Citrus Sinensis ID: 037786


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-----
VMEALVQNVTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLFEEEFSSKV
ccHHHHcccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEcccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHccccccccEEEccccEEEEEccccccccccEEEcccccccccccHHHHccccccEEcccccccEEEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHcccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHcccccEEEccccccccccccccccccccccccccccccEEEcccccccccc
cccHHHccccccEEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEcccccccccccccccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccEEEcccccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEcEEEcccccccccccHHHHHcccccEEEEccccccccccHHccccccEEEEEccccccccccHHHHHcccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHccccccEEEEccccccccccEEEEcccccccccccHHcccccEEEcccccccccccHHHccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHccccc
VMEALVQNVTKLQLLFLDYvdmstvvpgtLKNLSSSLTSLSlsycriqgefpenifRLSNLQMVRLKFNsnlsgvfprsnwtsplrcldvsgtrfsgqlpdsicnLRHLRELHLSQcnfygflpaslgnvTQLAVLSLSFKsfsghippslsnlhqltdvdlgsnsfdgqfpdimnltrisrldisnnqltgsipshgsglqNLAVLRLYNNtlsgtipswlftlpllrdidlsdnqltghldafpskslrKLYLTnnrlhgsipssIFELANLTYLSLasnnfsgivEPYMLAKLVNLAALElshnslsfgttskvnssfPQIFILSLSACNISAFPSFLRSLELAYLdlsennidgqipnwmwevgKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNllqgplpvppprlqFLLASNNQFTGEIIQSIcssstleipsWISEIGKDSLSYLNLSHNFITKMKQISWKNlgyldlrsnllqgpllvppsslRVILILNNQFTGEIIHSICDIIALdvldlsnnrlsgtipkcignfspwcqtkwpsrwsatTLFEEEFSSKV
VMEALVQNVTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSgvfprsnwtsPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLFEEEFSSKV
VMEALVQNVTKLQLLFLDYVDMSTVVPGTLKNlsssltslslsYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLFEEEFSSKV
****LVQNVTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLF********
VMEALVQNVTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLFEEEFSS*V
VMEALVQNVTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLFEEEFSSKV
VMEALVQNVTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLFEEEFSSK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VMEALVQNVTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKWPSRWSATTLFEEEFSSKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query565 2.2.26 [Sep-21-2011]
O49545 1003 Leucine-rich repeat recep no no 0.865 0.487 0.337 1e-44
Q9C9H7847 Receptor-like protein 12 no no 0.929 0.619 0.289 1e-44
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.863 0.487 0.332 9e-44
C0LGQ5 1249 LRR receptor-like serine/ no no 0.927 0.419 0.317 8e-43
Q9LVP0 1102 Probable leucine-rich rep no no 0.872 0.447 0.319 7e-42
Q9FL28 1173 LRR receptor-like serine/ no no 0.899 0.433 0.319 7e-42
O65440 992 Leucine-rich repeat recep no no 0.916 0.522 0.311 9e-41
O49318 1124 Probable leucine-rich rep no no 0.915 0.459 0.310 3e-40
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.925 0.417 0.300 1e-39
O82318 960 Probably inactive leucine no no 0.849 0.5 0.323 2e-39
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 180/533 (33%), Positives = 260/533 (48%), Gaps = 44/533 (8%)

Query: 37  LTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPR--SNWTSPLRCLDVSGTR 94
           L +LSL+   I G  P  I  LS L+ + L  N+  +G FP   S+    LR LDV    
Sbjct: 95  LQNLSLAENLISGPIPPEISSLSGLRHLNLS-NNVFNGSFPDEISSGLVNLRVLDVYNNN 153

Query: 95  FSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNL 154
            +G LP S+ NL  LR LHL    F G +P S G+   +  L++S     G IPP + NL
Sbjct: 154 LTGDLPVSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNL 213

Query: 155 HQLTDVDLG-SNSF-DGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNN 212
             L ++ +G  N+F DG  P+I NL+ + R D +N  LTG IP     LQ L  L L  N
Sbjct: 214 TTLRELYIGYYNAFEDGLPPEIGNLSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVN 273

Query: 213 TLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDA-FPS-KSLRKLYLTNNRLHGSIPSSIFE 270
             SG +   L TL  L+ +DLS+N  TG + A F   K+L  L L  N+LHG IP  I +
Sbjct: 274 VFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGD 333

Query: 271 LANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLS 330
           L  L  L L  NNF+G + P  L +   L  ++LS N L+      + S      +++L 
Sbjct: 334 LPELEVLQLWENNFTGSI-PQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLG 392

Query: 331 ACNISAFPSFLRSLE-LAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQIP 389
                + P  L   E L  + + EN ++G IP  ++ + K  L+ ++L  N+++   ++P
Sbjct: 393 NFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPK--LTQVELQDNYLS--GELP 448

Query: 390 WK-----NLKYLKLQSNLLQGPLPVPPPR---LQFLLASNNQFTGEIIQSICSSSTLEIP 441
                  NL  + L +N L GPLP        +Q LL   N+F G I             
Sbjct: 449 VAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFQGPI------------- 495

Query: 442 SWISEIGK-DSLSYLNLSHNFITK--MKQIS-WKNLGYLDLRSNLLQGPLLVPPSSLRVI 497
              SE+GK   LS ++ SHN  +     +IS  K L ++DL  N L G +    ++++++
Sbjct: 496 --PSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITAMKIL 553

Query: 498 LILN---NQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKW 547
             LN   N   G I  SI  + +L  LD S N LSG +P   G FS +  T +
Sbjct: 554 NYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSF 605




Necessary for male gametophyte development, as well as ovule specification and function. Involved in cell-cell communication process required during early anther development, and regulating cell division and differentiation to organize cell layers. Required for the development of high-ordered vascular strands within the leaf and a correlated control of leaf shape, size and symmetry. May regulate the CLV1-dependent CLV3-mediated signaling in meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query565
356551688 1135 PREDICTED: receptor-like protein 12-like 0.952 0.474 0.427 1e-108
225462116 1001 PREDICTED: receptor-like protein 12-like 0.872 0.492 0.418 4e-96
224116970 921 predicted protein [Populus trichocarpa] 0.904 0.554 0.438 8e-90
357493471 1109 Receptor-like protein kinase [Medicago t 0.861 0.439 0.398 2e-88
357493485 1060 Receptor-like protein kinase [Medicago t 0.854 0.455 0.399 6e-88
225459979 979 PREDICTED: receptor-like protein 12-like 0.886 0.511 0.412 7e-86
357493407 994 Receptor-like protein kinase [Medicago t 0.879 0.5 0.400 2e-85
359493539 1001 PREDICTED: receptor-like protein 12-like 0.874 0.493 0.405 3e-85
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.890 0.500 0.401 6e-85
359493546 985 PREDICTED: LRR receptor-like serine/thre 0.874 0.501 0.390 5e-84
>gi|356551688|ref|XP_003544206.1| PREDICTED: receptor-like protein 12-like [Glycine max] Back     alignment and taxonomy information
 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 246/575 (42%), Positives = 349/575 (60%), Gaps = 37/575 (6%)

Query: 1   VMEALVQNVTKLQLLFLDYVDMSTVVPGTLK---NLSSSLTSLSLSYCRIQGEFPENIFR 57
            +E ++ N T ++ L LD+++MST+ P +L    N SSSL SLSL    +QG+   NI  
Sbjct: 176 TLENVIVNATDIRELTLDFLNMSTIEPSSLSLLVNFSSSLVSLSLRDTGLQGKLANNILC 235

Query: 58  LSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQC 117
           L NLQ + L  N +L G  P  N ++PLR LD+S T FSG+LP++I +L  L  L    C
Sbjct: 236 LPNLQKLDLSVNLDLQGELPEFNRSTPLRYLDLSYTGFSGKLPNTINHLESLNYLSFESC 295

Query: 118 NFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMN- 176
           +F G +P  L N+ QL  L L   +FSG IP SLSNL  LT +DL  N+F G+ PD+ + 
Sbjct: 296 DFGGPIPVFLSNLMQLKHLDLGGNNFSGEIPSSLSNLKHLTFLDLSVNNFGGEIPDMFDK 355

Query: 177 ------------------------LTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNN 212
                                   LT++S LD S N+L G +P   SGL NL  L L  N
Sbjct: 356 LSKIEYLCISGNNLVGQLPSSLFGLTQLSDLDCSYNKLVGPMPDKISGLSNLCSLDLSTN 415

Query: 213 TLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELA 272
           +++GTIP W F+L  L  + L  NQLTG +  F S SL    L+ N+L G+IP+S+F L 
Sbjct: 416 SMNGTIPHWCFSLSSLIQLSLHGNQLTGSIGEFSSFSLYYCDLSYNKLQGNIPNSMFHLQ 475

Query: 273 NLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNS---LSFGTTSKVNSSFPQIFILSL 329
           NLT+LSL+SNN +G V+ +  + +  L  L+LS N+   LSF  T   + +F  +  L L
Sbjct: 476 NLTWLSLSSNNLTGHVDFHKFSNMQFLEILDLSDNNFLYLSFNNTEG-DYNFLNLQYLYL 534

Query: 330 SACNISAFPSFLRSLE-LAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMK-- 386
           S+CNI++FP  L  L+ L  LDLS N I G+IP W    GKDTLSFLDLSHN +T +   
Sbjct: 535 SSCNINSFPKLLSGLKYLNSLDLSRNQIHGKIPKWFNSTGKDTLSFLDLSHNLLTSVGYL 594

Query: 387 QIPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISE 446
            + W  ++Y+ L  N+LQG +PVPP  +++   SNN+ TG I  +IC++S+L+IP W + 
Sbjct: 595 SLSWATMQYIDLSFNMLQGDIPVPPSGIEYFSVSNNKLTGRISSTICNASSLQIPKWFNS 654

Query: 447 IGKDSLSYLNLSHNFITKMK--QISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILNNQF 504
            GKD+LS+L+LSHN +T +    +SW  + Y+DL  N+LQG + VPPS +    + NN+ 
Sbjct: 655 TGKDTLSFLDLSHNLLTSVGYLSLSWATMQYIDLSFNMLQGDIPVPPSGIEYFSVSNNKL 714

Query: 505 TGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNF 539
           TG I  +IC+  +L +L+LS+N L+G +P+C+G F
Sbjct: 715 TGRISSTICNASSLQILNLSHNNLTGKLPQCLGTF 749




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357493471|ref|XP_003617024.1| Receptor-like protein kinase [Medicago truncatula] gi|355518359|gb|AES99982.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357493485|ref|XP_003617031.1| Receptor-like protein kinase [Medicago truncatula] gi|355518366|gb|AES99989.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357493407|ref|XP_003616992.1| Receptor-like protein kinase [Medicago truncatula] gi|355518327|gb|AES99950.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query565
TAIR|locus:2046357 890 RLP23 "receptor like protein 2 0.858 0.544 0.336 2.8e-54
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.815 0.481 0.352 2e-53
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.893 0.564 0.345 2.2e-53
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.895 0.514 0.320 5.8e-52
TAIR|locus:2119445 719 AT4G13820 [Arabidopsis thalian 0.771 0.606 0.339 8.9e-51
TAIR|locus:2169965 1003 BAM1 "BARELY ANY MERISTEM 1" [ 0.835 0.470 0.344 6.7e-49
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.902 0.540 0.337 6.8e-49
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.812 0.524 0.339 1e-48
TAIR|locus:2129246 891 RLP50 "receptor like protein 5 0.847 0.537 0.318 1.1e-47
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.835 0.663 0.326 1.3e-47
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 566 (204.3 bits), Expect = 2.8e-54, P = 2.8e-54
 Identities = 178/529 (33%), Positives = 268/529 (50%)

Query:    28 GTLKNXXXXXXXXXXXYCRIQGE------FPENIFRLSNLQMVRLKFNSNLSGVFPRS-- 79
             GTLK+           Y  +Q         P     L  L+ + L  N  L G  P S  
Sbjct:    86 GTLKSNSSLFGFHQLRYVDLQNNNLTSSSLPSGFGNLKRLEGLFLSSNGFL-GQVPSSFS 144

Query:    80 NWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFL-P-ASLGNVTQLAVLS 137
             N T  L  LD+S  + +G  P  +  LR L  L LS  +F G L P +SL  + QL  L+
Sbjct:   145 NLTM-LAQLDLSYNKLTGSFP-LVRGLRKLIVLDLSYNHFSGTLNPNSSLFELHQLRYLN 202

Query:   138 LSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPD-IMNLTRISRLDISNNQLTGSIPS 196
             L+F +FS  +P    NLH+L ++ L SN F GQ P  I NLTR+++L +  N+LT S P 
Sbjct:   203 LAFNNFSSSLPSKFGNLHRLENLILSSNGFSGQVPSTISNLTRLTKLYLDQNKLTSSFPL 262

Query:   197 HGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKL--- 253
                 L NL  L L  N   G IPS L TLP L  + L +N L G ++   S +  +L   
Sbjct:   263 V-QNLTNLYELDLSYNKFFGVIPSSLLTLPFLAHLALRENNLAGSVEVSNSSTSSRLEIM 321

Query:   254 YLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGT 313
             YL +N   G I   I +L NL +L L+  N S  ++  + + L +L +L+LS NS+S  +
Sbjct:   322 YLGSNHFEGQILEPISKLINLKHLDLSFLNTSYPIDLKLFSSLKSLRSLDLSGNSISSAS 381

Query:   314 TSKVNSSFP-QIFILSLSACNISAFPSFLRSL-ELAYLDLSENNIDGQIPNWMWEVGKDT 371
              S  +S  P  + +L+L  C+I+ FP+ L++L EL Y+D+S N + G+IP W+W +    
Sbjct:   382 LSS-DSYIPLTLEMLTLRHCDINEFPNILKTLKELVYIDISNNRMKGKIPEWLWSL--PL 438

Query:   372 LSFLDLSHNFITEMKQ----IPWKNLKYLKLQSNLLQGPLPVPPPRLQFLLASNNQFTGE 427
             L  + L +N+ T  +     +   ++  L L SN  +G LP  P  ++    ++N FT E
Sbjct:   439 LQSVTLGNNYFTGFQGSAEILVNSSVLLLYLDSNNFEGALPDLPLSIKGFGVASNSFTSE 498

Query:   428 IIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPL 487
             I  SIC+ S              SL+ ++LS+N  T       +NL  + LR+N L+G +
Sbjct:   499 IPLSICNRS--------------SLAAIDLSYNNFTGPIPPCLRNLELVYLRNNNLEGSI 544

Query:   488 ---LVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIP 533
                L   +SLR + + +N+ TG++  S  +  +L  L + NNR+  T P
Sbjct:   545 PDALCDGASLRTLDVSHNRLTGKLPRSFVNCSSLKFLSVINNRIEDTFP 593


GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169965 BAM1 "BARELY ANY MERISTEM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query565
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-28
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-26
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
PLN032101153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  187 bits (476), Expect = 1e-50
 Identities = 176/556 (31%), Positives = 246/556 (44%), Gaps = 93/556 (16%)

Query: 28  GTLKNLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFP---------- 77
           G   N SS + S+ LS   I G+    IFRL  +Q + L  N+ LSG  P          
Sbjct: 62  GITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLS-NNQLSGPIPDDIFTTSSSL 120

Query: 78  ------RSNWTSP--------LRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFL 123
                  +N+T          L  LD+S    SG++P+ I +   L+ L L      G +
Sbjct: 121 RYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKI 180

Query: 124 PASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFP-DIMNLTRISR 182
           P SL N+T L  L+L+     G IP  L  +  L  + LG N+  G+ P +I  LT ++ 
Sbjct: 181 PNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNH 240

Query: 183 LDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHL 242
           LD+  N LTG IPS    L+NL  L LY N LSG IP  +F+L  L  +DLSDN L+G +
Sbjct: 241 LDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEI 300

Query: 243 DAFPS--KSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLA 300
                  ++L  L+L +N   G IP ++  L  L  L L SN FSG + P  L K  NL 
Sbjct: 301 PELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI-PKNLGKHNNLT 359

Query: 301 ALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQI 360
            L+LS N+L+           P+        C+         S  L  L L  N+++G+I
Sbjct: 360 VLDLSTNNLT--------GEIPE------GLCS---------SGNLFKLILFSNSLEGEI 396

Query: 361 PNWMWEVGKDTLSFLDLSHNFITEMKQIPWKNLKYLKLQSNLLQGPLPVPPPRLQ---FL 417
           P               L             ++L+ ++LQ N   G LP    +L    FL
Sbjct: 397 PK-------------SLG----------ACRSLRRVRLQDNSFSGELPSEFTKLPLVYFL 433

Query: 418 LASNNQFTGEIIQSICSSSTLEIPSWI---------SEIGKDSLSYLNLSHNFITKM--- 465
             SNN   G I        +L++ S              G   L  L+LS N  +     
Sbjct: 434 DISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPR 493

Query: 466 KQISWKNLGYLDLRSNLLQGPLLVPPSSLRVILILN---NQFTGEIIHSICDIIALDVLD 522
           K  S   L  L L  N L G +    SS + ++ L+   NQ +G+I  S  ++  L  LD
Sbjct: 494 KLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLD 553

Query: 523 LSNNRLSGTIPKCIGN 538
           LS N+LSG IPK +GN
Sbjct: 554 LSQNQLSGEIPKNLGN 569


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 565
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.5
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.04
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.85
PLN03150623 hypothetical protein; Provisional 98.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
KOG4341483 consensus F-box protein containing LRR [General fu 98.67
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.64
PLN03150623 hypothetical protein; Provisional 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.47
KOG4341483 consensus F-box protein containing LRR [General fu 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.41
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.34
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.33
PRK15386 426 type III secretion protein GogB; Provisional 98.3
PRK15386 426 type III secretion protein GogB; Provisional 98.28
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.77
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.73
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.7
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.59
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.11
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.03
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.01
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.2
KOG4308478 consensus LRR-containing protein [Function unknown 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.37
KOG4308 478 consensus LRR-containing protein [Function unknown 94.98
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.27
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.55
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.03
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.54
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.77
smart0037026 LRR Leucine-rich repeats, outliers. 90.77
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.16
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.33
smart0037026 LRR Leucine-rich repeats, outliers. 87.33
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.94
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.04
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.6e-52  Score=462.37  Aligned_cols=506  Identities=32%  Similarity=0.475  Sum_probs=449.2

Q ss_pred             CCCCcEEEcCCCcCCCCCchhhhhcCCCccEEEccCCcccccCCcccc-CCCCCCEEecCCCCCCCccCCCCCCCCCCcE
Q 037786            9 VTKLQLLFLDYVDMSTVVPGTLKNLSSSLTSLSLSYCRIQGEFPENIF-RLSNLQMVRLKFNSNLSGVFPRSNWTSPLRC   87 (565)
Q Consensus         9 ~~~L~~L~l~~~~~~~~~~~~~~~l~~~L~~L~l~~~~i~~~~~~~~~-~l~~L~~L~L~~~~~~~~~~~~~~~~~~L~~   87 (565)
                      ..+++.|+++++.+.+..+..+..+ ++|++|++++|++.+.+|..+. .+++|++|++++| ...+..+. ...++|++
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l-~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n-~l~~~~p~-~~l~~L~~  144 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRL-PYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNN-NFTGSIPR-GSIPNLET  144 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCC-CCCCEEECCCCccCCcCChHHhccCCCCCEEECcCC-ccccccCc-cccCCCCE
Confidence            3578999999999988888889888 9999999999999877776654 8999999999999 56555543 34589999


Q ss_pred             EEccCCccCccCCccccCCCCCCEEEcccccCcccCchhccCCCCCCeeeccCCcccccCCcCccCCCCCCEEEccCccc
Q 037786           88 LDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSF  167 (565)
Q Consensus        88 L~l~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~  167 (565)
                      |++++|.+.+..|..+.++++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+..+++|+.|++++|.+
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l  224 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNL  224 (968)
T ss_pred             EECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCcc
Confidence            99999999988999999999999999999999888999999999999999999999988999999999999999999998


Q ss_pred             cccCcC-CcCCCCCCEEeccCCcccccCCCCCcCCCCCCEEEcccccccCCCchhhcCCCCCCEEEccCCcccccCCCC-
Q 037786          168 DGQFPD-IMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAF-  245 (565)
Q Consensus       168 ~~~~~~-~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~-  245 (565)
                      .+..+. ++.+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..+.. 
T Consensus       225 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~  304 (968)
T PLN00113        225 SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELV  304 (968)
T ss_pred             CCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhH
Confidence            865554 899999999999999999889999999999999999999998888888999999999999999988665543 


Q ss_pred             -CCCCCcEEEccCCccccCCchhhhcCCCcCccccccccccCccChHhhhcCCCCCEEEccCCccccccCCcccCCCCCc
Q 037786          246 -PSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQI  324 (565)
Q Consensus       246 -~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L  324 (565)
                       ..++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..+ ..+..+++|+.|++++|++....+..+ ..++++
T Consensus       305 ~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p-~~l~~~~~L~~L~Ls~n~l~~~~p~~~-~~~~~L  382 (968)
T PLN00113        305 IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIP-KNLGKHNNLTVLDLSTNNLTGEIPEGL-CSSGNL  382 (968)
T ss_pred             cCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCC-hHHhCCCCCcEEECCCCeeEeeCChhH-hCcCCC
Confidence             67899999999999998889999999999999999999986655 568889999999999999987666555 567899


Q ss_pred             cEEEcCCCCCC-CCCchhhcc-ccceEeccCCcCcccCChhhhhhCCCCccEEEcCCCccCCccCC---CCCCCCeEEcC
Q 037786          325 FILSLSACNIS-AFPSFLRSL-ELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFITEMKQI---PWKNLKYLKLQ  399 (565)
Q Consensus       325 ~~L~l~~~~l~-~l~~~~~~~-~L~~L~l~~n~l~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~---~~~~L~~L~l~  399 (565)
                      +.|++++|.+. .+|..+... +|+.|++++|++++..|..+.  .++.|+.|++++|.++...+.   .+++|+.|+++
T Consensus       383 ~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~--~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~  460 (968)
T PLN00113        383 FKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFT--KLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLA  460 (968)
T ss_pred             CEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHh--cCCCCCEEECcCCcccCccChhhccCCCCcEEECc
Confidence            99999999987 566555544 999999999999988887765  679999999999999887663   67899999999


Q ss_pred             CCcccccCCCC--CCCCcEEEccccccCccchhhhhhcCCCCCCccccccCCCCCcEEeCcCCCCCCC-cc--cCCCccc
Q 037786          400 SNLLQGPLPVP--PPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHNFITKM-KQ--ISWKNLG  474 (565)
Q Consensus       400 ~n~~~~~~~~~--~~~L~~L~l~~n~i~~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~-~~--~~~~~L~  474 (565)
                      +|++.+..|..  .++|++|++++|++++..+..+..+              +.|++|++++|.+.+. |.  ..+++|+
T Consensus       461 ~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l--------------~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  526 (968)
T PLN00113        461 RNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSL--------------SELMQLKLSENKLSGEIPDELSSCKKLV  526 (968)
T ss_pred             CceeeeecCcccccccceEEECcCCccCCccChhhhhh--------------hccCEEECcCCcceeeCChHHcCccCCC
Confidence            99998877765  6889999999999999999888888              9999999999999977 65  7789999


Q ss_pred             EEECCCCcccccCCC---CCCCCcEeeccCceeeeccchhhhcCCCCCEEeCCCCcCcccCCCC
Q 037786          475 YLDLRSNLLQGPLLV---PPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKC  535 (565)
Q Consensus       475 ~L~ls~n~l~~~~~~---~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~p~~  535 (565)
                      .|++++|.+++.+|.   .+++|++||+++|.+++.+|..+..+++|+.|++++|++.+.+|+.
T Consensus       527 ~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~  590 (968)
T PLN00113        527 SLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST  590 (968)
T ss_pred             EEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCc
Confidence            999999999987776   7899999999999999999999999999999999999999988865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query565
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-30
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-17
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-30
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-09
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-07
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 7e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 8e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 1e-04
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 3e-04
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 6e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 8e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 130 bits (327), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 170/513 (33%), Positives = 238/513 (46%), Gaps = 69/513 (13%) Query: 58 LSNLQMVRLKFNSNLSGVFPR--SNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLS 115 L +LQ + L N +G P S L LD+SG F G +P + L L LS Sbjct: 265 LKSLQYLSLAENK-FTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALS 323 Query: 116 QCNFYGFLPA-SLGNVTQLAVLSLSFKSFSGHIPPSLSNLH-QLTDVDLGSNSFDGQFPD 173 NF G LP +L + L VL LSF FSG +P SL+NL L +DL SN+F G P Sbjct: 324 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG--PI 381 Query: 174 IMNLTR-----ISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNTLSGTIPSWLFTLPLL 228 + NL + + L + NN TG IP S L L L N LSGTIPS L +L L Sbjct: 382 LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 441 Query: 229 RDIDLSDNQLTGHL--DAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSG 286 RD+ L N L G + + K+L L L N L G IPS + NL ++SL++N +G Sbjct: 442 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTG 501 Query: 287 IVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLEL 346 + P + +L NLA L+LS+NS S NI A RSL Sbjct: 502 EI-PKWIGRLENLAILKLSNNSFS---------------------GNIPAELGDCRSL-- 537 Query: 347 AYLDLSENNIDGQIPNWMW-EVGKDTLSFLDLSHNFITEMKQIPWKN---LKYLKLQSNL 402 +LDL+ N +G IP M+ + GK ++ NFI + + KN K NL Sbjct: 538 IWLDLNTNLFNGTIPAAMFKQSGK-------IAANFIAGKRYVYIKNDGMKKECHGAGNL 590 Query: 403 L--QGPLPVPPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISEIGKDSLSYLNLSHN 460 L QG + +L L N + +S T + S+ +L++S+N Sbjct: 591 LEFQG---IRSEQLNRLSTRNPCNITSRVYGGHTSPTFD--------NNGSMMFLDMSYN 639 Query: 461 FITKM--KQI-SWKNLGYLDLRSNLLQGPLLVPPSSLRVILILN---NQFTGEIIHSICD 514 ++ K+I S L L+L N + G + LR + IL+ N+ G I ++ Sbjct: 640 MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSA 699 Query: 515 IIALDVLDLSNNRLSGTIPKCIGNFSPWCQTKW 547 + L +DLSNN LSG IP+ +G F + K+ Sbjct: 700 LTMLTEIDLSNNNLSGPIPE-MGQFETFPPAKF 731
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query565
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-99
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-78
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-77
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-67
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-50
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-49
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-57
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-49
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-40
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-28
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-34
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-14
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  317 bits (815), Expect = 2e-99
 Identities = 141/538 (26%), Positives = 209/538 (38%), Gaps = 79/538 (14%)

Query: 34  SSSLTSLSLSYCRIQ---GEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDV 90
              +TS+ LS   +         ++  L+ L+ + L  + +++G       ++ L  LD+
Sbjct: 49  DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNS-HINGSVSGFKCSASLTSLDL 107

Query: 91  SGTRFSGQLPD--SICNLRHLRELHLSQCNFYGFLPASLG-NVTQLAVLSLSFKSFSGHI 147
           S    SG +    S+ +   L+ L++S          S G  +  L VL LS  S SG  
Sbjct: 108 SRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGAN 167

Query: 148 PPSL---SNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNL 204
                      +L  + +  N   G    +     +  LD+S+N  +  IP  G     L
Sbjct: 168 VVGWVLSDGCGELKHLAISGNKISGDVD-VSRCVNLEFLDVSSNNFSTGIPFLGD-CSAL 225

Query: 205 AVLRLYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSI 264
             L +  N LSG     + T   L+ +++S NQ  G +   P KSL+ L L  N+  G I
Sbjct: 226 QHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEI 285

Query: 265 PSSIF-ELANLTYLSLASNNFSGIVEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQ 323
           P  +      LT L L+ N+F G V P        L +L LS N+ S           P 
Sbjct: 286 PDFLSGACDTLTGLDLSGNHFYGAV-PPFFGSCSLLESLALSSNNFS--------GELPM 336

Query: 324 IFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVGKDTLSFLDLSHNFIT 383
             +L +                L  LDLS N   G++P  +  +   +L  LDLS N  +
Sbjct: 337 DTLLKMR--------------GLKVLDLSFNEFSGELPESLTNL-SASLLTLDLSSNNFS 381

Query: 384 -----EMKQIPWKNLKYLKLQSNLLQGPLPVPP---PRLQFLLASNNQFTGEIIQSICSS 435
                 + Q P   L+ L LQ+N   G +P        L  L  S N  +G I  S+ S 
Sbjct: 382 GPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 441

Query: 436 STLEIPSWISEIGKDSLSYLNLSHN--------FITKMKQISWKNLGYLDLRSNLLQGPL 487
           S               L  L L  N         +  +     K L  L L  N L G +
Sbjct: 442 S--------------KLRDLKLWLNMLEGEIPQELMYV-----KTLETLILDFNDLTGEI 482

Query: 488 LVPPS-----SLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKCIGNFS 540
             P       +L  I + NN+ TGEI   I  +  L +L LSNN  SG IP  +G+  
Sbjct: 483 --PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCR 538


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query565
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.48
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.47
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.43
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.09
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.98
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.64
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.17
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.21
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1e-57  Score=494.03  Aligned_cols=522  Identities=27%  Similarity=0.356  Sum_probs=279.6

Q ss_pred             HhhCCCCCcEEEcCCCcCCCCCch--hhhhcCCCccEEEccCCcccccCCccc-cCCCCCCEEecCCCCCCCccCCC---
Q 037786            5 LVQNVTKLQLLFLDYVDMSTVVPG--TLKNLSSSLTSLSLSYCRIQGEFPENI-FRLSNLQMVRLKFNSNLSGVFPR---   78 (565)
Q Consensus         5 ~~~~~~~L~~L~l~~~~~~~~~~~--~~~~l~~~L~~L~l~~~~i~~~~~~~~-~~l~~L~~L~L~~~~~~~~~~~~---   78 (565)
                      .|+++++|++|++++|.+.+..+.  .++.+ ++|++|++++|.+++..+..+ .++++|++|++++| .+.+..+.   
T Consensus        95 ~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l-~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n-~l~~~~~~~~~  172 (768)
T 3rgz_A           95 GFKCSASLTSLDLSRNSLSGPVTTLTSLGSC-SGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSAN-SISGANVVGWV  172 (768)
T ss_dssp             CCCCCTTCCEEECCSSEEEEEGGGGGGGGGC-TTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSS-CCEEETHHHHH
T ss_pred             hhccCCCCCEEECCCCcCCCcCCChHHHhCC-CCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCC-ccCCcCChhhh
Confidence            466777777777777777665555  66666 777777777777765555544 56677777777666 33332221   


Q ss_pred             -CCCCCCCcEEEccCCccCccCCccccCCCCCCEEEcccccCcccCchhccCCCCCCeeeccCCcccccCCcCccCCCCC
Q 037786           79 -SNWTSPLRCLDVSGTRFSGQLPDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPSLSNLHQL  157 (565)
Q Consensus        79 -~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L  157 (565)
                       ...+++|++|++++|.+.+..+  +..+++|++|++++|.+.+..+. +.++++|++|++++|.+.+..|..+..+++|
T Consensus       173 ~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L  249 (768)
T 3rgz_A          173 LSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTEL  249 (768)
T ss_dssp             HTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSC
T ss_pred             hhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCC
Confidence             2222444444444444433222  23444444444444444433333 4444444444444444444444444444444


Q ss_pred             CEEEccCccccccCcC-----------------------CcC-CCCCCEEeccCCcccccCCCCCcCCCCCCEEEccccc
Q 037786          158 TDVDLGSNSFDGQFPD-----------------------IMN-LTRISRLDISNNQLTGSIPSHGSGLQNLAVLRLYNNT  213 (565)
Q Consensus       158 ~~L~l~~~~~~~~~~~-----------------------~~~-~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~  213 (565)
                      ++|++++|.+.+..+.                       +.. +++|++|++++|.+.+..|..+..+++|++|++++|.
T Consensus       250 ~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~  329 (768)
T 3rgz_A          250 KLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN  329 (768)
T ss_dssp             CEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSE
T ss_pred             CEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCc
Confidence            4444444444332222                       222 2445555555555444444444445555555555554


Q ss_pred             ccCCCch-hhcCCCCCCEEEccCCcccccCCCC--CCC-CCcEEEccCCccccCCchhhhc--CCCcCccccccccccCc
Q 037786          214 LSGTIPS-WLFTLPLLRDIDLSDNQLTGHLDAF--PSK-SLRKLYLTNNRLHGSIPSSIFE--LANLTYLSLASNNFSGI  287 (565)
Q Consensus       214 l~~~~~~-~l~~~~~L~~L~l~~~~~~~~~~~~--~~~-~L~~L~l~~~~~~~~~~~~~~~--~~~L~~L~l~~n~~~~~  287 (565)
                      +.+..+. .+..+++|++|++++|.+.+..+..  ..+ +|+.|++++|.+++..+..+..  +++|++|++++|.+.+.
T Consensus       330 l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~  409 (768)
T 3rgz_A          330 FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK  409 (768)
T ss_dssp             EEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEE
T ss_pred             ccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccc
Confidence            4433332 2444555555555555444322222  112 4555555555555444444433  45556666666655543


Q ss_pred             cChHhhhcCCCCCEEEccCCccccccCCcccCCCCCccEEEcCCCCCC-CCCchhhcc-ccceEeccCCcCcccCChhhh
Q 037786          288 VEPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNIS-AFPSFLRSL-ELAYLDLSENNIDGQIPNWMW  365 (565)
Q Consensus       288 ~~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~~~l~-~l~~~~~~~-~L~~L~l~~n~l~~~~~~~~~  365 (565)
                      ++ ..+..+++|++|++++|.+++..+..+ ..+++|+.|++++|.+. .+|..+... +|+.|++++|++++.+|..+.
T Consensus       410 ~p-~~l~~l~~L~~L~Ls~N~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~  487 (768)
T 3rgz_A          410 IP-PTLSNCSELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS  487 (768)
T ss_dssp             CC-GGGGGCTTCCEEECCSSEEESCCCGGG-GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG
T ss_pred             cC-HHHhcCCCCCEEECcCCcccCcccHHH-hcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHh
Confidence            33 345666666666666666655444443 55666666666666665 444444333 666666666666666666554


Q ss_pred             hhCCCCccEEEcCCCccCCccCC---CCCCCCeEEcCCCcccccCCCC---CCCCcEEEccccccCccchhhhhhcCCCC
Q 037786          366 EVGKDTLSFLDLSHNFITEMKQI---PWKNLKYLKLQSNLLQGPLPVP---PPRLQFLLASNNQFTGEIIQSICSSSTLE  439 (565)
Q Consensus       366 ~~~~~~L~~L~ls~n~l~~~~~~---~~~~L~~L~l~~n~~~~~~~~~---~~~L~~L~l~~n~i~~~~~~~l~~~~~~~  439 (565)
                        .+++|+.|++++|+++...+.   .+++|++|++++|++.+..|..   +++|++|++++|++++.+|..+.......
T Consensus       488 --~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~  565 (768)
T 3rgz_A          488 --NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKI  565 (768)
T ss_dssp             --GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCB
T ss_pred             --cCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchh
Confidence              456666666666666644332   4566666666666666655543   56666677777766666666554321110


Q ss_pred             CCcc----------------------------------c----------------------cccCCCCCcEEeCcCCCCC
Q 037786          440 IPSW----------------------------------I----------------------SEIGKDSLSYLNLSHNFIT  463 (565)
Q Consensus       440 ~~~~----------------------------------~----------------------~~~~~~~L~~L~l~~n~l~  463 (565)
                      ....                                  .                      ....++.|+.|++++|+++
T Consensus       566 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~  645 (768)
T 3rgz_A          566 AANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS  645 (768)
T ss_dssp             CCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCB
T ss_pred             hhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCccc
Confidence            0000                                  0                      0001245566666666666


Q ss_pred             CC-cc--cCCCcccEEECCCCcccccCCC---CCCCCcEeeccCceeeeccchhhhcCCCCCEEeCCCCcCcccCCCC
Q 037786          464 KM-KQ--ISWKNLGYLDLRSNLLQGPLLV---PPSSLRVILILNNQFTGEIIHSICDIIALDVLDLSNNRLSGTIPKC  535 (565)
Q Consensus       464 ~~-~~--~~~~~L~~L~ls~n~l~~~~~~---~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~p~~  535 (565)
                      +. |.  +.+++|+.|++++|.+++.+|.   .+++|++||+++|++++.+|..++.+++|++|++++|++.+.+|+.
T Consensus       646 g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          646 GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS
T ss_pred             ccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            55 43  5556666666666666665554   5566666666666666666666666666666666666666666544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 565
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 80.2 bits (196), Expect = 3e-17
 Identities = 57/258 (22%), Positives = 90/258 (34%), Gaps = 6/258 (2%)

Query: 32  NLSSSLTSLSLSYCRIQGEFPENIFRLSNLQMVRLKFNSNLSGVFPRSNWTSPLRCLDVS 91
            + ++   + L   RI      +     NL ++ L  N             + L  LD+S
Sbjct: 29  GIPAASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLS 88

Query: 92  GTRFSGQL-PDSICNLRHLRELHLSQCNFYGFLPASLGNVTQLAVLSLSFKSFSGHIPPS 150
                  + P +   L  L  LHL +C      P     +  L  L L   +       +
Sbjct: 89  DNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDT 148

Query: 151 LSNLHQLTDVDLGSNSFDGQFPD-IMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLRL 209
             +L  LT + L  N            L  + RL +  N++    P     L  L  L L
Sbjct: 149 FRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYL 208

Query: 210 YNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFP-SKSLRKLYLTNNRLHGSIPSSI 268
           + N LS      L  L  L+ + L+DN       A P    L+K   +++ +  S+P   
Sbjct: 209 FANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQR- 267

Query: 269 FELANLTYLSLASNNFSG 286
             LA      LA+N+  G
Sbjct: 268 --LAGRDLKRLAANDLQG 283


>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query565
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.24
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.11
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.95  E-value=6.9e-26  Score=223.31  Aligned_cols=338  Identities=23%  Similarity=0.269  Sum_probs=166.5

Q ss_pred             CCCCCCeeeccCCcccccCCcCccCCCCCCEEEccCccccccCcCCcCCCCCCEEeccCCcccccCCCCCcCCCCCCEEE
Q 037786          129 NVTQLAVLSLSFKSFSGHIPPSLSNLHQLTDVDLGSNSFDGQFPDIMNLTRISRLDISNNQLTGSIPSHGSGLQNLAVLR  208 (565)
Q Consensus       129 ~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~  208 (565)
                      .+.+|+.|+++++.++. + +.+..+++|++|++++|.++... .++.+++|++|++++|++.+..  .+..+++|+.++
T Consensus        42 ~l~~l~~L~l~~~~I~~-l-~gl~~L~nL~~L~Ls~N~l~~l~-~l~~L~~L~~L~L~~n~i~~i~--~l~~l~~L~~L~  116 (384)
T d2omza2          42 DLDQVTTLQADRLGIKS-I-DGVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQIADIT--PLANLTNLTGLT  116 (384)
T ss_dssp             HHTTCCEEECCSSCCCC-C-TTGGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSCCCCCG--GGTTCTTCCEEE
T ss_pred             HhCCCCEEECCCCCCCC-c-cccccCCCCCEEeCcCCcCCCCc-cccCCccccccccccccccccc--cccccccccccc
Confidence            45566666666666653 2 34556666666666666665432 3555666666666666555322  244555555555


Q ss_pred             cccccccCCCchhhcCCCCCCEEEccCCcccccCCCCCCCCCcEEEccCCccccCCchhhhcCCCcCccccccccccCcc
Q 037786          209 LYNNTLSGTIPSWLFTLPLLRDIDLSDNQLTGHLDAFPSKSLRKLYLTNNRLHGSIPSSIFELANLTYLSLASNNFSGIV  288 (565)
Q Consensus       209 l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~  288 (565)
                      ++++.+....  .......+.......+.+............+...                         .+....   
T Consensus       117 ~~~~~~~~~~--~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~-------------------------~~~~~~---  166 (384)
T d2omza2         117 LFNNQITDID--PLKNLTNLNRLELSSNTISDISALSGLTSLQQLS-------------------------FGNQVT---  166 (384)
T ss_dssp             CCSSCCCCCG--GGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEE-------------------------EEESCC---
T ss_pred             cccccccccc--cccccccccccccccccccccccccccccccccc-------------------------cccccc---
Confidence            5555544221  1222333344443333332211111100000000                         000000   


Q ss_pred             ChHhhhcCCCCCEEEccCCccccccCCcccCCCCCccEEEcCCCCCCCCCchhhccccceEeccCCcCcccCChhhhhhC
Q 037786          289 EPYMLAKLVNLAALELSHNSLSFGTTSKVNSSFPQIFILSLSACNISAFPSFLRSLELAYLDLSENNIDGQIPNWMWEVG  368 (565)
Q Consensus       289 ~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~~~l~~l~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~  368 (565)
                      ....+.............+....   ......++.++.+++++|.++.++......+|+++++++|.+++ ++ .+.  .
T Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~-~~-~l~--~  239 (384)
T d2omza2         167 DLKPLANLTTLERLDISSNKVSD---ISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKD-IG-TLA--S  239 (384)
T ss_dssp             CCGGGTTCTTCCEEECCSSCCCC---CGGGGGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCC-CG-GGG--G
T ss_pred             hhhhhcccccccccccccccccc---ccccccccccceeeccCCccCCCCcccccCCCCEEECCCCCCCC-cc-hhh--c
Confidence            00112222333333333332211   11123445555556665555555444333456666666665552 22 111  3


Q ss_pred             CCCccEEEcCCCccCCccCC-CCCCCCeEEcCCCcccccCCC-CCCCCcEEEccccccCccchhhhhhcCCCCCCccccc
Q 037786          369 KDTLSFLDLSHNFITEMKQI-PWKNLKYLKLQSNLLQGPLPV-PPPRLQFLLASNNQFTGEIIQSICSSSTLEIPSWISE  446 (565)
Q Consensus       369 ~~~L~~L~ls~n~l~~~~~~-~~~~L~~L~l~~n~~~~~~~~-~~~~L~~L~l~~n~i~~~~~~~l~~~~~~~~~~~~~~  446 (565)
                      ++.++.+++++|.++.+++. .+++|++|+++++++.+..+. .++.++.+++++|++++.  ..+..+           
T Consensus       240 l~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~~--~~~~~~-----------  306 (384)
T d2omza2         240 LTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI--SPISNL-----------  306 (384)
T ss_dssp             CTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCSCC--GGGGGC-----------
T ss_pred             ccccchhccccCccCCCCcccccccCCEeeccCcccCCCCccccccccccccccccccccc--cccchh-----------
Confidence            45666666666666655442 455666666666665543222 255666666666666542  234444           


Q ss_pred             cCCCCCcEEeCcCCCCCCC-cccCCCcccEEECCCCcccccC-CCCCCCCcEeeccCceeeeccchhhhcCCCCCEEeCC
Q 037786          447 IGKDSLSYLNLSHNFITKM-KQISWKNLGYLDLRSNLLQGPL-LVPPSSLRVILILNNQFTGEIIHSICDIIALDVLDLS  524 (565)
Q Consensus       447 ~~~~~L~~L~l~~n~l~~~-~~~~~~~L~~L~ls~n~l~~~~-~~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~  524 (565)
                         +++++|++++|+++++ +...+++|++|++++|++++.. ...+++|++|++++|++++..|  ++++++|+.|+|+
T Consensus       307 ---~~l~~L~ls~n~l~~l~~l~~l~~L~~L~L~~n~l~~l~~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~  381 (384)
T d2omza2         307 ---KNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLN  381 (384)
T ss_dssp             ---TTCSEEECCSSCCSCCGGGGGCTTCCEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECC
T ss_pred             ---cccCeEECCCCCCCCCcccccCCCCCEEECCCCCCCCChhHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCC
Confidence               6666666666666666 3356666666666666665421 1255666666666666665443  5666666666666


Q ss_pred             CC
Q 037786          525 NN  526 (565)
Q Consensus       525 ~n  526 (565)
                      +|
T Consensus       382 ~N  383 (384)
T d2omza2         382 DQ  383 (384)
T ss_dssp             CE
T ss_pred             CC
Confidence            65



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure