Citrus Sinensis ID: 037604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540
GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRLGYERAISE
ccccEEEEEEEccccccccccHHHHcccccccEEEEEccccccccccccHHHHHHcccccEEccccccccccccEEEEcccccccccccccccccccEEEccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccEEccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccEEccccccccccccEEEccccccccccccccccccEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccEEEEEEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHHHHHHHcccccccHHHHccHHHccEEEccccccccccHHccccHcEEEEccccccccccccccccccHHHcccccccEEEEccccccccccHHHcccccEEEEcccccccccccHHcccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEEcccccccccccHcccccEEEcccccccccccHHHccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEEcccccccccccHHHccccccEEEcccccccccccccccccHHHHHHHHHHcccccccccccc
GTDAIEGIFLDLskikginldpgtftnmsnMRLLKFYVPKFYGIERFLSMSIEEQLSYSkvqlpngldylpeklrylhwdtyplrilpsnfkpknlvELNLRFSKVEQlwegekacvpssiqnFKYLSMLNfegckslrsfpsnlhfvcpvtiDFSYCVnliefpqisgkiTRLYLgcsaieevpssiecltdlevLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCinldrtaitelpssfenltglkglsvsdcskldklpdnignlesLHHMSAFGSaisqlpssvadsnvlgildfsrckglesfprsllGLSSLVALHIRNFAVMEIPQEIARLSSLIdlhiggnnfqsLPASIKQLSQLsslelndckmlqslpelplclkYLHLrdckmlqslpalplclesldlrdcnmlrslpelplclqeLDATNCNRLQSLAEIPSCLQELDASVLETLSKLspdfrvwlpafllqpiyfgFINSLKLNGKANKKILADSQLRIRHMAIASLRLGYERAISE
GTDAIEGIFLdlskikginldpgtftnmSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRLGYERAISE
GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRLGYERAISE
****IEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRLGY******
GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRLGY******
GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRLGYERAISE
*TDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRL********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAFLLQPIYFGFINSLKLNGKANKKILADSQLRIRHMAIASLRLGYERAISE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query540 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.655 0.309 0.329 8e-35
O23530 1301 Protein SUPPRESSOR OF npr no no 0.783 0.325 0.292 3e-32
Q9SZ67 1895 Probable WRKY transcripti no no 0.546 0.155 0.332 1e-31
Q9FH83 1288 Probable WRKY transcripti no no 0.627 0.263 0.287 4e-30
O825001095 Putative disease resistan no no 0.490 0.242 0.305 6e-27
Q9FL92 1372 Probable WRKY transcripti no no 0.501 0.197 0.283 2e-24
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.516 0.172 0.257 2e-18
Q1L8Y7561 Leucine-rich repeat prote yes no 0.698 0.672 0.271 9e-17
Q5RAV5582 Leucine-rich repeat prote yes no 0.698 0.647 0.274 4e-16
Q9UQ13582 Leucine-rich repeat prote yes no 0.698 0.647 0.274 4e-16
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  149 bits (375), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 140/425 (32%), Positives = 189/425 (44%), Gaps = 71/425 (16%)

Query: 26  TNMSNMRLLKFYVPKFYGIERFLSMSIEEQ-----LSYSKVQLPNGLDYLPEKLRYLHWD 80
            N   M +   +V  +    RF + +++        +  +      +DYLP  LR     
Sbjct: 523 NNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCT 582

Query: 81  TYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRS 140
            YP    PS F+ K LV L LR + +  LW  E   +P                  SLR 
Sbjct: 583 NYPWESFPSTFELKMLVHLQLRHNSLRHLWT-ETKHLP------------------SLRR 623

Query: 141 FPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLG---CSAIEEVPSSIECLTDLEVL 197
                       ID S+   L   P  +G     Y+    CS +EEV  S+ C + +  L
Sbjct: 624 ------------IDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGL 671

Query: 198 DLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPS 257
            L  CK LKR       + SL  L L  C +LE+ PEI  +M+    I++  + I ELPS
Sbjct: 672 YLNDCKSLKRFPC--VNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPS 729

Query: 258 S---------------FENLTGLK----------GLSVSDCSKLDKLPDNIGNLESLHHM 292
           S                +NL  L            LSVS CSKL+ LP+ IG+L++L   
Sbjct: 730 SIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVF 789

Query: 293 SAFGSAISQLPSSVADSNVLGILDFSRCK-GLE-SFPRSLLGLSSLVALHIR--NFAVME 348
            A  + I + PSS+   N L IL F   K G+   FP    GL SL  L++   N     
Sbjct: 790 DASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGG 849

Query: 349 IPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHL 408
           +P+EI  LSSL  L +  NNF+ LP+SI QL  L SL+L DC+ L  LPELP  L  LH+
Sbjct: 850 LPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHV 909

Query: 409 RDCKM 413
            DC M
Sbjct: 910 -DCHM 913
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 Back     alignment and function description
>sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query540
255563202 1158 leucine-rich repeat containing protein, 0.677 0.316 0.4 1e-73
255537137 1034 leucine-rich repeat containing protein, 0.685 0.357 0.403 1e-63
359486075 1291 PREDICTED: TMV resistance protein N-like 0.772 0.323 0.345 8e-63
255544956 1403 leucine-rich repeat containing protein, 0.962 0.370 0.325 2e-62
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.772 0.294 0.343 5e-62
359486071 1261 PREDICTED: TMV resistance protein N-like 0.796 0.340 0.350 4e-60
147802252 1441 hypothetical protein VITISV_020931 [Viti 0.818 0.306 0.320 2e-59
451798990 1335 TMV resistance protein N-like protein 7 0.772 0.312 0.346 3e-59
451798988 1219 TMV resistance protein N-like protein 6 0.772 0.342 0.342 5e-58
359493561 1080 PREDICTED: TMV resistance protein N-like 0.838 0.419 0.326 1e-56
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  283 bits (725), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 170/425 (40%), Positives = 240/425 (56%), Gaps = 59/425 (13%)

Query: 1   GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSK 60
           GT+AI GI L +S+ + + L+   FT +SN++ L   +    G         EE+    K
Sbjct: 565 GTEAIVGILLGMSEARKLELNRNAFTRISNLKFLILRMSNNCG-------GFEEE---CK 614

Query: 61  VQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSS 120
           VQ P GL+ LP++LRYL+W  YPL+ LP+NF P NL+ELN  +S++E LWEG+K  VPSS
Sbjct: 615 VQFPEGLESLPQQLRYLYWHGYPLKFLPANFHPTNLIELNFPYSRLEGLWEGDK--VPSS 672

Query: 121 IQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLGCSA 180
           I     L+ ++    K++RSFP+ +      T+D S C NL  FP++S  I  LYL  +A
Sbjct: 673 IGQLTKLTFMSLRCSKNIRSFPTTIDLQSLETLDLSGCSNLKIFPEVSRNIRYLYLNETA 732

Query: 181 IEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKME 240
           I+EVP SIE L+ L VL++  C  L+ I +   KL+SL  L L+GC  LE FPEILE   
Sbjct: 733 IQEVPLSIEHLSKLVVLNMKNCNELECIPSTIFKLKSLGVLILSGCKKLESFPEILETTN 792

Query: 241 HLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAIS 300
           HL+ ++LD TA+  LP +F NL  L  L+ SDCSKL KLP N+ NL+SL  + A G  +S
Sbjct: 793 HLQHLSLDETAMVNLPDTFCNLKALNMLNFSDCSKLGKLPKNMKNLKSLAELRAGGCNLS 852

Query: 301 QLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARLSSLI 360
            LP+                                               ++  LSS++
Sbjct: 853 TLPA-----------------------------------------------DLKYLSSIV 865

Query: 361 DLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLKYLHLRDCKMLQSLPAL 420
           +L++ G+NF ++PA I QLS+L  + +  CK LQSLPELP  ++YL+ RDC+ L S+  L
Sbjct: 866 ELNLSGSNFDTMPAGINQLSKLRWINVTGCKRLQSLPELPPRIRYLNARDCRSLVSISGL 925

Query: 421 PLCLE 425
               E
Sbjct: 926 KQLFE 930

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537137|ref|XP_002509635.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223549534|gb|EEF51022.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147802252|emb|CAN68265.1| hypothetical protein VITISV_020931 [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359493561|ref|XP_002268895.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query540
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.724 0.320 0.325 1.5e-45
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.9 0.409 0.305 2.9e-45
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.885 0.241 0.301 3.1e-44
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.740 0.330 0.313 1.1e-39
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.914 0.406 0.292 3.5e-38
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.677 0.282 0.321 1.7e-37
TAIR|locus:2115870 1234 AT4G08450 [Arabidopsis thalian 0.703 0.307 0.307 6.9e-37
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.692 0.326 0.317 7e-36
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.579 0.255 0.308 8e-34
TAIR|locus:21532071165 AT5G45060 [Arabidopsis thalian 0.6 0.278 0.323 1e-33
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 490 (177.5 bits), Expect = 1.5e-45, P = 1.5e-45
 Identities = 143/440 (32%), Positives = 224/440 (50%)

Query:     1 GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSK 60
             GTD I GIFLD SK++ + L    F  M N++ LK Y       +   S   E +    K
Sbjct:   537 GTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIY-------DSHCSRGCEAEF---K 586

Query:    61 VQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSS 120
             + L  GL +LP +L YLHW  YPL+ +P +F PKNLV+L L  S++E++W+ EK      
Sbjct:   587 LHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEK-----D 641

Query:   121 IQNFKYLSM---LNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRL-YL 176
             +   K++ +   +N   C  L    +N H +    ++   C +L + P     + +L YL
Sbjct:   642 VGMLKWVDLSHSINLRQCLGL----ANAHNL--ERLNLEGCTSLKKLPSTINCLEKLIYL 695

Query:   177 G---CSAIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVD-LCLNGCLNLERF 232
                 C+++  +P  I+  + L+ L L  C  LK+    F  +   V+ L L+G + ++  
Sbjct:   696 NLRDCTSLRSLPKGIKTQS-LQTLILSGCSSLKK----FPLISENVEVLLLDGTV-IKSL 749

Query:   233 PEILEKMEHLKCINLDRTA-ITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHH 291
             PE ++    L  +NL     +  L S    L  L+ L +S CS+L+  P+   ++ESL  
Sbjct:   750 PESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEI 809

Query:   292 MSAFGSAISQLPSSVADSNVLGILDFSRCKGLES-------FPRSLLGLSSLVALHIRNF 344
             +    ++I+++P  +  SN   I  FS C G  S       F    LG S L  L++   
Sbjct:   810 LLMDDTSITEMPKMMHLSN---IKTFSLC-GTSSHVSVSMFFMPPTLGCSRLTDLYLSRC 865

Query:   345 AVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPELPLCLK 404
             ++ ++P  I  LSSL  L + GNN ++LP S  QL+ L   +L  CKML+SLP LP  L+
Sbjct:   866 SLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQ 925

Query:   405 YLHLRDCKMLQSL--PALPL 422
             YL   +C+ L++L  P  PL
Sbjct:   926 YLDAHECESLETLANPLTPL 945
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00007023001
SubName- Full=Chromosome chr13 scaffold_181, whole genome shotgun sequence; (1237 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-45
PLN032101153 PLN03210, PLN03210, Resistant to P 4e-19
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-09
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-08
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-08
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 2e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-06
pfam0772520 pfam07725, LRR_3, Leucine Rich Repeat 3e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  172 bits (437), Expect = 1e-45
 Identities = 137/426 (32%), Positives = 200/426 (46%), Gaps = 82/426 (19%)

Query: 1   GTDAIEGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSK 60
           GT  + GI LD+ +I  +++    F  M N+  LKFY  K+            +Q    +
Sbjct: 530 GTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKW------------DQKKEVR 577

Query: 61  VQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSS 120
             LP G DYLP KLR L WD YPLR +PSNF+P+NLV+L ++ SK+E+LW+G        
Sbjct: 578 WHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDG-------- 629

Query: 121 IQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKITRLYLG-CS 179
           + +   L  ++  G K+L+  P           D S   NL            L L  CS
Sbjct: 630 VHSLTGLRNIDLRGSKNLKEIP-----------DLSMATNL----------ETLKLSDCS 668

Query: 180 AIEEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKM 239
           ++ E+PSSI+ L  LE LD+  C+ L+ + T    L+SL  L L+GC  L+ FP+I   +
Sbjct: 669 SLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNI 727

Query: 240 EHLKCINLDRTAITELPSS--FENLT----------------------------GLKGLS 269
             L   +LD TAI E PS+   ENL                              L  L 
Sbjct: 728 SWL---DLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLF 784

Query: 270 VSDCSKLDKLPDNIGNLESLHHMSAFGSA-ISQLPSSVADSNVLGILDFSRCKGLESFPR 328
           +SD   L +LP +I NL  L H+       +  LP+ + +   L  LD S C  L +FP 
Sbjct: 785 LSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPD 843

Query: 329 SLLGLSSLVALHIRNFAVMEIPQEIARLSSLIDLHIGG-NNFQSLPASIKQLSQLSSLEL 387
               +S L    +    + E+P  I + S+L  L + G NN Q +  +I +L  L +++ 
Sbjct: 844 ISTNISDLN---LSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDF 900

Query: 388 NDCKML 393
           +DC  L
Sbjct: 901 SDCGAL 906

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|191828 pfam07725, LRR_3, Leucine Rich Repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 540
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
KOG4237498 consensus Extracellular matrix protein slit, conta 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.37
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
PRK15386 426 type III secretion protein GogB; Provisional 98.76
PRK15386 426 type III secretion protein GogB; Provisional 98.59
PLN03150623 hypothetical protein; Provisional 98.57
PLN03150623 hypothetical protein; Provisional 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.51
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.41
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
KOG4341483 consensus F-box protein containing LRR [General fu 98.32
KOG4341483 consensus F-box protein containing LRR [General fu 98.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.79
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.54
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.53
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.83
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.67
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.47
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.65
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.03
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.01
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.0
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.2
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.69
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.63
KOG4308478 consensus LRR-containing protein [Function unknown 93.08
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.5
KOG4308478 consensus LRR-containing protein [Function unknown 89.33
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.77
smart0037026 LRR Leucine-rich repeats, outliers. 87.77
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.54
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.88
smart0037026 LRR Leucine-rich repeats, outliers. 84.43
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.43
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 84.18
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.78
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.9e-43  Score=394.18  Aligned_cols=469  Identities=20%  Similarity=0.248  Sum_probs=255.0

Q ss_pred             EEEEeecCcccccccCchhhhccccCceeeeeccccccchhhhccchhhhhcccccccCCCCC-ccccCcEEEeecCCCC
Q 037604            6 EGIFLDLSKIKGINLDPGTFTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLD-YLPEKLRYLHWDTYPL   84 (540)
Q Consensus         6 ~~i~L~~~~~~~~~~~~~~f~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~~~L~~L~l~~~~l   84 (540)
                      +...||++++.+....+.+|..+++|++|++++|+++                  +.+|..+. .+ .+|++|++++|.+
T Consensus        70 ~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~------------------~~ip~~~~~~l-~~L~~L~Ls~n~l  130 (968)
T PLN00113         70 RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLS------------------GPIPDDIFTTS-SSLRYLNLSNNNF  130 (968)
T ss_pred             cEEEEEecCCCccccCChHHhCCCCCCEEECCCCccC------------------CcCChHHhccC-CCCCEEECcCCcc
Confidence            4456667777666677889999999999999999986                  34454443 33 3556666655555


Q ss_pred             CCCCCCCCCCCceEeecCCcchhhhhccccCcCCCcccCCCCCCEEecCCCCCCcccCCCC-ccCCCcEEEccCCcCccc
Q 037604           85 RILPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNL-HFVCPVTIDFSYCVNLIE  163 (540)
Q Consensus        85 ~~l~~~~~~~~L~~L~Ls~n~i~~l~~g~~~~lp~~~~~l~~L~~L~L~~~~~~~~~~~~~-~l~~L~~L~L~~~~~~~~  163 (540)
                      ....+...+++|++|++++|.+...       +|..++++++|++|++++|.+.+.+|..+ .+++|++|++++|.+.+.
T Consensus       131 ~~~~p~~~l~~L~~L~Ls~n~~~~~-------~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~  203 (968)
T PLN00113        131 TGSIPRGSIPNLETLDLSNNMLSGE-------IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQ  203 (968)
T ss_pred             ccccCccccCCCCEEECcCCccccc-------CChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCc
Confidence            3222222345555555555555422       45555555555555555555555555555 555555555555555444


Q ss_pred             cCCCC---CCeeEEEcccCCce-eccccccCCCCCCEEEcccCccccccchhcCCCCCCcEEeccCCcCCCcCchhhhCC
Q 037604          164 FPQIS---GKITRLYLGCSAIE-EVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKM  239 (540)
Q Consensus       164 ~~~~~---~~l~~L~L~~~~l~-~l~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l  239 (540)
                      +|..+   .+|+.|+++.|.+. .+|..++.+++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+..+
T Consensus       204 ~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  283 (968)
T PLN00113        204 IPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSL  283 (968)
T ss_pred             CChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhc
Confidence            44322   23355555555544 445555555555555555555555555555555555555555555555555555555


Q ss_pred             CCCCEEEcCCCCCc-ccCcccCCCCCCCeEccCCCcCCCcCCCCCCCCCCCcEEEccCCCCCC-CCccccCCCCccEEEc
Q 037604          240 EHLKCINLDRTAIT-ELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQ-LPSSVADSNVLGILDF  317 (540)
Q Consensus       240 ~~L~~L~l~~~~l~-~l~~~~~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~l~~-l~~~~~~l~~L~~L~l  317 (540)
                      ++|++|++++|.+. .+|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+ +|..++.+++|+.|++
T Consensus       284 ~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~L  363 (968)
T PLN00113        284 QKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDL  363 (968)
T ss_pred             cCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEEC
Confidence            55555555555544 344444555555555555555554445445555555555555554442 3444444445555555


Q ss_pred             cCC------------------------CCCCcccccccCCCCCcEEeccCCCCCC-CChhhcCCCCCcEEEecCCCCc-c
Q 037604          318 SRC------------------------KGLESFPRSLLGLSSLVALHIRNFAVME-IPQEIARLSSLIDLHIGGNNFQ-S  371 (540)
Q Consensus       318 ~~~------------------------~~~~~~~~~l~~~~~L~~L~l~~~~~~~-~~~~~~~l~~L~~L~l~~~~l~-~  371 (540)
                      ++|                        .+.+.+|..+..+++|+.|++++|.+.+ +|..+..+++|+.|++++|.++ .
T Consensus       364 s~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~  443 (968)
T PLN00113        364 STNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGR  443 (968)
T ss_pred             CCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCc
Confidence            544                        4444444445555555555555555554 4555555555666666655554 3


Q ss_pred             cchhccCCCCCCEEEecCCCCCCcCCCCC--CCccEEEecCCCCCCcCCCCC---CCccEEeecCCCCCCCCCCc---cc
Q 037604          372 LPASIKQLSQLSSLELNDCKMLQSLPELP--LCLKYLHLRDCKMLQSLPALP---LCLESLDLRDCNMLRSLPEL---PL  443 (540)
Q Consensus       372 lp~~l~~l~~L~~L~l~~~~~~~~~~~~~--~~L~~L~l~~~~~l~~~~~~~---~~L~~L~l~~~~~l~~~~~~---~~  443 (540)
                      +|..+..+++|+.|++++|.+.+.+|..+  ++|+.|++++|...+.+|..+   .+|+.|++++|...+.+|..   ..
T Consensus       444 ~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~  523 (968)
T PLN00113        444 INSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCK  523 (968)
T ss_pred             cChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCcc
Confidence            34444555666666666666555555432  566777777776666665433   34777777777776666643   34


Q ss_pred             cccccccccccccccCCCCCccccccchhhhhhhccCCCccccccccc---ccCCeEeeeccccc
Q 037604          444 CLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAF---LLQPIYFGFINSLK  505 (540)
Q Consensus       444 ~L~~L~i~~c~~l~~~~~~~~~l~~L~~~~~~~l~~l~~~~~~~lp~~---~~~l~~l~~~~c~~  505 (540)
                      +|++|++++|.--..++.....+++|+.+++..     +.+.+.+|..   +..+..+++++|.-
T Consensus       524 ~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~-----N~l~~~~p~~l~~l~~L~~l~ls~N~l  583 (968)
T PLN00113        524 KLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQ-----NQLSGEIPKNLGNVESLVQVNISHNHL  583 (968)
T ss_pred             CCCEEECCCCcccccCChhHhCcccCCEEECCC-----CcccccCChhHhcCcccCEEeccCCcc
Confidence            566666666543322222111222232222221     2233344443   44567778887764

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 4e-12
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 1e-09
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 1e-09
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 9e-08
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 7e-07
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-06
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 5e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 102/220 (46%), Gaps = 23/220 (10%)
Query: 229 LERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLES 288
           L +FP+   ++ HL+   +D   + ELP + +   GL+ L+++  + L  LP +I +L  
Sbjct: 93  LPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTLAR-NPLRALPASIASLNR 151
Query: 289 LHHMSAFG-SAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVM 347
           L  +S      +++LP  +A ++  G                  GL +L +L +    + 
Sbjct: 152 LRELSIRACPELTELPEPLASTDASG---------------EHQGLVNLQSLRLEWTGIR 196
Query: 348 EIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLPEL---PLCLK 404
            +P  IA L +L  L I  +   +L  +I  L +L  L+L  C  L++ P +      LK
Sbjct: 197 SLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLK 256
Query: 405 YLHLRDCKMLQSLP---ALPLCLESLDLRDCNMLRSLPEL 441
            L L+DC  L +LP        LE LDLR C  L  LP L
Sbjct: 257 RLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSL 296
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query540
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-46
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-30
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-29
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  163 bits (415), Expect = 3e-46
 Identities = 70/341 (20%), Positives = 125/341 (36%), Gaps = 37/341 (10%)

Query: 120 SIQNFKYLSMLNFEGCKSLRSFPSNLH-FVCPVTIDFSYCVNLIEFPQISGKITRLYLGC 178
              +      L F+G  +LR +   L  +      D +   +       +          
Sbjct: 7   HHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSN-NPQIETRTG 65

Query: 179 SAIEEVPSSIECLTD--LEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEIL 236
            A++     +E  T      L+L     L +   +  +L  L  + ++    L   P+ +
Sbjct: 66  RALKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAA-GLMELPDTM 123

Query: 237 EKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFG 296
           ++   L+ + L R  +  LP+S  +L  L+ LS+  C +L +LP+ + + ++        
Sbjct: 124 QQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDAS------- 176

Query: 297 SAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHIRNFAVMEIPQEIARL 356
                L +       L  L       + S P S+  L +L +L IRN  +  +   I  L
Sbjct: 177 GEHQGLVN-------LQSLRLEWTG-IRSLPASIANLQNLKSLKIRNSPLSALGPAIHHL 228

Query: 357 SSLIDLHIGGNN-FQSLPASIKQLSQLSSLELNDCKMLQSLPE----LPLCLKYLHLRDC 411
             L +L + G    ++ P      + L  L L DC  L +LP     L   L+ L LR C
Sbjct: 229 PKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLT-QLEKLDLRGC 287

Query: 412 KMLQSLPALPLCLESL---DLRDC-------NMLRSLPELP 442
             L  LP+L   L +     +          +   + P  P
Sbjct: 288 VNLSRLPSLIAQLPANCIILVPPHLQAQLDQHRPVARPAEP 328
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query540
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.53
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.35
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.27
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.15
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.94
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.91
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.85
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.84
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.81
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.67
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.48
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.59
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.52
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.24
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.62
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=9.1e-48  Score=418.75  Aligned_cols=505  Identities=19%  Similarity=0.209  Sum_probs=310.3

Q ss_pred             EeecCcccccccCch--hhhccccCceeeeeccccccchhh---hccchhhhhcc-------------------------
Q 037604            9 FLDLSKIKGINLDPG--TFTNMSNMRLLKFYVPKFYGIERF---LSMSIEEQLSY-------------------------   58 (540)
Q Consensus         9 ~L~~~~~~~~~~~~~--~f~~l~~L~~L~l~~n~l~~~~~~---~~~~~~~~~~~-------------------------   58 (540)
                      +||+++|......+.  +|.++++|++|++++|.+.+....   ..+..++.++.                         
T Consensus       104 ~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L  183 (768)
T 3rgz_A          104 SLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHL  183 (768)
T ss_dssp             EEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEE
T ss_pred             EEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEE
Confidence            355556554443344  566666666666666655433211   22333333333                         


Q ss_pred             --cccccCC--CCCccccCcEEEeecCCCCCC-CCCCCCCCCceEeecCCcchhhhhccccCcCCCcccCCCCCCEEecC
Q 037604           59 --SKVQLPN--GLDYLPEKLRYLHWDTYPLRI-LPSNFKPKNLVELNLRFSKVEQLWEGEKACVPSSIQNFKYLSMLNFE  133 (540)
Q Consensus        59 --~~~~~~~--~~~~l~~~L~~L~l~~~~l~~-l~~~~~~~~L~~L~Ls~n~i~~l~~g~~~~lp~~~~~l~~L~~L~L~  133 (540)
                        ....+..  .+..+ .+|++|++++|.+.. +|....+++|++|++++|.++..       +|..++++++|++|+++
T Consensus       184 ~Ls~n~l~~~~~~~~l-~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~-------~~~~l~~l~~L~~L~Ls  255 (768)
T 3rgz_A          184 AISGNKISGDVDVSRC-VNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGD-------FSRAISTCTELKLLNIS  255 (768)
T ss_dssp             ECCSSEEESCCBCTTC-TTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSC-------HHHHTTTCSSCCEEECC
T ss_pred             ECCCCcccccCCcccC-CcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCc-------ccHHHhcCCCCCEEECC
Confidence              3222211  12334 366666666666644 33322566677777776666532       45566666667777776


Q ss_pred             CCCCCcccCCCCccCCCcEEEccCCcCccccCCCC----CCeeEEEcccCCce-eccccccCCCCCCEEEcccCcccccc
Q 037604          134 GCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQIS----GKITRLYLGCSAIE-EVPSSIECLTDLEVLDLMYCKRLKRI  208 (540)
Q Consensus       134 ~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~----~~l~~L~L~~~~l~-~l~~~~~~l~~L~~L~l~~~~~~~~~  208 (540)
                      +|.+.+.+|.. .+++|++|++++|.+.+.+|..+    .++++|++++|.++ .+|..++.+++|++|++++|.+.+.+
T Consensus       256 ~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~i  334 (768)
T 3rgz_A          256 SNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL  334 (768)
T ss_dssp             SSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEEC
T ss_pred             CCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcC
Confidence            66665555444 56666666666666655555443    45677777777766 55666777777777777777766666


Q ss_pred             chh-cCCCCCCcEEeccCCcCCCcCchhhhCC---------------------------CCCCEEEcCCCCCc-ccCccc
Q 037604          209 STR-FCKLRSLVDLCLNGCLNLERFPEILEKM---------------------------EHLKCINLDRTAIT-ELPSSF  259 (540)
Q Consensus       209 ~~~-l~~l~~L~~L~l~~~~~~~~~~~~l~~l---------------------------~~L~~L~l~~~~l~-~l~~~~  259 (540)
                      |.. +..+++|++|++++|.+.+.+|..+..+                           ++|++|++++|.++ .+|..+
T Consensus       335 p~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l  414 (768)
T 3rgz_A          335 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL  414 (768)
T ss_dssp             CHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGG
T ss_pred             CHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHH
Confidence            654 6667777777777766655555555443                           34444555554444 455566


Q ss_pred             CCCCCCCeEccCCCcCCCcCCCCCCCCCCCcEEEccCCCCCC-CCccccCCCCccEEEccCCCCCCcccccccCCCCCcE
Q 037604          260 ENLTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQ-LPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVA  338 (540)
Q Consensus       260 ~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~l~~-l~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~  338 (540)
                      ..+++|+.|++++|.+.+.+|..++.+++|+.|++++|.+.+ +|..+..+++|++|++++|.+.+.+|..+..+++|++
T Consensus       415 ~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~  494 (768)
T 3rgz_A          415 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNW  494 (768)
T ss_dssp             GGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             hcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCE
Confidence            677777777777777777777777777888888888887774 5777777888888888888888788888888888888


Q ss_pred             EeccCCCCCC-CChhhcCCCCCcEEEecCCCCc-ccchhccCCCCCCEEEecCCCCCCcCCCC-----------------
Q 037604          339 LHIRNFAVME-IPQEIARLSSLIDLHIGGNNFQ-SLPASIKQLSQLSSLELNDCKMLQSLPEL-----------------  399 (540)
Q Consensus       339 L~l~~~~~~~-~~~~~~~l~~L~~L~l~~~~l~-~lp~~l~~l~~L~~L~l~~~~~~~~~~~~-----------------  399 (540)
                      |++++|.+.+ +|.+++.+++|+.|++++|+++ .+|..+..+++|+.|++++|++.+.+|..                 
T Consensus       495 L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~  574 (768)
T 3rgz_A          495 ISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKR  574 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCE
T ss_pred             EEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccc
Confidence            8888888875 7778888888888888888876 77778888888888888888776655521                 


Q ss_pred             --------------------------------------------------------CCCccEEEecCCCCCCcCCCCC--
Q 037604          400 --------------------------------------------------------PLCLKYLHLRDCKMLQSLPALP--  421 (540)
Q Consensus       400 --------------------------------------------------------~~~L~~L~l~~~~~l~~~~~~~--  421 (540)
                                                                              .++|+.|++++|...+.+|..+  
T Consensus       575 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~  654 (768)
T 3rgz_A          575 YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGS  654 (768)
T ss_dssp             EEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGG
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhc
Confidence                                                                    1457788888888888888654  


Q ss_pred             -CCccEEeecCCCCCCCCCCcc---ccccccccccccccccCCCCCccccccchhhhhhhccCCCccccccccc--ccCC
Q 037604          422 -LCLESLDLRDCNMLRSLPELP---LCLQELDATNCNRLQSLAEIPSCLQELDASVLETLSKLSPDFRVWLPAF--LLQP  495 (540)
Q Consensus       422 -~~L~~L~l~~~~~l~~~~~~~---~~L~~L~i~~c~~l~~~~~~~~~l~~L~~~~~~~l~~l~~~~~~~lp~~--~~~l  495 (540)
                       ..|+.|++++|...+.+|..+   .+|+.|+++++. +  .+.+|..+..+..+..-.++.  +.+.+.+|..  ....
T Consensus       655 l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~-l--~g~ip~~l~~l~~L~~L~ls~--N~l~g~iP~~~~~~~~  729 (768)
T 3rgz_A          655 MPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNK-L--DGRIPQAMSALTMLTEIDLSN--NNLSGPIPEMGQFETF  729 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC-C--EECCCGGGGGCCCCSEEECCS--SEEEEECCSSSSGGGS
T ss_pred             cccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCc-c--cCcCChHHhCCCCCCEEECcC--CcccccCCCchhhccC
Confidence             348888898888888888644   356666666643 2  234555554443332222222  3344455543  1122


Q ss_pred             eEeeeccccccch----hHHHHHHHhhHHHHHHHHHH
Q 037604          496 IYFGFINSLKLNG----KANKKILADSQLRIRHMAIA  528 (540)
Q Consensus       496 ~~l~~~~c~~l~~----~~~~~~~~~~~~~i~~~~~~  528 (540)
                      ....|.+++.|-+    .|... .+.+|.+|+|+|.+
T Consensus       730 ~~~~~~gN~~Lcg~~l~~C~~~-~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          730 PPAKFLNNPGLCGYPLPRCDPS-NADGYAHHQRSHHH  765 (768)
T ss_dssp             CGGGGCSCTEEESTTSCCCCSC-C-------------
T ss_pred             CHHHhcCCchhcCCCCcCCCCC-ccCCCCCCCCcccc
Confidence            2234556655544    23222 36799999999875
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 540
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 62.4 bits (150), Expect = 3e-11
 Identities = 45/292 (15%), Positives = 100/292 (34%), Gaps = 18/292 (6%)

Query: 160 NLIEFPQ-ISGKITRLYLGCSAIEEV-PSSIECLTDLEVLDLMYCKRLKRISTRFCKLRS 217
            L + P+ +      L L  + I E+     + L +L  L L+  K  K     F  L  
Sbjct: 21  GLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVK 80

Query: 218 LVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFENLTGLKGLSVSDCSKLD 277
           L  L L+     E   ++ + ++ L+    + T + +   +  N   +  L  +      
Sbjct: 81  LERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSG 140

Query: 278 KLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLV 337
                   ++ L ++    + I+ +P  +  S  L  L     K  +    SL GL++L 
Sbjct: 141 IENGAFQGMKKLSYIRIADTNITTIPQGLPPS--LTELHLDGNKITKVDAASLKGLNNLA 198

Query: 338 ALHIRNFAVMEIPQEIARLSS-LIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSL 396
            L +   ++  +       +  L +LH+  N    +P  +     +  + L++   + ++
Sbjct: 199 KLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNN-ISAI 257

Query: 397 PELPLCLKYLHLRDCKMLQSLPALPLCLESLDLRDCNMLRSLPELPLCLQEL 448
                C    + +                 + L   N ++     P   + +
Sbjct: 258 GSNDFCPPGYNTKKAS-----------YSGVSLFS-NPVQYWEIQPSTFRCV 297
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query540
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.33
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.92
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.57
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.37
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.66
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.94  E-value=1.1e-25  Score=222.88  Aligned_cols=339  Identities=16%  Similarity=0.191  Sum_probs=185.4

Q ss_pred             hhccccCceeeeeccccccchhhhccchhhhhcccccccCCCCCccccCcEEEeecCCCCCCCCCCCCCCCceEeecCCc
Q 037604           25 FTNMSNMRLLKFYVPKFYGIERFLSMSIEEQLSYSKVQLPNGLDYLPEKLRYLHWDTYPLRILPSNFKPKNLVELNLRFS  104 (540)
Q Consensus        25 f~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~L~~L~l~~~~l~~l~~~~~~~~L~~L~Ls~n  104 (540)
                      .+.+.+|++|+++++.+.                   .+ +++..+ ++|++|++++|+++++++...+++|++|++++|
T Consensus        40 ~~~l~~l~~L~l~~~~I~-------------------~l-~gl~~L-~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n   98 (384)
T d2omza2          40 QTDLDQVTTLQADRLGIK-------------------SI-DGVEYL-NNLTQINFSNNQLTDITPLKNLTKLVDILMNNN   98 (384)
T ss_dssp             HHHHTTCCEEECCSSCCC-------------------CC-TTGGGC-TTCCEEECCSSCCCCCGGGTTCTTCCEEECCSS
T ss_pred             HHHhCCCCEEECCCCCCC-------------------Cc-cccccC-CCCCEEeCcCCcCCCCccccCCccccccccccc
Confidence            345667888888887763                   33 356666 478888888888888876557888888888888


Q ss_pred             chhhhhccccCcCCCcccCCCCCCEEecCCCCCCcccCCCCccCCCcEEEccCCcCccccCCCCCCe---eEEEcccCCc
Q 037604          105 KVEQLWEGEKACVPSSIQNFKYLSMLNFEGCKSLRSFPSNLHFVCPVTIDFSYCVNLIEFPQISGKI---TRLYLGCSAI  181 (540)
Q Consensus       105 ~i~~l~~g~~~~lp~~~~~l~~L~~L~L~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l---~~L~L~~~~l  181 (540)
                      .+..+         ..++++++|+.|+++++...+. +.......+.......+.+...........   ..........
T Consensus        99 ~i~~i---------~~l~~l~~L~~L~~~~~~~~~~-~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  168 (384)
T d2omza2          99 QIADI---------TPLANLTNLTGLTLFNNQITDI-DPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDL  168 (384)
T ss_dssp             CCCCC---------GGGTTCTTCCEEECCSSCCCCC-GGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCC
T ss_pred             ccccc---------cccccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccccchh
Confidence            87642         2367788888888877655432 222233444454444433221111111111   1111111111


Q ss_pred             eeccccccCCCCCCEEEcccCccccccchhcCCCCCCcEEeccCCcCCCcCchhhhCCCCCCEEEcCCCCCcccCcccCC
Q 037604          182 EEVPSSIECLTDLEVLDLMYCKRLKRISTRFCKLRSLVDLCLNGCLNLERFPEILEKMEHLKCINLDRTAITELPSSFEN  261 (540)
Q Consensus       182 ~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~l~~~~~~  261 (540)
                          ..+...+.........+..  .....+..+++++.+++++|.+.+..+  ....++|+.|++++|.++.++ .+..
T Consensus       169 ----~~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~~-~l~~  239 (384)
T d2omza2         169 ----KPLANLTTLERLDISSNKV--SDISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDIG-TLAS  239 (384)
T ss_dssp             ----GGGTTCTTCCEEECCSSCC--CCCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCCG-GGGG
T ss_pred             ----hhhcccccccccccccccc--ccccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCcc-hhhc
Confidence                1122233333333333321  112234455666666666655444322  344566666666666666553 3556


Q ss_pred             CCCCCeEccCCCcCCCcCCCCCCCCCCCcEEEccCCCCCCCCccccCCCCccEEEccCCCCCCcccccccCCCCCcEEec
Q 037604          262 LTGLKGLSVSDCSKLDKLPDNIGNLESLHHMSAFGSAISQLPSSVADSNVLGILDFSRCKGLESFPRSLLGLSSLVALHI  341 (540)
Q Consensus       262 l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~l~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l  341 (540)
                      +++|+.+++.+|.+.+..  .+..+++|++|+++++.+++++. +..++.++.+++..|.+.+.  ..+..+++++.|++
T Consensus       240 l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L~l~~~~l~~~~~-~~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~l  314 (384)
T d2omza2         240 LTNLTDLDLANNQISNLA--PLSGLTKLTELKLGANQISNISP-LAGLTALTNLELNENQLEDI--SPISNLKNLTYLTL  314 (384)
T ss_dssp             CTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCCCCGG-GTTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEEC
T ss_pred             ccccchhccccCccCCCC--cccccccCCEeeccCcccCCCCc-cccccccccccccccccccc--cccchhcccCeEEC
Confidence            666666666666554422  24556666666666666665542 44556666666666654432  23455666666666


Q ss_pred             cCCCCCCCChhhcCCCCCcEEEecCCCCcccchhccCCCCCCEEEecCCCCCCcCC-CCCCCccEEEecC
Q 037604          342 RNFAVMEIPQEIARLSSLIDLHIGGNNFQSLPASIKQLSQLSSLELNDCKMLQSLP-ELPLCLKYLHLRD  410 (540)
Q Consensus       342 ~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~lp~~l~~l~~L~~L~l~~~~~~~~~~-~~~~~L~~L~l~~  410 (540)
                      ++|.+.+++. +..+++|++|++++|+++.++ .++.+++|++|++++|++.+..| ..+++|+.|++++
T Consensus       315 s~n~l~~l~~-l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l~~l~~l~~L~~L~L~~  382 (384)
T d2omza2         315 YFNNISDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTPLANLTRITQLGLND  382 (384)
T ss_dssp             CSSCCSCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBCGGGTTCTTCSEEECCC
T ss_pred             CCCCCCCCcc-cccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCChhhccCCCCCEeeCCC
Confidence            6666666542 556666666666666666655 35666666666666665443222 1224444444444
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure