Citrus Sinensis ID: 037597

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MSANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR
ccccccccccccccccccccccEEEccccccccccccHHHHHccccccccEEEccccccccccccccccccccccEEEccccccccccccHHccccccccEEEcccccccEEccHHHHHHHHHHHHHHHc
ccccccccccccccccccccccEEEccccccccccccHHHHHHcccccccEEEccccccccEEccHHHcccHcHHEEEcccccccHHHHHHHHccccccEEEEEccccccccccccccccHHHHHHHHHc
msanaidnlvvpkdyrglrklNTLVLGGTEVAMIDGskalqsigslpslkTLYLSYTNFTGTVINQElhnltnleelildesDLHVSQLLQSIASFTSLKYLSMQDSVLKGalhgqgklrVSEAFVILIR
msanaidnlvvpkdyrglrKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKgalhgqgklrvseafVILIR
MSANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR
*****IDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILI*
MSANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR
MSANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR
****AIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q80VQ1 524 Leucine-rich repeat-conta yes no 0.753 0.187 0.336 0.0003
Q9BTT6 524 Leucine-rich repeat-conta yes no 0.776 0.192 0.336 0.0004
>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 Back     alignment and function desciption
 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 9/107 (8%)

Query: 11  VPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHN 70
           +P     LR+L  L LG  E+  +      +SIG+L  LK L+L     +   + QE+ N
Sbjct: 166 LPDSLTQLRRLEELDLGNNEIYNLP-----ESIGALLHLKDLWLDGNQLSE--LPQEIGN 218

Query: 71  LTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQG 117
           L NL  L LD S+  + +L + I+  TSL YL +  ++L+    G G
Sbjct: 219 LKNL--LCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIG 263

Mus musculus (taxid: 10090)
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
356567128 1133 PREDICTED: LRR receptor-like serine/thre 0.761 0.087 0.372 1e-08
224150593112 predicted protein [Populus trichocarpa] 0.761 0.883 0.476 1e-08
224124410 601 predicted protein [Populus trichocarpa] 0.707 0.153 0.494 2e-08
224108411 626 predicted protein [Populus trichocarpa] 0.753 0.156 0.466 4e-08
224124626 1126 predicted protein [Populus trichocarpa] 0.761 0.087 0.409 2e-07
224113693 949 predicted protein [Populus trichocarpa] 0.761 0.104 0.418 4e-07
359482745 1026 PREDICTED: leucine-rich repeat receptor 0.907 0.115 0.352 1e-06
224134597 947 predicted protein [Populus trichocarpa] 0.853 0.117 0.375 2e-06
224145105 280 predicted protein [Populus trichocarpa] 0.592 0.275 0.45 2e-06
359482725 1144 PREDICTED: leucine-rich repeat receptor 0.823 0.093 0.368 6e-06
>gi|356567128|ref|XP_003551773.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Back     alignment and taxonomy information
 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 3/102 (2%)

Query: 4   NAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTV 63
           N I +  V +  +GL +L+ L L G    MIDGSK   S+ +  S++ L +S   F GT+
Sbjct: 222 NNISDFAVHQGSKGLGRLDALYLDGN---MIDGSKLRNSLRAFSSVRMLSMSENEFKGTI 278

Query: 64  INQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQ 105
           +  + H+L+NLE L +D S+   ++  +SI   TSLK LS++
Sbjct: 279 VAGDFHDLSNLEHLTMDYSNNLKNEFFKSIGELTSLKVLSLR 320

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224150593|ref|XP_002336982.1| predicted protein [Populus trichocarpa] gi|222837502|gb|EEE75881.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124410|ref|XP_002330016.1| predicted protein [Populus trichocarpa] gi|222871441|gb|EEF08572.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224108411|ref|XP_002333396.1| predicted protein [Populus trichocarpa] gi|222836497|gb|EEE74904.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124626|ref|XP_002330070.1| predicted protein [Populus trichocarpa] gi|222871495|gb|EEF08626.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113693|ref|XP_002332513.1| predicted protein [Populus trichocarpa] gi|222832619|gb|EEE71096.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482745|ref|XP_003632825.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145105|ref|XP_002336200.1| predicted protein [Populus trichocarpa] gi|222832534|gb|EEE71011.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482725|ref|XP_003632817.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
MGI|MGI:2442313 524 Lrrc1 "leucine rich repeat con 0.807 0.200 0.344 7.3e-07
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.853 0.115 0.313 7.1e-06
UNIPROTKB|Q9BTT6 524 LRRC1 "Leucine-rich repeat-con 0.807 0.200 0.336 1.1e-05
FB|FBgn0034540 808 Lrt "Leucine-rich tendon-speci 0.884 0.142 0.325 2.5e-05
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.838 0.107 0.290 2.6e-05
UNIPROTKB|E1BWI3204 RSU1 "Uncharacterized protein" 0.746 0.475 0.311 3.8e-05
UNIPROTKB|Q15404277 RSU1 "Ras suppressor protein 1 0.746 0.350 0.311 6.1e-05
UNIPROTKB|E1BS02277 RSU1 "Uncharacterized protein" 0.746 0.350 0.311 7.9e-05
UNIPROTKB|Q5E9C0277 RSU1 "Ras suppressor protein 1 0.746 0.350 0.311 7.9e-05
UNIPROTKB|E2R9R1277 RSU1 "Uncharacterized protein" 0.746 0.350 0.311 7.9e-05
MGI|MGI:2442313 Lrrc1 "leucine rich repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 123 (48.4 bits), Expect = 7.3e-07, P = 7.3e-07
 Identities = 40/116 (34%), Positives = 62/116 (53%)

Query:     7 DNLV--VPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVI 64
             +NL+  +P     LR+L  L LG  E+  +      +SIG+L  LK L+L     +   +
Sbjct:   160 ENLLTYLPDSLTQLRRLEELDLGNNEIYNLP-----ESIGALLHLKDLWLDGNQLSE--L 212

Query:    65 NQELHNLTNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLR 120
              QE+ NL NL  L LD S+  + +L + I+  TSL YL +  ++L+    G GKL+
Sbjct:   213 PQEIGNLKNL--LCLDVSENRLERLPEEISGLTSLTYLVISQNLLETIPEGIGKLK 266
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0016020 "membrane" evidence=IEA
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTT6 LRRC1 "Leucine-rich repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0034540 Lrt "Leucine-rich tendon-specific protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWI3 RSU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q15404 RSU1 "Ras suppressor protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS02 RSU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9C0 RSU1 "Ras suppressor protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9R1 RSU1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01310065
annotation not avaliable (987 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information 
 Score = 37.5 bits (87), Expect = 0.001
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 10  VVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELH 69
            +P D   LR L ++ L G     I G+    S+GS+ SL+ L LSY +F G+ I + L 
Sbjct: 433 FIPNDISKLRHLQSINLSGNS---IRGNIPP-SLGSITSLEVLDLSYNSFNGS-IPESLG 487

Query: 70  NLTNLEELILDESDL 84
            LT+L  L L+ + L
Sbjct: 488 QLTSLRILNLNGNSL 502

Length = 623

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.63
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
PLN03150623 hypothetical protein; Provisional 99.35
PLN03150623 hypothetical protein; Provisional 99.34
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.3
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.29
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.18
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.11
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.01
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.98
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.83
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.82
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.75
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.53
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.53
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.53
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.5
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.45
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.41
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.37
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.11
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.07
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.03
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.89
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.66
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.47
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.37
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.02
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.97
PRK15386 426 type III secretion protein GogB; Provisional 96.77
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.71
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.59
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.55
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.41
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.38
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.33
PRK15386 426 type III secretion protein GogB; Provisional 96.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.03
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.01
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.24
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.41
smart0037026 LRR Leucine-rich repeats, outliers. 94.41
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.99
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.43
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.15
KOG1947 482 consensus Leucine rich repeat proteins, some prote 90.05
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.99
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.9
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.02
KOG1947 482 consensus Leucine rich repeat proteins, some prote 82.91
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.49
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.63  E-value=1.2e-15  Score=121.26  Aligned_cols=120  Identities=24%  Similarity=0.341  Sum_probs=73.9

Q ss_pred             CCCCCCCccCccccCCCCCCcEEEcCCcccccccCCchhhhcCCCCCCCEEeccCCCCCcccchHhhcCCCCCcEEEccC
Q 037597            2 SANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILDE   81 (130)
Q Consensus         2 ~~n~l~~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~l~~L~~L~l~~   81 (130)
                      ++|.+++.. |..++.+++|++|++++|.+    .+..|..++.+++|++|++++|.+++..|. .+..+.+|++|++++
T Consensus       148 s~n~~~~~~-p~~~~~l~~L~~L~L~~n~l----~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L~~  221 (968)
T PLN00113        148 SNNMLSGEI-PNDIGSFSSLKVLDLGGNVL----VGKIPNSLTNLTSLEFLTLASNQLVGQIPR-ELGQMKSLKWIYLGY  221 (968)
T ss_pred             cCCcccccC-ChHHhcCCCCCEEECccCcc----cccCChhhhhCcCCCeeeccCCCCcCcCCh-HHcCcCCccEEECcC
Confidence            445555444 55666666666666666666    455666666666666666666666655555 566666666666666


Q ss_pred             CCCCCchhHHhhhcCCCCCEEeccCcccccccCcccccCcccceeeee
Q 037597           82 SDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILI  129 (130)
Q Consensus        82 n~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~l~~l~~l~~  129 (130)
                      |.+.+ ..|..++.+++|++|++++|.+.+.+|. .+.++++|++|.+
T Consensus       222 n~l~~-~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L  267 (968)
T PLN00113        222 NNLSG-EIPYEIGGLTSLNHLDLVYNNLTGPIPS-SLGNLKNLQYLFL  267 (968)
T ss_pred             CccCC-cCChhHhcCCCCCEEECcCceeccccCh-hHhCCCCCCEEEC
Confidence            66665 5566666666666666666666656665 5566666655543

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-05
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
 Score = 52.7 bits (127), Expect = 3e-09
 Identities = 23/100 (23%), Positives = 48/100 (48%), Gaps = 5/100 (5%)

Query: 12  PKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNL 71
              Y+ L  L+TL+L G  +  +     L +   L SL+ L    TN    + N  + +L
Sbjct: 69  DGAYQSLSHLSTLILTGNPIQSLA----LGAFSGLSSLQKLVAVETNLAS-LENFPIGHL 123

Query: 72  TNLEELILDESDLHVSQLLQSIASFTSLKYLSMQDSVLKG 111
             L+EL +  + +   +L +  ++ T+L++L +  + ++ 
Sbjct: 124 KTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQS 163
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.72
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.68
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.68
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.67
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.67
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.66
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.66
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.63
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.63
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.61
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.6
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.6
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.6
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.6
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.6
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.6
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.58
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.57
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.57
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.57
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.56
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.56
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.56
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.56
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.56
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.55
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.54
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.54
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.53
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.53
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.53
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.52
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.52
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.5
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.5
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 99.5
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.49
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.49
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.48
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.48
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.47
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.44
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.44
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.43
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.42
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.42
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.42
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.42
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.34
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.33
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.32
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.29
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.29
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.26
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.21
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.18
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.03
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.01
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.99
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.94
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.87
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.85
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.59
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.58
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.5
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.47
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.17
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.98
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.43
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.38
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.36
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.24
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.13
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.91
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.74
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
Probab=99.76  E-value=5.5e-18  Score=113.25  Aligned_cols=123  Identities=12%  Similarity=0.190  Sum_probs=103.2

Q ss_pred             CCCCCCCCccCccccCCCCCCcEEEcCCcccccccCCchhhhcCCCCCCCEEeccCCCCCcccchHhhcCCCCCcEEEcc
Q 037597            1 MSANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKALQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILD   80 (130)
Q Consensus         1 l~~n~l~~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~l~~L~~L~l~   80 (130)
                      +++|.+++...+..+..+++|++|++++|.+    +...+..+..+++|+.|++++|.+++..+. .+..+++|++|+++
T Consensus        39 L~~N~l~~~~~~~~~~~l~~L~~L~L~~N~i----~~i~~~~~~~l~~L~~L~Ls~N~l~~~~~~-~~~~l~~L~~L~Ls  113 (220)
T 2v70_A           39 LNNNEFTVLEATGIFKKLPQLRKINFSNNKI----TDIEEGAFEGASGVNEILLTSNRLENVQHK-MFKGLESLKTLMLR  113 (220)
T ss_dssp             CCSSCCCEECCCCCGGGCTTCCEEECCSSCC----CEECTTTTTTCTTCCEEECCSSCCCCCCGG-GGTTCSSCCEEECT
T ss_pred             cCCCcCCccCchhhhccCCCCCEEECCCCcC----CEECHHHhCCCCCCCEEECCCCccCccCHh-HhcCCcCCCEEECC
Confidence            4678887754234578999999999999999    444555788999999999999999855555 78899999999999


Q ss_pred             CCCCCCchhHHhhhcCCCCCEEeccCcccccccCcccccCcccceeeeeC
Q 037597           81 ESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR  130 (130)
Q Consensus        81 ~n~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~l~~l~~l~~~  130 (130)
                      +|.+.. ..|..+..+++|+.|++++|.+++..|. .|..+++|+++.+.
T Consensus       114 ~N~l~~-~~~~~~~~l~~L~~L~L~~N~l~~~~~~-~~~~l~~L~~L~L~  161 (220)
T 2v70_A          114 SNRITC-VGNDSFIGLSSVRLLSLYDNQITTVAPG-AFDTLHSLSTLNLL  161 (220)
T ss_dssp             TSCCCC-BCTTSSTTCTTCSEEECTTSCCCCBCTT-TTTTCTTCCEEECC
T ss_pred             CCcCCe-ECHhHcCCCccCCEEECCCCcCCEECHH-HhcCCCCCCEEEec
Confidence            999998 5577889999999999999999966677 88999999988763
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 44.4 bits (103), Expect = 8e-07
 Identities = 9/40 (22%), Positives = 16/40 (40%), Gaps = 2/40 (5%)

Query: 41  QSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILD 80
           Q +  L  L +L +S+ N  G +   +  NL   +     
Sbjct: 262 QGLTQLKFLHSLNVSFNNLCGEI--PQGGNLQRFDVSAYA 299
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.61
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.5
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.48
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.41
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.19
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.14
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.12
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.96
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.74
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.73
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.67
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.65
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.5
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.49
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.16
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.67  E-value=1.9e-16  Score=102.23  Aligned_cols=118  Identities=19%  Similarity=0.294  Sum_probs=91.7

Q ss_pred             CCCCCCCccCccccCCCCCCcEEEcCCcccccccCCch-hhhcCCCCCCCEEeccCCCCCcccchHhhcCCCCCcEEEcc
Q 037597            2 SANAIDNLVVPKDYRGLRKLNTLVLGGTEVAMIDGSKA-LQSIGSLPSLKTLYLSYTNFTGTVINQELHNLTNLEELILD   80 (130)
Q Consensus         2 ~~n~l~~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~-~~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~l~~L~~L~l~   80 (130)
                      ++|.++.  +|+.+.  +++++|++++|.+    +..+ +..+..+++|+.|++++|.++...+. .+..+++|+.|+++
T Consensus        16 s~~~L~~--iP~~lp--~~l~~L~Ls~N~i----~~~~~~~~f~~l~~L~~L~L~~N~i~~~~~~-~~~~~~~L~~L~Ls   86 (192)
T d1w8aa_          16 TGRGLKE--IPRDIP--LHTTELLLNDNEL----GRISSDGLFGRLPHLVKLELKRNQLTGIEPN-AFEGASHIQELQLG   86 (192)
T ss_dssp             TTSCCSS--CCSCCC--TTCSEEECCSCCC----CSBCCSCSGGGCTTCCEEECCSSCCCCBCTT-TTTTCTTCCEEECC
T ss_pred             eCCCcCc--cCCCCC--CCCCEEEeCCCCC----cccccccccCCCceEeeeecccccccccccc-ccccccccceeeec
Confidence            4566664  476553  6889999999998    3433 44567889999999999998855555 78888999999999


Q ss_pred             CCCCCCchhHHhhhcCCCCCEEeccCcccccccCcccccCcccceeeeeC
Q 037597           81 ESDLHVSQLLQSIASFTSLKYLSMQDSVLKGALHGQGKLRVSEAFVILIR  130 (130)
Q Consensus        81 ~n~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~l~~l~~l~~~  130 (130)
                      +|++.. ..+..|.++++|++|++++|+++ .+|...|..+++|+++.+.
T Consensus        87 ~N~l~~-l~~~~F~~l~~L~~L~L~~N~l~-~i~~~~f~~l~~L~~l~L~  134 (192)
T d1w8aa_          87 ENKIKE-ISNKMFLGLHQLKTLNLYDNQIS-CVMPGSFEHLNSLTSLNLA  134 (192)
T ss_dssp             SCCCCE-ECSSSSTTCTTCCEEECCSSCCC-EECTTSSTTCTTCCEEECT
T ss_pred             cccccc-cCHHHHhCCCcccccccCCcccc-ccCHHHhcCCccccccccc
Confidence            999988 44557888999999999999999 4444378888888888763
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure