCCCCEeeCcCCCCccCCcccccCC-CCCcEEEccCCcCccc
Q 037558          212 SNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIPRSFGNL-TSLSTLRLSKNELFGS  290 (518)
Q Consensus       212 ~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l-~~L~~L~l~~n~l~~~  290 (518)
                      +|.+++.+|..+..+++|++|++++|.+.+..|..  .+++|++|++++|.+++.+|..+... ++|++|++++|.+++.
T Consensus       232 ~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~  309 (768)
T 3rgz_A          232 GNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGA  309 (768)
T ss_dssp             SSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEEC
T ss_pred             CCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCc
Confidence            55555555555555555555555555554433332  34444444444444444555555443 6666666666666666


Q ss_pred             CccccCCCCCccEEEccCCcccccCCcc-CcCCCCCCeeecccccccccCCccccc-c-cCcEEEccCccCcc-------
Q 037558          291 IPDEIGKMRSLSVLDLNENQFKGVLPPS-ISNLTNLKELALLYNHLSGSIPPSLGN-L-ILRELLLSGNHFAG-------  360 (518)
Q Consensus       291 ~p~~~~~l~~L~~L~l~~n~l~~~~~~~-l~~l~~L~~L~l~~n~l~~~~p~~~~~-~-~L~~L~l~~n~~~~-------  360 (518)
                      +|..++.+++|++|++++|.+.+.+|.. +..+++|++|++++|.+++.+|..+.. . .|++|++++|.+.+       
T Consensus       310 ~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~  389 (768)
T 3rgz_A          310 VPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC  389 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTT
T ss_pred             cchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhh
Confidence            6666666666666666666666555544 556666666666666666555554433 2 45555555554444       


Q ss_pred             -------------------cCchhhcCCCCccEEecCCCcCccccChhhhcCCCCcEEEcccCccccccChhhhCCCCCC
Q 037558          361 -------------------YLPYNICQGGALEIFTVSENHFQGTIPTSVRNCTSLIRVHLNGNNLTGNISEALAIYPNLT  421 (518)
Q Consensus       361 -------------------~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~  421 (518)
                                         .+|..+..+++|+.|++++|.+.+.+|..+..+++|++|++++|++++.+|..+..+++|+
T Consensus       390 ~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~  469 (768)
T 3rgz_A          390 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE  469 (768)
T ss_dssp             CSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCC
T ss_pred             hcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCce
Confidence                               4444444444444555555544444444444455555555555555544455555555555


Q ss_pred             EEecccCccccccCccccCCCCCCEEEccCCccccCccccccCCCCCCEEeCcCCcCcccCCccccCCCCCCEEECcCCc
Q 037558          422 FIDLSRNNFYGEISSNWGKCPKLDTLNVSMNNITGGIPREIGNSSQLQALDLSLNHIVGEIPKELGKLNSLTKLILRGNQ  501 (518)
Q Consensus       422 ~L~L~~n~l~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~  501 (518)
                      +|++++|++.+.+|..+..+++|++|++++|++.+.+|.++..+++|++|++++|++.+.+|..++.+++|++|++++|+
T Consensus       470 ~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~  549 (768)
T 3rgz_A          470 TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL  549 (768)
T ss_dssp             EEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSE
T ss_pred             EEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCc
Confidence            55555555554455555555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             cccccCccCcc
Q 037558          502 RAVTLSFINKV  512 (518)
Q Consensus       502 ~~~~ip~~l~~  512 (518)
                      +.|.+|..+.+
T Consensus       550 l~g~ip~~~~~  560 (768)
T 3rgz_A          550 FNGTIPAAMFK  560 (768)
T ss_dssp             EESBCCGGGGT
T ss_pred             cCCcCChHHhc
Confidence            55555554443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 518
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-24
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-11
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score =  100 bits (249), Expect = 4e-24
 Identities = 72/340 (21%), Positives = 123/340 (36%), Gaps = 39/340 (11%)

Query: 34  EEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCAWYGISCNDAG---RVINISLR 90
           ++   LL+ K  L   N + L SW       ++      W G+ C+      RV N+ L 
Sbjct: 6   QDKQALLQIKKDLG--NPTTLSSW-----LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLS 58

Query: 91  NTGLSGTLHGFSFSSFPRLAYLDLTGSGLFGTIPPEVGLLSHLKFLFIDTN-KLDGSIPP 149
              L                            IP  +  L +L FL+I     L G IPP
Sbjct: 59  GLNLPKPY-----------------------PIPSSLANLPYLNFLYIGGINNLVGPIPP 95

Query: 150 EVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHISLLFIYDNLFSGFIPSDIGNSKSIFNLD 209
            + +L+ +   ++    ++G++P  L  +  +  L    N  SG +P  I +  ++  + 
Sbjct: 96  AIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGIT 155

Query: 210 LSSNQFSGPIPLFFGNLSNLKS-LYLYGNSLSSPILSSLGKFKSLIDLQLNENQFTGYIP 268
              N+ SG IP  +G+ S L + + +  N L+  I  +                      
Sbjct: 156 FDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASV 215

Query: 269 RSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKEL 328
               +  +                 ++G  ++L+ LDL  N+  G LP  ++ L  L  L
Sbjct: 216 LFGSDKNT--QKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSL 273

Query: 329 ALLYNHLSGSIPPSLGNLI-LRELLLSGNHFAGYLPYNIC 367
            + +N+L G I P  GNL        + N      P   C
Sbjct: 274 NVSFNNLCGEI-PQGGNLQRFDVSAYANNKCLCGSPLPAC 312


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.47
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.03
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=2.6e-40  Score=318.23  Aligned_cols=291  Identities=27%  Similarity=0.487  Sum_probs=218.9

Q ss_pred             CCHHHHHHHHHHHHhcCCCCCCCCCCCcCCCCCCCCCCCCCc--cCceeeCCCC---CEEEEEcCCCCCccc--cCCccC
Q 037558           31 EPNEEADTLLKWKASLQSRNQSRLPSWTKATTNVSSKISPCA--WYGISCNDAG---RVINISLRNTGLSGT--LHGFSF  103 (518)
Q Consensus        31 ~~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~--w~g~~c~~~~---~v~~l~l~~~~~~~~--~~~~~l  103 (518)
                      |.++|++||++||+++.++  ..+.+|..+       .|||.  |.||+|+..+   ||++|+|+++++.|.  +|+ .+
T Consensus         3 c~~~e~~aLl~~k~~~~~~--~~l~sW~~~-------~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~-~l   72 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNP--TTLSSWLPT-------TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS-SL   72 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCC--GGGTTCCTT-------SCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG-GG
T ss_pred             CCHHHHHHHHHHHHHCCCC--CcCCCCCCC-------CCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCCh-HH
Confidence            7899999999999999763  368999866       69995  9999998643   799999999988874  555 78


Q ss_pred             CCCCCCcEEeCCC-CCCcccCCccccCCCCCCEEECCCCCCCcCCCccCCCCCCCcEEEccCCCCCccCCcCCcCCCCCC
Q 037558          104 SSFPRLAYLDLTG-SGLFGTIPPEVGLLSHLKFLFIDTNKLDGSIPPEVGQLSSMEVFFLCSNYLNGSVPPSLGNLSHIS  182 (518)
Q Consensus       104 ~~l~~L~~L~L~~-~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~p~~l~~l~~L~~L~L~~n~~~~~~p~~l~~l~~L~  182 (518)
                      .++++|++|+|++ |.+.|.+|+.|+++++|++|++++|++.+..+..+..+.+|+++++++|.+.+.+|..+.+++.++
T Consensus        73 ~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~  152 (313)
T d1ogqa_          73 ANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLV  152 (313)
T ss_dssp             GGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCC
T ss_pred             hcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccc
Confidence            8888888888875 677777888888888888888888888777777777788888888888877777777787888888


Q ss_pred             EEEccCccccccCCccccCCCCC-cEEEcccCcCCCCcchhccCCCCCcEEEcccCcCCccccccccCCCCCCEeeCcCC
Q 037558          183 LLFIYDNLFSGFIPSDIGNSKSI-FNLDLSSNQFSGPIPLFFGNLSNLKSLYLYGNSLSSPILSSLGKFKSLIDLQLNEN  261 (518)
Q Consensus       183 ~L~l~~n~~~~~~~~~~~~~~~L-~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n  261 (518)
                      ++++++|.+.+.+|..+..+..+ +.+++++|++++..+..+..+..+ .+++.++...+..+..+..+++++.++++++
T Consensus       153 ~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~  231 (313)
T d1ogqa_         153 GITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKN  231 (313)
T ss_dssp             EEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSS
T ss_pred             eeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccccccc
Confidence            88888887777777777776665 677777777777666666655443 5777777776666666677777777777777


Q ss_pred             CCccCCcccccCCCCCcEEEccCCcCcccCccccCCCCCccEEEccCCcccccCCccCcCCCCCCeeeccccc
Q 037558          262 QFTGYIPRSFGNLTSLSTLRLSKNELFGSIPDEIGKMRSLSVLDLNENQFKGVLPPSISNLTNLKELALLYNH  334 (518)
Q Consensus       262 ~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~  334 (518)
                      .+.+.++ .+..+++|+.|++++|+++|.+|..++.+++|++|++++|+++|.+|. ++.+++|+.+++++|+
T Consensus       232 ~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         232 SLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             EECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             ccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            7665443 466667777777777777767777777777777777777777766663 4566666666666665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure