Citrus Sinensis ID: 037720

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MAAVAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC
ccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEccccccEEEEEcccccccccccccccccccEEEccccccccccccEEEcccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEccccEEEccccHHHHcccccccEEcccccccccccccccccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEcccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccEEEEEccccccccccEEEEcccccccccccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEccccccEEEccHHHcccccEEEEcccccccccccHHHccccccEEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccc
MAAVAFHSTELLIIFLAVSSFvvnccppsdRAALLAFKSalhepyigifnswtgndcchnwygvscdpetHQVAEITlrgksedpifqrahrtgymtgfispavcklphlssltltdwegisgeiprcstllpflrildltgnkisgeiprhigklhrlsvlniadnyvsgpipgsignlsslmhldvrnnrisgpipgcfgRLHMLSRALLsgnqisgtipssisrvyrltdldlstnqisgpipaslgkmpdlstlnldfnrfsgvipaslltsgvnnlnlsknslegkipdafgpksYFMVLDLSynklsgpiprtlsgtsyIGYLDlshnnlcgkipagspfdhldassfesnkclcgkpllnac
MAAVAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITlrgksedpiFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFesnkclcgkpllnac
MAAVAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC
***VAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDA**F**NKCLCG*******
*****FH**ELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNA*
MAAVAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC
MAAVAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLL**C
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query369 2.2.26 [Sep-21-2011]
Q00874372 DNA-damage-repair/tolerat no no 0.934 0.927 0.590 1e-116
A7PW81333 Polygalacturonase inhibit no no 0.810 0.897 0.340 5e-41
Q42371 976 LRR receptor-like serine/ no no 0.764 0.288 0.345 4e-38
Q8VZG8 1045 Probable LRR receptor-lik no no 0.731 0.258 0.340 6e-38
Q9FL28 1173 LRR receptor-like serine/ no no 0.739 0.232 0.366 4e-37
Q05091330 Polygalacturonase inhibit N/A no 0.815 0.912 0.306 5e-37
Q9LP24 1120 Probable leucine-rich rep no no 0.726 0.239 0.341 1e-36
Q9LVP0 1102 Probable leucine-rich rep no no 0.785 0.263 0.368 1e-36
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.715 0.210 0.353 2e-35
Q9M5J9330 Polygalacturonase inhibit no no 0.804 0.9 0.321 3e-35
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function desciption
 Score =  419 bits (1077), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 259/347 (74%), Gaps = 2/347 (0%)

Query: 25  CCPPSDRAALLAFKSALHEPYIGIFNSWTGN-DCCHNWYGVSCDPETHQVAEITLRGKSE 83
           CC P D+ AL AFKS+L EP +GIFN+W+ N DCC  WYG+SCDP++ +V +I+LRG+SE
Sbjct: 26  CCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESE 85

Query: 84  DPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGN 143
           D IFQ+A R+GYM+G I PAVC L  L+SL L DW+GI+GEIP C T L  LRILDL GN
Sbjct: 86  DAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGN 145

Query: 144 KISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGR 203
           KI+GEIP  IGKL +L+VLN+A+N +SG IP S+ +L  L HL++  N I+G IP  FG 
Sbjct: 146 KITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGS 205

Query: 204 LHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFN 263
           L MLSR LL  N+++G+IP SIS + RL DLDLS N I GPIP  +G M  LS LNLD N
Sbjct: 206 LKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCN 265

Query: 264 RFSGVIPASLLT-SGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSG 322
             +G IP SLL+ SG++  NLS+N+LEG IPD FG K+Y + LDLS+N LSG IP +LS 
Sbjct: 266 SLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSS 325

Query: 323 TSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC 369
             ++G+LD+SHN LCG+IP G PFDHL+A+SF  N+CLCG PL  +C
Sbjct: 326 AKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGPLTTSC 372
This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.
Arabidopsis thaliana (taxid: 3702)
>sp|A7PW81|PGIP_VITVI Polygalacturonase inhibitor OS=Vitis vinifera GN=pgip PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9M5J9|PGIP1_ARATH Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana GN=PGIP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query369
312281525365 unnamed protein product [Thellungiella h 0.932 0.942 0.721 1e-145
359806061368 DNA-damage-repair/toleration protein DRT 0.986 0.989 0.717 1e-145
377774276367 leucine-rich repeat receptor-like protei 0.986 0.991 0.682 1e-144
377774272367 leucine-rich repeat receptor-like protei 0.986 0.991 0.682 1e-144
377774270367 leucine-rich repeat receptor-like protei 0.986 0.991 0.682 1e-144
377774274367 leucine-rich repeat receptor-like protei 0.986 0.991 0.682 1e-143
297830776365 leucine-rich repeat family protein [Arab 0.932 0.942 0.707 1e-141
15232373365 leucine-rich repeat-containing protein [ 0.932 0.942 0.704 1e-141
225435514364 PREDICTED: DNA-damage-repair/toleration 0.972 0.986 0.693 1e-141
255544794366 serine-threonine protein kinase, plant-t 0.991 1.0 0.701 1e-140
>gi|312281525|dbj|BAJ33628.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
 Score =  522 bits (1344), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 249/345 (72%), Positives = 294/345 (85%), Gaps = 1/345 (0%)

Query: 25  CCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPETHQVAEITLRGKSED 84
           CCPPSDR ALLAF+SALHEPY+GIFNSWTG DCCHNWYGVSCD  TH+VA+I LRG+SED
Sbjct: 19  CCPPSDRRALLAFRSALHEPYLGIFNSWTGQDCCHNWYGVSCDSVTHRVADINLRGESED 78

Query: 85  PIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNK 144
           PIF+RAHRTG+MTG ISPA+C LP LS++T+  W+GISGEIP+C T LPFLR LDL GN+
Sbjct: 79  PIFERAHRTGFMTGRISPAICNLPRLSAITIAGWKGISGEIPKCITRLPFLRTLDLIGNQ 138

Query: 145 ISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRL 204
           ISG IP  IG+LHRL+VLN+ADN +SGPIP S+ NLSSLMHLD+RNN+ISG IP  FGRL
Sbjct: 139 ISGGIPNDIGRLHRLAVLNVADNRISGPIPKSLTNLSSLMHLDLRNNQISGVIPPDFGRL 198

Query: 205 HMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNR 264
            MLSRALLSGN+I+G IP S++R+YRL D+DLS NQ+ G IP SLG+M  L+TLNLD N+
Sbjct: 199 TMLSRALLSGNRITGRIPESLTRIYRLADVDLSGNQLYGTIPPSLGRMAVLATLNLDGNK 258

Query: 265 FSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTS 324
            SG IP +L+TS V NLNLS+N L+GKIP+ FGP+SYF VLDLSYN L GPIPR++SG S
Sbjct: 259 ISGEIPQTLMTSSVMNLNLSRNLLQGKIPEGFGPRSYFTVLDLSYNNLKGPIPRSISGAS 318

Query: 325 YIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC 369
           +IG+LDLSHN+LCG+IP GSPFDHL+A+SF  N CLCGKP L AC
Sbjct: 319 FIGHLDLSHNHLCGRIPVGSPFDHLEAASFMYNDCLCGKP-LRAC 362

Source: Thellungiella halophila

Species: Eutrema halophilum

Genus: Eutrema

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359806061|ref|NP_001240925.1| DNA-damage-repair/toleration protein DRT100-like precursor [Glycine max] gi|223452540|gb|ACM89597.1| leucine rich repeat protein [Glycine max] Back     alignment and taxonomy information
>gi|377774276|gb|AFB75324.1| leucine-rich repeat receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|377774272|gb|AFB75322.1| leucine-rich repeat receptor-like protein [Malus x domestica] gi|377774284|gb|AFB75328.1| leucine-rich repeat receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|377774270|gb|AFB75321.1| leucine-rich repeat receptor-like protein [Malus x domestica] gi|377774278|gb|AFB75325.1| leucine-rich repeat receptor-like protein [Malus x domestica] gi|377774280|gb|AFB75326.1| leucine-rich repeat receptor-like protein [Malus x domestica] gi|377774282|gb|AFB75327.1| leucine-rich repeat receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|377774274|gb|AFB75323.1| leucine-rich repeat receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|297830776|ref|XP_002883270.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297329110|gb|EFH59529.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15232373|ref|NP_188718.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|9294409|dbj|BAB02490.1| polygalacturonase inhibitor-like protein [Arabidopsis thaliana] gi|17380932|gb|AAL36278.1| unknown protein [Arabidopsis thaliana] gi|21436417|gb|AAM51409.1| unknown protein [Arabidopsis thaliana] gi|332642907|gb|AEE76428.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225435514|ref|XP_002285553.1| PREDICTED: DNA-damage-repair/toleration protein DRT100 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255544794|ref|XP_002513458.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223547366|gb|EEF48861.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query369
TAIR|locus:2091871365 AT3G20820 [Arabidopsis thalian 0.964 0.975 0.688 2e-136
TAIR|locus:2182260371 AT5G12940 [Arabidopsis thalian 0.962 0.956 0.637 1.5e-122
TAIR|locus:2091260372 DRT100 "DNA-DAMAGE REPAIR/TOLE 0.978 0.970 0.582 5.9e-112
TAIR|locus:2066306 480 AT2G26380 [Arabidopsis thalian 0.878 0.675 0.358 2e-47
TAIR|locus:2012633455 AT1G33670 [Arabidopsis thalian 0.918 0.745 0.363 4.8e-46
TAIR|locus:2197586 478 AT1G33600 [Arabidopsis thalian 0.840 0.648 0.357 3.4e-45
TAIR|locus:2197563 477 AT1G33590 [Arabidopsis thalian 0.842 0.651 0.355 5.6e-45
TAIR|locus:2154463 589 AT5G23400 [Arabidopsis thalian 0.878 0.550 0.362 1.9e-44
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.853 0.36 0.346 1.5e-40
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.867 0.325 0.340 2.4e-39
TAIR|locus:2091871 AT3G20820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1336 (475.4 bits), Expect = 2.0e-136, P = 2.0e-136
 Identities = 247/359 (68%), Positives = 298/359 (83%)

Query:    11 LLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHNWYGVSCDPET 70
             +L++ L +SS    CCPPSDR ALLAF+SALHEPY+GIFNSWTG DCCHNWYG+SCD  T
Sbjct:     7 VLLLLLLISS--ATCCPPSDRRALLAFRSALHEPYLGIFNSWTGQDCCHNWYGISCDSLT 64

Query:    71 HQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCST 130
             H+VA+I LRG+SEDPIF+RAHRTGYMTG IS ++C+L  LS++T+ DW+GISGEIP+C T
Sbjct:    65 HRVADINLRGESEDPIFERAHRTGYMTGHISASICELTRLSAITIADWKGISGEIPKCIT 124

Query:   131 LLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRN 190
              LPFLR LDL GN+ISG IP  IG+L+RL+VLN+ADN +SG IP S+ NLSSLMHLD+RN
Sbjct:   125 RLPFLRTLDLIGNQISGGIPYDIGRLNRLAVLNVADNRISGSIPKSLTNLSSLMHLDLRN 184

Query:   191 NRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLG 250
             N ISG IP   GRL MLSRALLSGN+I+G IP S++ +YRL D+DLS NQ+ G IP SLG
Sbjct:   185 NLISGVIPSDVGRLKMLSRALLSGNRITGRIPESLTNIYRLADVDLSGNQLYGTIPPSLG 244

Query:   251 KMPDLSTLNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYN 310
             +M  L+TLNLD N+ SG IP +L+TS V NLNLS+N L+GKIP+ FGP+SYF VLDLSYN
Sbjct:   245 RMSVLATLNLDGNKISGEIPQTLMTSSVMNLNLSRNLLQGKIPEGFGPRSYFTVLDLSYN 304

Query:   311 KLSGPIPRTLSGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC 369
              L GPIPR++SG S+IG+LDLSHN+LCG+IP GSPFDHL+A+SF  N CLCGKPL  AC
Sbjct:   305 NLKGPIPRSISGASFIGHLDLSHNHLCGRIPVGSPFDHLEAASFMFNDCLCGKPL-RAC 362
GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2182260 AT5G12940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091260 DRT100 "DNA-DAMAGE REPAIR/TOLERATION 100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066306 AT2G26380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012633 AT1G33670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197586 AT1G33600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197563 AT1G33590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154463 AT5G23400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
scaffold_302486.1
annotation not avaliable (365 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.6__2219__AT5G22320.1
annotation not avaliable (452 aa)
  •     0.493
fgenesh2_kg.6__1996__AT5G19680.1
annotation not avaliable (328 aa)
  •     0.441

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-36
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-12
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 5e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  175 bits (446), Expect = 1e-48
 Identities = 117/366 (31%), Positives = 177/366 (48%), Gaps = 40/366 (10%)

Query: 1   MAAVAFHSTELLIIFLAVSSFVVNCCPPSDRAALLAFKSALHEPYIGIFNSWTGNDCCHN 60
           MA         LI  L       +     +   LL+FKS++++P   + N  +  D C  
Sbjct: 1   MAKKGPQHCPYLIFMLFFLFLNFSMLHAEELELLLSFKSSINDPLKYLSNWNSSADVC-L 59

Query: 61  WYGVSCDPETHQVAEITLRGKSEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEG 120
           W G++C+  +  V  I L GK+             ++G IS A+ +LP++ ++ L++   
Sbjct: 60  WQGITCNNSSR-VVSIDLSGKN-------------ISGKISSAIFRLPYIQTINLSN-NQ 104

Query: 121 ISGEIPR-----CSTL------------------LPFLRILDLTGNKISGEIPRHIGKLH 157
           +SG IP       S+L                  +P L  LDL+ N +SGEIP  IG   
Sbjct: 105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFS 164

Query: 158 RLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQI 217
            L VL++  N + G IP S+ NL+SL  L + +N++ G IP   G++  L    L  N +
Sbjct: 165 SLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNL 224

Query: 218 SGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLDFNRFSGVIPASLLT-S 276
           SG IP  I  +  L  LDL  N ++GPIP+SLG + +L  L L  N+ SG IP S+ +  
Sbjct: 225 SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQ 284

Query: 277 GVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNL 336
            + +L+LS NSL G+IP+         +L L  N  +G IP  L+    +  L L  N  
Sbjct: 285 KLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKF 344

Query: 337 CGKIPA 342
            G+IP 
Sbjct: 345 SGEIPK 350

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 369
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.7
PLN03150623 hypothetical protein; Provisional 99.69
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.58
PLN03150623 hypothetical protein; Provisional 99.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.36
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.2
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.93
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.78
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.65
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.52
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.17
PRK15386 426 type III secretion protein GogB; Provisional 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.77
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.72
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.7
PRK15386 426 type III secretion protein GogB; Provisional 97.69
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.62
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.5
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.34
KOG4341483 consensus F-box protein containing LRR [General fu 97.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.03
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.5
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.33
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.12
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.93
KOG4308 478 consensus LRR-containing protein [Function unknown 94.46
KOG4308478 consensus LRR-containing protein [Function unknown 94.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.9
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.99
smart0037026 LRR Leucine-rich repeats, outliers. 87.99
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.97
KOG4341483 consensus F-box protein containing LRR [General fu 85.59
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.86
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.31
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.25
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.9e-42  Score=360.14  Aligned_cols=328  Identities=34%  Similarity=0.589  Sum_probs=250.3

Q ss_pred             CCHHHHHHHHHHHHhCCCCCCCCCCCCC-CCCCCCCCcceEeCCCCCcEEEEEcCCCCCC----hhhhhcc-------CC
Q 037720           26 CPPSDRAALLAFKSALHEPYIGIFNSWT-GNDCCHNWYGVSCDPETHQVAEITLRGKSED----PIFQRAH-------RT   93 (369)
Q Consensus        26 ~~~~~~~~ll~~~~~~~~~~~~~~~~W~-~~~~c~~w~gv~c~~~~~~v~~L~L~~~~~~----~~~~~~~-------~~   93 (369)
                      ..++|++||++||+++.+ +.+.+.+|+ +.+||. |.||+|+. .++|++|++++....    ..+..+.       ..
T Consensus        26 ~~~~~~~~l~~~~~~~~~-~~~~~~~w~~~~~~c~-w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~  102 (968)
T PLN00113         26 LHAEELELLLSFKSSIND-PLKYLSNWNSSADVCL-WQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSN  102 (968)
T ss_pred             CCHHHHHHHHHHHHhCCC-CcccCCCCCCCCCCCc-CcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCC
Confidence            367899999999999964 556788997 677886 99999985 469999999983211    1111111       23


Q ss_pred             CcceeecCcccc-CCCCCCEEecCCCCCCcccCCcCCCCCCCCcEEEccCCcCCccCCccccCCCCCCEEEeecccCCCC
Q 037720           94 GYMTGFISPAVC-KLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGP  172 (369)
Q Consensus        94 ~~~~~~~~~~l~-~l~~L~~L~L~~~~~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~  172 (369)
                      |.+.|.+|..+. .+++|++|++++ |.+++.+|.  +.+++|++|++++|.+++.+|..++++++|++|++++|.+.+.
T Consensus       103 n~~~~~ip~~~~~~l~~L~~L~Ls~-n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~  179 (968)
T PLN00113        103 NQLSGPIPDDIFTTSSSLRYLNLSN-NNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGK  179 (968)
T ss_pred             CccCCcCChHHhccCCCCCEEECcC-CccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccccc
Confidence            445555555443 566666666663 455555553  3466677777777777777777777888888888888888777


Q ss_pred             CCccccCCCCCcEEEeecccccCCCCcccCCCCCCcEEEccCCcccccCCccccCCCCCCEEEcccCCCccccccccCCC
Q 037720          173 IPGSIGNLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKM  252 (369)
Q Consensus       173 ~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~l~~l  252 (369)
                      +|..+.++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..+.++++|++|++++|.+++.+|..++++
T Consensus       180 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  259 (968)
T PLN00113        180 IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL  259 (968)
T ss_pred             CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCC
Confidence            77778888888888888888877778888888888888888888887888888888888888888888887788888888


Q ss_pred             CCCcEEeccCCcccccCCcccCc-CCCCEEEccCCcCCccCCcCcCCCCCCCEEEccCCCCCCCCcccCcCCCCcCEEEc
Q 037720          253 PDLSTLNLDFNRFSGVIPASLLT-SGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDL  331 (369)
Q Consensus       253 ~~L~~L~L~~n~l~~~~~~~~~~-~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l  331 (369)
                      ++|++|++++|.+.+..|..+.. ++|++|++++|.+.+.+|..+.++++|+.|++++|.+++.+|..+..+++|++|++
T Consensus       260 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L  339 (968)
T PLN00113        260 KNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQL  339 (968)
T ss_pred             CCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEEC
Confidence            88888888888888777776655 78888888888888888888888888888888888888888888888888888888


Q ss_pred             ccCcCceeCCCC-CCCCCCCcccccCCCC
Q 037720          332 SHNNLCGKIPAG-SPFDHLDASSFESNKC  359 (369)
Q Consensus       332 s~N~l~g~ip~~-~~~~~l~~l~~~~n~~  359 (369)
                      ++|.++|.+|.. ..+++|+.+++++|..
T Consensus       340 ~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l  368 (968)
T PLN00113        340 WSNKFSGEIPKNLGKHNNLTVLDLSTNNL  368 (968)
T ss_pred             cCCCCcCcCChHHhCCCCCcEEECCCCee
Confidence            888888888863 5567788888887753

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-32
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-27
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-05
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-27
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-09
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-09
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-09
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 8e-09
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 9e-09
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-08
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-08
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-07
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 9e-06
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 9e-06
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 1e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 6e-05
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 6e-05
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 6e-05
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 6e-05
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 6e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-05
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 8e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 9e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-04
4eco_A 636 Crystal Structure Of A Hypothetical Protein (Bacegg 2e-04
3b2d_A 603 Crystal Structure Of Human Rp105MD-1 Complex Length 4e-04
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 7e-04
3o53_A317 Crystal Structure Of Lrim1 Leucine-Rich Repeat Doma 7e-04
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (338), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 164/345 (47%), Gaps = 43/345 (12%)
Query: 26  CPPSDRAALLAFKSALHEPYIGIFNSWT-GNDCCH-NWYGVSCDP--ETHQVAEITLRGK 81
           C P D+ ALL  K  L  P     +SW    DCC+  W GV CD   +T++V  + L G 
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT--LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60
Query: 82  SEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLT 141
           +    +            I  ++  LP+L+ L +     + G IP     L  L  L +T
Sbjct: 61  NLPKPYP-----------IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYIT 109
Query: 142 GNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCF 201
              +SG IP  + ++  L  L+ + N +SG +P SI +L +L+ +    NRISG IP  +
Sbjct: 110 HTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY 169
Query: 202 GRLHMLSRAL-LSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNL 260
           G    L  ++ +S N+++G IP + + +  L  +DLS N + G      G   +   ++L
Sbjct: 170 GSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHL 228
Query: 261 DFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTL 320
             N          L   +  + LSKN L G              LDL  N++ G +P+ L
Sbjct: 229 AKNS---------LAFDLGKVGLSKN-LNG--------------LDLRNNRIYGTLPQGL 264
Query: 321 SGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPL 365
           +   ++  L++S NNLCG+IP G      D S++ +NKCLCG PL
Sbjct: 265 TQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPL 309
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3O53|A Chain A, Crystal Structure Of Lrim1 Leucine-Rich Repeat Domain Length = 317 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query369
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-104
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-70
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-67
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-45
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-40
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-35
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-31
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-29
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-29
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-25
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  307 bits (790), Expect = e-104
 Identities = 101/345 (29%), Positives = 158/345 (45%), Gaps = 43/345 (12%)

Query: 26  CPPSDRAALLAFKSALHEPYIGIFNSWTGN-DCCHN-WYGVSCDPETH--QVAEITLRGK 81
           C P D+ ALL  K  L  P     +SW    DCC+  W GV CD +T   +V  + L G 
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT--LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60

Query: 82  SEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLT 141
           +                 I  ++  LP+L+ L +     + G IP     L  L  L +T
Sbjct: 61  NL-----------PKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYIT 109

Query: 142 GNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCF 201
              +SG IP  + ++  L  L+ + N +SG +P SI +L +L+ +    NRISG IP  +
Sbjct: 110 HTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY 169

Query: 202 GRLHMLSRAL-LSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNL 260
           G    L  ++ +S N+++G IP + + +  L  +DLS N + G      G   +   ++L
Sbjct: 170 GSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHL 228

Query: 261 DFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTL 320
             N  +  +        V        +L                LDL  N++ G +P+ L
Sbjct: 229 AKNSLAFDLGK------VGLS----KNLN--------------GLDLRNNRIYGTLPQGL 264

Query: 321 SGTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPL 365
           +   ++  L++S NNLCG+IP G      D S++ +NKCLCG PL
Sbjct: 265 TQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPL 309
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query369
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.29
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.02
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.8
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.64
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.5
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.89
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=1.3e-48  Score=357.38  Aligned_cols=304  Identities=34%  Similarity=0.659  Sum_probs=224.4

Q ss_pred             CCCHHHHHHHHHHHHhCCCCCCCCCCCCC-CCCCCC-CCcceEeCCCC--CcEEEEEcCCCCCChhhhhccCCCccee--
Q 037720           25 CCPPSDRAALLAFKSALHEPYIGIFNSWT-GNDCCH-NWYGVSCDPET--HQVAEITLRGKSEDPIFQRAHRTGYMTG--   98 (369)
Q Consensus        25 ~~~~~~~~~ll~~~~~~~~~~~~~~~~W~-~~~~c~-~w~gv~c~~~~--~~v~~L~L~~~~~~~~~~~~~~~~~~~~--   98 (369)
                      .|.++|++||++||+++.++ . .+++|. +.+||. .|.||+|+...  ++|+.|++++             +.+.+  
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~-~-~l~~W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~-------------~~l~~~~   66 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNP-T-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG-------------LNLPKPY   66 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCC-G-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEEC-------------CCCSSCE
T ss_pred             CCCHHHHHHHHHHHHhcCCc-c-cccCCCCCCCCCcCCCcceEeCCCCCCceEEEEECCC-------------CCccCCc
Confidence            58999999999999999754 3 688997 667873 39999998654  7999999998             66777  


Q ss_pred             ecCccccCCCCCCEEecCCCCCCcccCCcCCCCCCCCcEEEccCCcCCccCCccccCCCCCCEEEeecccCCCCCCcccc
Q 037720           99 FISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIG  178 (369)
Q Consensus        99 ~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~  178 (369)
                      .+|..+.++++|++|++++++.+.+.+|..++.+++|++|++++|.+++.+|..+.++++|++|++++|.+++.+|..+.
T Consensus        67 ~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~  146 (313)
T 1ogq_A           67 PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSIS  146 (313)
T ss_dssp             ECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGG
T ss_pred             ccChhHhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHh
Confidence            77777777777777777643566666676677777777777777777666666666677777777777766666666666


Q ss_pred             CCCCCcEEEeecccccCCCCcccCCCC-CCcEEEccCCcccccCCccccCCCCCCEEEcccCCCccccccccCCCCCCcE
Q 037720          179 NLSSLMHLDVRNNRISGPIPGCFGRLH-MLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLST  257 (369)
Q Consensus       179 ~l~~L~~L~Ls~n~l~~~~~~~l~~l~-~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~l~~l~~L~~  257 (369)
                      .+++|++|++++|.+++.+|..+..++ +|++|++++|.+++.+|..+..++ |++|++++|.+++..|..+..+++|+ 
T Consensus       147 ~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~-  224 (313)
T 1ogq_A          147 SLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQ-  224 (313)
T ss_dssp             GCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCS-
T ss_pred             cCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCC-
Confidence            666666666666666655666665555 566666666665555555555554 55555555555555555555555554 


Q ss_pred             EeccCCcccccCCcccCcCCCCEEEccCCcCCccCCcCcCCCCCCCEEEccCCCCCCCCcccCcCCCCcCEEEcccCcCc
Q 037720          258 LNLDFNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNLC  337 (369)
Q Consensus       258 L~L~~n~l~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~ls~N~l~  337 (369)
                                            +|++++|.+++.+|. +..+++|++|++++|++++.+|..+..+++|++|++++|+++
T Consensus       225 ----------------------~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~  281 (313)
T 1ogq_A          225 ----------------------KIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC  281 (313)
T ss_dssp             ----------------------EEECCSSEECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE
T ss_pred             ----------------------EEECCCCceeeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCccc
Confidence                                  455555555444443 567789999999999999999999999999999999999999


Q ss_pred             eeCCCCCCCCCCCcccccCCCCccCCCCCCCC
Q 037720          338 GKIPAGSPFDHLDASSFESNKCLCGKPLLNAC  369 (369)
Q Consensus       338 g~ip~~~~~~~l~~l~~~~n~~~c~~~~~~~c  369 (369)
                      |.+|....+++|+.+++.+|+++|+.++. .|
T Consensus       282 ~~ip~~~~l~~L~~l~l~~N~~lc~~p~~-~C  312 (313)
T 1ogq_A          282 GEIPQGGNLQRFDVSAYANNKCLCGSPLP-AC  312 (313)
T ss_dssp             EECCCSTTGGGSCGGGTCSSSEEESTTSS-CC
T ss_pred             ccCCCCccccccChHHhcCCCCccCCCCC-CC
Confidence            99999988999999999999999998875 46
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 369
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-33
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  122 bits (307), Expect = 8e-33
 Identities = 90/344 (26%), Positives = 141/344 (40%), Gaps = 41/344 (11%)

Query: 26  CPPSDRAALLAFKSALHEPYIGIFNSWT-GNDCCH-NWYGVSCDPET--HQVAEITLRGK 81
           C P D+ ALL  K  L  P     +SW    DCC+  W GV CD +T  ++V  + L G 
Sbjct: 3   CNPQDKQALLQIKKDLGNP--TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60

Query: 82  SEDPIFQRAHRTGYMTGFISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLT 141
           +    +            I  ++  LP+L+ L +     + G IP     L  L  L +T
Sbjct: 61  NLPKPYP-----------IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYIT 109

Query: 142 GNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIGNLSSLMHLDVRNNRISGPIPGCF 201
              +SG IP  + ++  L  L+ + N +SG +P SI +L +L+ +    NRISG IP  +
Sbjct: 110 HTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY 169

Query: 202 GRLHMLSRALLSGNQISGTIPSSISRVYRLTDLDLSTNQISGPIPASLGKMPDLSTLNLD 261
           G    L  ++                           N+++G IP +   +         
Sbjct: 170 GSFSKLFTSMTISR-----------------------NRLTGKIPPTFANLNLAFVDLSR 206

Query: 262 FNRFSGVIPASLLTSGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLS 321
                        +           +         G       LDL  N++ G +P+ L+
Sbjct: 207 NMLEGDASVLF-GSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLT 265

Query: 322 GTSYIGYLDLSHNNLCGKIPAGSPFDHLDASSFESNKCLCGKPL 365
              ++  L++S NNLCG+IP G      D S++ +NKCLCG PL
Sbjct: 266 QLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPL 309
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query369
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.18
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=5.5e-48  Score=351.18  Aligned_cols=303  Identities=34%  Similarity=0.624  Sum_probs=211.4

Q ss_pred             CCCHHHHHHHHHHHHhCCCCCCCCCCCCC-CCCCCC-CCcceEeCCCC--CcEEEEEcCCCCCChhhhhccCCCccee--
Q 037720           25 CCPPSDRAALLAFKSALHEPYIGIFNSWT-GNDCCH-NWYGVSCDPET--HQVAEITLRGKSEDPIFQRAHRTGYMTG--   98 (369)
Q Consensus        25 ~~~~~~~~~ll~~~~~~~~~~~~~~~~W~-~~~~c~-~w~gv~c~~~~--~~v~~L~L~~~~~~~~~~~~~~~~~~~~--   98 (369)
                      -|.|+||+||++||+++.++  ..+++|. ++|||. .|.||+|+..+  +||++|+|++             +.+.|  
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~--~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~-------------~~l~g~~   66 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNP--TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG-------------LNLPKPY   66 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCC--GGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEEC-------------CCCSSCE
T ss_pred             CCCHHHHHHHHHHHHHCCCC--CcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCC-------------CCCCCCC
Confidence            48999999999999999875  3588997 789994 49999998643  4899999998             55554  


Q ss_pred             ecCccccCCCCCCEEecCCCCCCcccCCcCCCCCCCCcEEEccCCcCCccCCccccCCCCCCEEEeecccCCCCCCcccc
Q 037720           99 FISPAVCKLPHLSSLTLTDWEGISGEIPRCSTLLPFLRILDLTGNKISGEIPRHIGKLHRLSVLNIADNYVSGPIPGSIG  178 (369)
Q Consensus        99 ~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~  178 (369)
                      .+|+.+.++++|++|+|+++|.+.|.+|..++++++|++|++++|.+.+..+..+..+.+|+++++++|.+.+.+|..+ 
T Consensus        67 ~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l-  145 (313)
T d1ogqa_          67 PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI-  145 (313)
T ss_dssp             ECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGG-
T ss_pred             CCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhh-
Confidence            3556666666666666654445555555555555555555555555555444445555555555555555444444444 


Q ss_pred             CCCCCcEEEeecccccCCCCcccCCCCCCcEEEccCCcccccCCccccCCCCC-CEEEcccCCCccccccccCCCCCCcE
Q 037720          179 NLSSLMHLDVRNNRISGPIPGCFGRLHMLSRALLSGNQISGTIPSSISRVYRL-TDLDLSTNQISGPIPASLGKMPDLST  257 (369)
Q Consensus       179 ~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L-~~L~ls~n~l~~~~~~~l~~l~~L~~  257 (369)
                                             .+++.++++++++|.+.+.+|..+..+.++ +.++++.|++++..|..+..+..+ .
T Consensus       146 -----------------------~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~  201 (313)
T d1ogqa_         146 -----------------------SSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-F  201 (313)
T ss_dssp             -----------------------GGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-E
T ss_pred             -----------------------ccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-c
Confidence                                   444455555555555554555555444443 555555666655555555554333 4


Q ss_pred             EeccCCcccccCCcccCc-CCCCEEEccCCcCCccCCcCcCCCCCCCEEEccCCCCCCCCcccCcCCCCcCEEEcccCcC
Q 037720          258 LNLDFNRFSGVIPASLLT-SGVNNLNLSKNSLEGKIPDAFGPKSYFMVLDLSYNKLSGPIPRTLSGTSYIGYLDLSHNNL  336 (369)
Q Consensus       258 L~L~~n~l~~~~~~~~~~-~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~ls~N~l  336 (369)
                      +++..+.+.+.+|..+.. +.++.+++++|.+.+.++ .+..+++|+.|++++|+++|.+|+.++++++|++|+|++|+|
T Consensus       202 l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l  280 (313)
T d1ogqa_         202 VDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNL  280 (313)
T ss_dssp             EECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEE
T ss_pred             ccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcc
Confidence            666666666666555544 667777777777765554 577788999999999999999999999999999999999999


Q ss_pred             ceeCCCCCCCCCCCcccccCCCCccCCCCCCCC
Q 037720          337 CGKIPAGSPFDHLDASSFESNKCLCGKPLLNAC  369 (369)
Q Consensus       337 ~g~ip~~~~~~~l~~l~~~~n~~~c~~~~~~~c  369 (369)
                      +|.+|....+.+|+.+++.+|+.+||.|+ +.|
T Consensus       281 ~g~iP~~~~L~~L~~l~l~~N~~l~g~pl-p~c  312 (313)
T d1ogqa_         281 CGEIPQGGNLQRFDVSAYANNKCLCGSPL-PAC  312 (313)
T ss_dssp             EEECCCSTTGGGSCGGGTCSSSEEESTTS-SCC
T ss_pred             cccCCCcccCCCCCHHHhCCCccccCCCC-CCC
Confidence            99999988889999999999999999876 566
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure