Citrus Sinensis ID: 037661


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MSSSSSSSSSSSSSSLSSSPFNNPEAREALFSKLADKEAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDLLMCFDKTVQIQAENQDPEMNVVKLENQDPEDNNDDKPKPKPSLVE
cccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
msssssssssssssslssspfnnpEAREALFSKLADKEAEASKHMAEELFKEEKIDSALCVVDrarmknpnhqglnshFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLfkpdrcssvgadTANKLINEAWEvlsdpkrreAYDLLMCFDKTVQiqaenqdpemnvvklenqdpednnddkpkpkpslve
msssssssssssssslssspfnNPEAREALFSKLADKEAEASKHMAeelfkeekiDSALCVVDRARMknpnhqglnSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQlfkpdrcssvgADTANKLINEawevlsdpkRREAYDLLMCFDKTVQIqaenqdpeMNVVKLenqdpednnddkpkpkpslve
MsssssssssssssslsssPFNNPEAREALFSKLADKEAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDLLMCFDKTVQIQAENQDPEMNVVKLenqdpednnddkpkpkpSLVE
******************************************************IDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDLLMCFDKTVQI***********************************
*********************NNPEAREA***KLADKEAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDL*********************************************
***********************PEAREALFSKLA**********AEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDLLMCFDKTVQIQAENQDPEMNVVKLEN*******************
********************************KLADKEAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDLLMCFDK***************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSSSSSSSSSSSLSSSPFNNPEAREALFSKLADKEAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDLLMCFDKTVQIQAENQDPEMNVVKLENQDPEDNNDDKPKPKPSLVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
B3WEQ6 387 Chaperone protein DnaJ OS yes no 0.323 0.167 0.441 6e-07
Q038N5 387 Chaperone protein DnaJ OS yes no 0.323 0.167 0.441 6e-07
P0DJM1 377 Chaperone protein DnaJ OS yes no 0.318 0.169 0.461 7e-07
B8DE39 376 Chaperone protein DnaJ OS yes no 0.318 0.170 0.461 7e-07
G2K045 377 Chaperone protein DnaJ OS yes no 0.318 0.169 0.461 7e-07
Q92BN9 376 Chaperone protein DnaJ OS yes no 0.318 0.170 0.461 7e-07
Q71ZJ8 376 Chaperone protein DnaJ OS yes no 0.318 0.170 0.446 1e-06
C1KVB9 376 Chaperone protein DnaJ OS yes no 0.318 0.170 0.446 1e-06
O66921 376 Chaperone protein DnaJ 2 yes no 0.338 0.180 0.405 1e-06
Q28I38 375 DnaJ homolog subfamily B yes no 0.318 0.170 0.430 2e-06
>sp|B3WEQ6|DNAJ_LACCB Chaperone protein DnaJ OS=Lactobacillus casei (strain BL23) GN=dnaJ PE=3 SV=1 Back     alignment and function desciption
 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 89  AEKKSWYAVLGI-RDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSD 147
           A++K +Y  LG+ RD  A  D I+K +  L + + PD   + GA+   K INEA++VLSD
Sbjct: 2   ADQKDYYETLGVSRD--ADDDTIRKAFRKLSKKYHPDLNHAPGAEQKFKDINEAYQVLSD 59

Query: 148 PKRREAYD 155
           P++R AYD
Sbjct: 60  PQKRAAYD 67




Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins.
Lactobacillus casei (strain BL23) (taxid: 543734)
>sp|Q038N5|DNAJ_LACC3 Chaperone protein DnaJ OS=Lactobacillus casei (strain ATCC 334) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 Back     alignment and function description
>sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
359473614 1168 PREDICTED: uncharacterized protein LOC10 0.577 0.099 0.382 1e-11
449524856 759 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.577 0.152 0.365 4e-11
449456494 759 PREDICTED: uncharacterized protein LOC10 0.577 0.152 0.365 4e-11
449440969 841 PREDICTED: uncharacterized protein LOC10 0.577 0.137 0.365 1e-10
255578737 636 heat shock protein binding protein, puta 0.577 0.182 0.357 2e-10
224072578 678 predicted protein [Populus trichocarpa] 0.582 0.172 0.360 3e-10
255540213 783 conserved hypothetical protein [Ricinus 0.601 0.154 0.359 3e-10
356529354 812 PREDICTED: uncharacterized protein LOC10 0.636 0.157 0.348 4e-10
356561770 779 PREDICTED: uncharacterized protein LOC10 0.582 0.150 0.368 4e-10
302143678 585 unnamed protein product [Vitis vinifera] 0.577 0.198 0.349 6e-10
>gi|359473614|ref|XP_002271091.2| PREDICTED: uncharacterized protein LOC100257476 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 7/123 (5%)

Query: 38  EAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKK----- 92
           EA  +K +AE+ F    I  A  +  +A+   P   GL    A   VH ++AE K     
Sbjct: 386 EATRAKEIAEKKFIARDIAGAKKLALKAQNLFPGLDGLPQMLATLDVH-ISAENKINGEA 444

Query: 93  SWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRRE 152
            WY +LG+ + +A  D ++K+Y  L  +  PD+  S+GAD A KLI+EAW +LSD  +R 
Sbjct: 445 DWYGILGV-NPQADDDTVRKQYRKLALMLHPDKNKSIGADGAFKLISEAWSLLSDKTKRI 503

Query: 153 AYD 155
           AYD
Sbjct: 504 AYD 506




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449524856|ref|XP_004169437.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101216332 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449456494|ref|XP_004145984.1| PREDICTED: uncharacterized protein LOC101216332 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440969|ref|XP_004138256.1| PREDICTED: uncharacterized protein LOC101223022 [Cucumis sativus] gi|449501461|ref|XP_004161373.1| PREDICTED: uncharacterized LOC101223022 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255578737|ref|XP_002530227.1| heat shock protein binding protein, putative [Ricinus communis] gi|223530274|gb|EEF32174.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224072578|ref|XP_002303790.1| predicted protein [Populus trichocarpa] gi|222841222|gb|EEE78769.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255540213|ref|XP_002511171.1| conserved hypothetical protein [Ricinus communis] gi|223550286|gb|EEF51773.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356529354|ref|XP_003533259.1| PREDICTED: uncharacterized protein LOC100816712 [Glycine max] Back     alignment and taxonomy information
>gi|356561770|ref|XP_003549151.1| PREDICTED: uncharacterized protein LOC100806402 [Glycine max] Back     alignment and taxonomy information
>gi|302143678|emb|CBI22539.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
TAIR|locus:2169170 431 AT5G37380 [Arabidopsis thalian 0.577 0.269 0.341 1.5e-11
TAIR|locus:2122950 558 AT4G19570 [Arabidopsis thalian 0.587 0.211 0.349 5.1e-11
TAIR|locus:2051244 706 AT2G05230 [Arabidopsis thalian 0.577 0.164 0.341 2.5e-10
TAIR|locus:2051274 706 AT2G05250 [Arabidopsis thalian 0.577 0.164 0.341 2.5e-10
TAIR|locus:2151714241 AT5G37750 [Arabidopsis thalian 0.417 0.348 0.379 1.2e-09
TAIR|locus:2163786 726 AT5G53150 [Arabidopsis thalian 0.587 0.162 0.325 1.5e-09
TAIR|locus:2040110 656 AT2G25560 [Arabidopsis thalian 0.587 0.179 0.32 1.6e-09
TAIR|locus:2195281138 AT1G09260 [Arabidopsis thalian 0.547 0.797 0.285 4.7e-09
TAIR|locus:2182508 287 AT5G37440 [Arabidopsis thalian 0.318 0.222 0.415 1.1e-08
TAIR|locus:2122970 345 AT4G19590 [Arabidopsis thalian 0.338 0.197 0.405 1.8e-08
TAIR|locus:2169170 AT5G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 1.5e-11, P = 1.5e-11
 Identities = 42/123 (34%), Positives = 66/123 (53%)

Query:    38 EAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKK----- 92
             EA  +K +AE  FK + I  A     +A+   P  +G++   A   V+ +AAE K     
Sbjct:     7 EATRAKEIAENKFKMKDIAGAKKFALKAQNLYPEIEGVSQMLATLDVY-IAAENKVNEDV 65

Query:    93 SWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRRE 152
              WY +L     R   + +K++Y  L  +  PD+  S+GA+ A K ++EAW+ LSD ++R 
Sbjct:    66 DWYGILNASP-RDDDETLKRKYRKLALMLHPDKNKSIGAEGAFKHVSEAWKFLSDKEKRA 124

Query:   153 AYD 155
             AYD
Sbjct:   125 AYD 127




GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2122950 AT4G19570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051244 AT2G05230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051274 AT2G05250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151714 AT5G37750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163786 AT5G53150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040110 AT2G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195281 AT1G09260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182508 AT5G37440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122970 AT4G19590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00002795001
SubName- Full=Chromosome chr1 scaffold_136, whole genome shotgun sequence; (817 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-14
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-12
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-11
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-10
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-10
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 8e-10
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-09
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-09
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-09
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 4e-09
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-09
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 8e-09
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-08
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 4e-08
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-08
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 6e-08
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 8e-08
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-07
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-07
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-07
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-07
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-07
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 6e-07
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 6e-07
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-06
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 3e-06
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-05
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-05
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-05
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-05
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-05
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 4e-05
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 4e-05
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 7e-05
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 3e-04
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 7e-04
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
 Score = 64.5 bits (158), Expect = 2e-14
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 94  WYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADT-ANKLINEAWEVLSDPKRRE 152
           +Y +LG+    A  + IKK Y  L   + PD+     A     K INEA+EVLSDP++R 
Sbjct: 2   YYEILGV-PRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60

Query: 153 AYD 155
            YD
Sbjct: 61  IYD 63


DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63

>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.95
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.92
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.87
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
PRK14288 369 chaperone protein DnaJ; Provisional 99.82
PRK14296 372 chaperone protein DnaJ; Provisional 99.82
PRK14287 371 chaperone protein DnaJ; Provisional 99.8
PRK14298 377 chaperone protein DnaJ; Provisional 99.79
PRK14279 392 chaperone protein DnaJ; Provisional 99.79
PRK14299 291 chaperone protein DnaJ; Provisional 99.79
PRK14291 382 chaperone protein DnaJ; Provisional 99.79
PRK14286 372 chaperone protein DnaJ; Provisional 99.78
PRK14276 380 chaperone protein DnaJ; Provisional 99.78
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.78
PRK14283 378 chaperone protein DnaJ; Provisional 99.78
PRK14285 365 chaperone protein DnaJ; Provisional 99.78
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.77
PRK14282 369 chaperone protein DnaJ; Provisional 99.77
PRK14280 376 chaperone protein DnaJ; Provisional 99.77
PRK14278 378 chaperone protein DnaJ; Provisional 99.77
PRK14301 373 chaperone protein DnaJ; Provisional 99.77
PRK14294 366 chaperone protein DnaJ; Provisional 99.76
PRK14277 386 chaperone protein DnaJ; Provisional 99.76
PRK10767 371 chaperone protein DnaJ; Provisional 99.75
PRK14297 380 chaperone protein DnaJ; Provisional 99.75
PRK14295 389 chaperone protein DnaJ; Provisional 99.75
PRK14284 391 chaperone protein DnaJ; Provisional 99.75
PRK14281 397 chaperone protein DnaJ; Provisional 99.74
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.73
PRK14300 372 chaperone protein DnaJ; Provisional 99.73
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.73
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
PRK14292 371 chaperone protein DnaJ; Provisional 99.72
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
PRK14293 374 chaperone protein DnaJ; Provisional 99.72
PRK14290 365 chaperone protein DnaJ; Provisional 99.72
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.71
PRK14289 386 chaperone protein DnaJ; Provisional 99.71
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.71
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.68
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.66
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.65
PHA03102153 Small T antigen; Reviewed 99.61
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.61
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.59
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
PRK05014171 hscB co-chaperone HscB; Provisional 99.55
PRK01356166 hscB co-chaperone HscB; Provisional 99.53
PRK00294173 hscB co-chaperone HscB; Provisional 99.5
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
PRK03578176 hscB co-chaperone HscB; Provisional 99.49
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.38
PTZ00100116 DnaJ chaperone protein; Provisional 99.3
PHA02624 647 large T antigen; Provisional 99.28
PRK01773173 hscB co-chaperone HscB; Provisional 99.25
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.25
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.17
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.12
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.07
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.01
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.3
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.27
KOG0431453 consensus Auxilin-like protein and related protein 98.27
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.98
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.71
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.21
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.79
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.51
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.23
PF1342844 TPR_14: Tetratricopeptide repeat 95.96
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.89
PF1337173 TPR_9: Tetratricopeptide repeat 95.74
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.36
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.32
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.76
KOG4234271 consensus TPR repeat-containing protein [General f 94.46
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 94.39
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 93.91
TIGR02552135 LcrH_SycD type III secretion low calcium response 93.69
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.31
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 93.27
KOG0553304 consensus TPR repeat-containing protein [General f 92.75
PF03704146 BTAD: Bacterial transcriptional activator domain; 92.39
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 92.34
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.16
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.89
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 91.84
PRK15359144 type III secretion system chaperone protein SscB; 91.53
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 91.37
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 91.15
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 90.88
PRK15359144 type III secretion system chaperone protein SscB; 90.78
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 90.58
PF13512142 TPR_18: Tetratricopeptide repeat 90.57
PRK10370198 formate-dependent nitrite reductase complex subuni 90.56
TIGR02552135 LcrH_SycD type III secretion low calcium response 90.56
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 90.33
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 90.0
PRK12370553 invasion protein regulator; Provisional 89.82
KOG0547 606 consensus Translocase of outer mitochondrial membr 89.67
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 89.54
KOG0553304 consensus TPR repeat-containing protein [General f 89.34
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 89.34
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 89.29
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.27
PRK10370198 formate-dependent nitrite reductase complex subuni 88.64
PRK11189296 lipoprotein NlpI; Provisional 88.19
KOG0724 335 consensus Zuotin and related molecular chaperones 87.95
PF1343134 TPR_17: Tetratricopeptide repeat 87.94
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 87.83
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 87.83
KOG4234271 consensus TPR repeat-containing protein [General f 87.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 87.76
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 86.19
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 85.54
PF07219108 HemY_N: HemY protein N-terminus; InterPro: IPR0108 85.14
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.03
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 84.41
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 84.19
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 84.12
PF10500225 SR-25: Nuclear RNA-splicing-associated protein; In 83.21
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 83.18
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 82.92
PF1337173 TPR_9: Tetratricopeptide repeat 82.66
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 82.6
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 82.42
PF10475291 DUF2450: Protein of unknown function N-terminal do 82.4
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 81.6
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 81.16
PF14687112 DUF4460: Domain of unknown function (DUF4460) 80.58
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
Probab=99.95  E-value=2e-27  Score=208.84  Aligned_cols=155  Identities=23%  Similarity=0.257  Sum_probs=143.5

Q ss_pred             CCChhhHHHHHHhhCHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCchhHHhhHHHHHHHHHhhhccCcchhccc
Q 037661           21 FNNPEAREALFSKLADKEAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKLAAEKKSWYAVLGI  100 (201)
Q Consensus        21 ~~~p~~~~~~~~r~n~~ea~~~~~~A~~~l~~~d~~~A~~~~~~a~~~~p~~~~~~~~l~~~~v~~~~~~~~d~Y~vLgv  100 (201)
                      .++|++++.|..|            |++++..++|+.|+.+|++|..+++....++..+.....+......+|||+||||
T Consensus       335 ~~d~~dv~~l~dR------------AeA~l~dE~YD~AI~dye~A~e~n~sn~~~reGle~Akrlkkqs~kRDYYKILGV  402 (504)
T KOG0624|consen  335 DIDPDDVQVLCDR------------AEAYLGDEMYDDAIHDYEKALELNESNTRAREGLERAKRLKKQSGKRDYYKILGV  402 (504)
T ss_pred             hcCchHHHHHHHH------------HHHHhhhHHHHHHHHHHHHHHhcCcccHHHHHHHHHHHHHHHHhccchHHHHhhh
Confidence            4677777777777            9999999999999999999999999999999999988888788899999999999


Q ss_pred             cCCCCCHHHHHHHHHHHHHhhCCCCCCCch----HHHHHHHHHHHHHHcCChhHHHHhhccCCCCccccccccCCCCCCc
Q 037661          101 RDHRAGVDVIKKRYEALVQLFKPDRCSSVG----ADTANKLINEAWEVLSDPKRREAYDLLMCFDKTVQIQAENQDPEMN  176 (201)
Q Consensus       101 ~~~~as~~eIkkaYrkla~~~HPDk~~~~~----a~~~f~~i~~Ay~vLsdp~kR~~YD~~~~~~~~~~~~~~~~~~~~~  176 (201)
                      .+ +|+..||.+|||+++.+||||...+..    |+++|..|..|-+||+||++|+.||.+.++-+...++++++++++.
T Consensus       403 kR-nAsKqEI~KAYRKlAqkWHPDNFqdEeEKKkAEKKFIDIAAAKEVLsd~EkRrqFDnGeDPLD~Es~q~GGGg~~Hg  481 (504)
T KOG0624|consen  403 KR-NASKQEITKAYRKLAQKWHPDNFQDEEEKKKAEKKFIDIAAAKEVLSDPEKRRQFDNGEDPLDPESQQGGGGGPFHG  481 (504)
T ss_pred             cc-cccHHHHHHHHHHHHHhcCCccccCHHHHHHHHHhhhhHHHHHHhhcCHHHHhhccCCCCCCChhhccCCCCCCCCC
Confidence            99 999999999999999999999998766    8999999999999999999999999999998888888888899999


Q ss_pred             ccccCCCCCCCC
Q 037661          177 VVKLENQDPEDN  188 (201)
Q Consensus       177 ~~~~~~~~~~~~  188 (201)
                      ++++-+|.|.-.
T Consensus       482 f~n~hgF~~F~~  493 (504)
T KOG0624|consen  482 FWNEHGFNPFGG  493 (504)
T ss_pred             CccccCCCCCCC
Confidence            999999988654



>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF10500 SR-25: Nuclear RNA-splicing-associated protein; InterPro: IPR019532 SR-25, otherwise known as ADP-ribosylation factor-like factor 6-interacting protein 4, is expressed in virtually all tissue types Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10475 DUF2450: Protein of unknown function N-terminal domain (DUF2450) ; InterPro: IPR019515 This entry represents Vacuolar protein sorting-associated protein 54, and is thought to be involved in retrograde transport from early and late endosomes to late Golgi found in eukaryotes, but its function is not known Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 3e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 2e-05
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 2e-05
3lz8_A 329 Structure Of A Putative Chaperone Dnaj From Klebsie 4e-05
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-05
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-04
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-04
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 2e-04
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-04
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-04
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 8/78 (10%) Query: 91 KKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSS-VGADTANKL------INEAWE 143 KK WY++LG D A + +K++Y+ L+ ++ PD+ S+ V A T + I++AW+ Sbjct: 9 KKDWYSILG-ADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWK 67 Query: 144 VLSDPKRREAYDLLMCFD 161 +L + + + YDL C D Sbjct: 68 ILGNEETKREYDLQRCED 85
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-13
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 8e-13
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-12
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 8e-12
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 9e-12
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-11
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 8e-11
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 1e-10
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-10
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-10
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 4e-10
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-10
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 6e-10
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 1e-09
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-09
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-09
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 4e-09
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 5e-09
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 6e-09
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 7e-09
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-08
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 1e-08
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-08
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-08
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 7e-08
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-07
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 9e-07
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 3e-05
2guz_A71 Mitochondrial import inner membrane translocase su 1e-04
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
 Score = 65.5 bits (160), Expect = 6e-13
 Identities = 36/132 (27%), Positives = 54/132 (40%), Gaps = 7/132 (5%)

Query: 28  EALFSKLADKEAEASKHMAEELFKEEKIDSALCVVDRARMKNPNHQGLNSHFACYVVHKL 87
           E L  ++      A K  AE    EE  D A+   + A+  N N Q +            
Sbjct: 320 EVL--QMEPDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLK 377

Query: 88  AAEKKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVG----ADTANKLINEAWE 143
            ++K+ +Y +LG+    A    I K Y  L   + PD   +      A+     I  A E
Sbjct: 378 QSQKRDYYKILGV-KRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKE 436

Query: 144 VLSDPKRREAYD 155
           VLSDP+ R+ +D
Sbjct: 437 VLSDPEMRKKFD 448


>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.86
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.86
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.85
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.85
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.85
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.84
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.84
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.84
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.83
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.83
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.82
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.82
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.81
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.81
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.8
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.79
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.77
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.77
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.75
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.72
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.72
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.72
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.72
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.71
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.7
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.69
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.68
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.68
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.68
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.68
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.65
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.61
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.6
2guz_A71 Mitochondrial import inner membrane translocase su 99.56
2guz_B65 Mitochondrial import inner membrane translocase su 98.83
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.63
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.63
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.42
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.24
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.95
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.79
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.74
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 95.69
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.45
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.34
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.17
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.02
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 94.99
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 94.93
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 94.81
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.59
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 94.56
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 94.54
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.25
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 94.02
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.01
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 93.78
3k9i_A117 BH0479 protein; putative protein binding protein, 93.77
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 93.76
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 93.7
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.66
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 93.51
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 93.41
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 93.39
2kat_A115 Uncharacterized protein; NESG, structure, structur 93.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 93.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 93.17
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 93.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 93.16
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.12
3k9i_A117 BH0479 protein; putative protein binding protein, 92.95
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 92.84
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 92.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 92.69
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 92.66
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 92.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 92.63
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 92.61
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 92.32
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 92.22
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.09
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 91.9
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 91.9
3q49_B137 STIP1 homology and U box-containing protein 1; E3 91.77
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 91.7
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 91.7
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 91.64
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 91.6
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 91.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 91.54
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 91.46
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 91.42
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 91.41
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 91.41
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 91.11
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 91.08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 91.05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 90.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 90.82
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 90.59
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 90.54
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 90.39
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 90.3
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 90.06
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.75
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 89.2
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 88.89
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 88.88
4i17_A228 Hypothetical protein; TPR repeats protein, structu 88.52
1om2_A95 Protein (mitochondrial import receptor subunit TOM 88.49
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 88.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 87.99
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 87.92
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 87.92
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 87.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 87.57
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 87.4
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 87.06
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 87.05
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 86.88
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 86.62
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 86.47
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 86.22
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 86.13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 86.03
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 86.0
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 85.95
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 85.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 85.82
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 85.41
4eqf_A365 PEX5-related protein; accessory protein, tetratric 85.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 84.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 83.68
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 83.63
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 83.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 83.38
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 83.16
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 83.09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 83.05
3u4t_A272 TPR repeat-containing protein; structural genomics 82.99
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 82.73
4i17_A228 Hypothetical protein; TPR repeats protein, structu 82.66
3u4t_A 272 TPR repeat-containing protein; structural genomics 82.62
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 82.47
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 82.42
2gw1_A514 Mitochondrial precursor proteins import receptor; 82.42
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 82.2
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 81.79
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 81.65
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 81.45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 81.42
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 81.27
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 81.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 81.16
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 81.03
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 80.93
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 80.58
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 80.05
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.86  E-value=4.1e-22  Score=140.13  Aligned_cols=71  Identities=34%  Similarity=0.525  Sum_probs=66.7

Q ss_pred             cCcchhccccCCCCCHHHHHHHHHHHHHhhCCCCCCCchHHHHHHHHHHHHHHcCChhHHHHhhccCCCCcc
Q 037661           92 KSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTANKLINEAWEVLSDPKRREAYDLLMCFDKT  163 (201)
Q Consensus        92 ~d~Y~vLgv~~~~as~~eIkkaYrkla~~~HPDk~~~~~a~~~f~~i~~Ay~vLsdp~kR~~YD~~~~~~~~  163 (201)
                      .|||+||||++ +++.++||++||+|++++|||+++.+.+.+.|+.|++||++|+||.+|..||.++..+..
T Consensus         3 ~~~y~iLgv~~-~as~~~Ik~ayr~l~~~~HPD~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~~~   73 (77)
T 1hdj_A            3 KDYYQTLGLAR-GASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLK   73 (77)
T ss_dssp             CCSHHHHTCCT-TCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGGGCC
T ss_pred             CCHHHHcCCCC-CCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHHcccccc
Confidence            58999999999 999999999999999999999999888999999999999999999999999998865443



>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-10
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-09
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 1e-08
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-08
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 5e-08
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 5e-08
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 9e-07
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 0.001
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 53.5 bits (128), Expect = 2e-10
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 91  KKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSVGADTAN-------KLINEAWE 143
           KK WY++LG  D  A +  +K++Y+ L+ L+ PD+ S+                I++AW+
Sbjct: 15  KKDWYSILGA-DPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWK 73

Query: 144 VLSDPKRREAYDL 156
           +L + + ++ YDL
Sbjct: 74  ILGNEETKKKYDL 86


>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.89
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.83
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.82
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.74
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.74
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.66
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.49
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.37
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.36
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.2
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.14
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.71
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.22
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.11
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 94.91
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.42
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.04
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 93.62
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 93.36
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.79
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.73
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.7
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 92.68
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 91.36
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 90.85
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 90.74
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 90.72
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 90.67
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 90.62
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 90.33
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 89.73
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 89.67
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 88.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 87.22
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 86.77
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 85.73
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 85.55
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 83.72
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 82.33
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 80.23
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
Probab=99.89  E-value=1.3e-23  Score=146.06  Aligned_cols=70  Identities=36%  Similarity=0.562  Sum_probs=64.9

Q ss_pred             ccCcchhccccCCCCCHHHHHHHHHHHHHhhCCCCCCCc-hHHHHHHHHHHHHHHcCChhHHHHhhccCCCC
Q 037661           91 KKSWYAVLGIRDHRAGVDVIKKRYEALVQLFKPDRCSSV-GADTANKLINEAWEVLSDPKRREAYDLLMCFD  161 (201)
Q Consensus        91 ~~d~Y~vLgv~~~~as~~eIkkaYrkla~~~HPDk~~~~-~a~~~f~~i~~Ay~vLsdp~kR~~YD~~~~~~  161 (201)
                      .+|||+||||++ +|+..+||++||++++++|||+++.. .+++.|..|++||+||+||.+|..||++|..+
T Consensus         2 k~dyY~vLgv~~-~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~   72 (75)
T d1xbla_           2 KQDYYEILGVSK-TAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAA   72 (75)
T ss_dssp             CCCTTTTTCCSS-SCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSS
T ss_pred             CCCHHHHcCCCC-CcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccc
Confidence            479999999999 99999999999999999999998764 47888999999999999999999999998654



>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure