Citrus Sinensis ID: 037810

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MACNDANLEPLLSGLADEQLASALVGSTNQTNNKDAPNGRRRRLHRSTSAPAAPLQNSIPPPESNSAIRRPNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERRL
ccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccEEccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHEcEEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
macndanlepllsGLADEQLASALVgstnqtnnkdapngrrrrlhrstsapaaplqnsipppesnsairrpntRKAVVFLAIYLGIGTICFYAVKSQIkgmkndgildgIIDSVYFCVVTMTaighgdlmpnSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCScatittlgcgdmsfsksegrIFAVYWILISCISLTLLFLYVAELNIERRL
MACNDANLEPLLSGLADEQLASAlvgstnqtnnkdapngrrrrlhrstsapaaplqnsipppesnsairrpNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERRL
MACNDANLEPLLSGLADEQLASALVGSTNQTNNKDAPNGRRRRLHRSTSAPAAPLQNSIPPPESNSAIRRPNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMalfallvlakavDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCikilislpllilVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERRL
**************************************************************************KAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNI****
************************************************************************TRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERRL
MACNDANLEPLLSGLADEQLASALVGSTNQ*************************QNSIPPPESNSAIRRPNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERRL
*******************************************************************IRRPNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIER**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRoooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooRRRRRRRRRRRRRRRRRRRRRRRoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACNDANLEPLLSGLADEQLASALVGSTNQTNNKDAPNGRRRRLHRSTSAPAAPLQNSIPPPESNSAIRRPNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q8LBL1363 Two-pore potassium channe yes no 0.769 0.597 0.477 3e-56
Q850M0347 Two pore potassium channe yes no 0.875 0.711 0.428 1e-51
Q8LIN5349 Two pore potassium channe no no 0.829 0.670 0.397 4e-41
Q9S6Z8408 Two-pore potassium channe no no 0.875 0.605 0.280 6e-27
Q9SVV6436 Two-pore potassium channe no no 0.822 0.532 0.293 2e-26
Q69TN4456 Two pore potassium channe no no 0.829 0.513 0.300 1e-22
Q9FL25443 Two-pore potassium channe no no 0.822 0.523 0.256 5e-22
Q9FWX6284 Two-pore potassium channe no no 0.677 0.672 0.308 1e-21
Q7TSH7493 Potassium voltage-gated c yes no 0.390 0.223 0.285 3e-07
Q9H3M0494 Potassium voltage-gated c yes no 0.386 0.220 0.300 3e-07
>sp|Q8LBL1|TPK1_ARATH Two-pore potassium channel 1 OS=Arabidopsis thaliana GN=TPK1 PE=1 SV=2 Back     alignment and function desciption
 Score =  219 bits (557), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/226 (47%), Positives = 147/226 (65%), Gaps = 9/226 (3%)

Query: 60  PPPESNS----AIRRPNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVY 115
           PPP  +     +   PN R+ ++FLA+YL IGT+CFY V+ QI G K  G+    +D++Y
Sbjct: 59  PPPHPSKIPMFSDLNPNLRRVIMFLALYLTIGTLCFYLVRDQISGHKTSGV----VDALY 114

Query: 116 FCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKAL 175
           FC+VTMT +G+GDL+PNS  S+LL CAFV +GM L   L L++A DYL  K   L+V+A 
Sbjct: 115 FCIVTMTTVGYGDLVPNSSASRLLACAFVFSGMVLVGHL-LSRAADYLVEKQEALLVRAF 173

Query: 176 HTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSCAT 235
           H  +      IL E+ T+K+RYKC    + L +L +V  +F V ++KM V+ A  C C+T
Sbjct: 174 HLRQSFGPTDILKELHTNKLRYKCYATCLVLVVLFIVGTIFLVMVEKMPVISAFYCVCST 233

Query: 236 ITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERR 281
           +TTLG GD SF+   GR+FAV+WIL S I L   FLYVAELN E +
Sbjct: 234 VTTLGYGDKSFNSEAGRLFAVFWILTSSICLAQFFLYVAELNTENK 279
Voltage-independent, large conductance and potassium-selective tonoplast ion channel. Regulated by cytoplasmic calcium and pH. Does not mediate slow-vacuolar (SV) ionic currents, but essential to establish VK currents. Has some permeability for Rb(+) and NH(4)(+), but none for Na(+), Cs(+) or Li(+). Involved in intracellular K(+) redistribution and/or K(+) retranslocation between different tissues.
Arabidopsis thaliana (taxid: 3702)
>sp|Q850M0|KCO1_ORYSJ Two pore potassium channel a OS=Oryza sativa subsp. japonica GN=TPKA PE=1 SV=1 Back     alignment and function description
>sp|Q8LIN5|KCO2_ORYSJ Two pore potassium channel b OS=Oryza sativa subsp. japonica GN=TPKB PE=1 SV=1 Back     alignment and function description
>sp|Q9S6Z8|TPK5_ARATH Two-pore potassium channel 5 OS=Arabidopsis thaliana GN=TPK5 PE=1 SV=1 Back     alignment and function description
>sp|Q9SVV6|TPK3_ARATH Two-pore potassium channel 3 OS=Arabidopsis thaliana GN=TPK3 PE=2 SV=1 Back     alignment and function description
>sp|Q69TN4|KCO3_ORYSJ Two pore potassium channel c OS=Oryza sativa subsp. japonica GN=TPKC PE=3 SV=1 Back     alignment and function description
>sp|Q9FL25|TPK2_ARATH Two-pore potassium channel 2 OS=Arabidopsis thaliana GN=TPK2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWX6|TPK4_ARATH Two-pore potassium channel 4 OS=Arabidopsis thaliana GN=TPK4 PE=2 SV=2 Back     alignment and function description
>sp|Q7TSH7|KCNF1_MOUSE Potassium voltage-gated channel subfamily F member 1 OS=Mus musculus GN=Kcnf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9H3M0|KCNF1_HUMAN Potassium voltage-gated channel subfamily F member 1 OS=Homo sapiens GN=KCNF1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
356501636349 PREDICTED: calcium-activated outward-rec 0.932 0.753 0.482 1e-63
147776300354 hypothetical protein VITISV_029267 [Viti 0.936 0.745 0.444 4e-62
225461894354 PREDICTED: calcium-activated outward-rec 0.936 0.745 0.444 4e-62
154425489349 potassium channel [Nicotiana tabacum] 0.921 0.744 0.469 1e-61
3378661349 putative outward rectifying potassium ch 0.836 0.676 0.513 1e-61
224097414354 outward rectifying potassium channel [Po 0.925 0.737 0.474 3e-60
9739011348 outward-rectifying potassium channel KCO 0.875 0.709 0.480 6e-60
388496042349 unknown [Lotus japonicus] 0.918 0.742 0.458 2e-59
224056449316 outward rectifying potassium channel [Po 0.836 0.746 0.487 5e-59
357495031349 Outward rectifying potassium channel [Me 0.932 0.753 0.468 1e-58
>gi|356501636|ref|XP_003519630.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 181/288 (62%), Gaps = 25/288 (8%)

Query: 1   MACNDANLEPLLSGLADEQLASALVGSTNQTNNKDAPNGRRRRLHRSTSAPAAPL----- 55
           MA N A  +PLLSG  D     A   +  Q  NK       RRL RS SAP A L     
Sbjct: 1   MANNGAK-DPLLSGSLD-----ATQKTKQQLLNK-------RRLLRSRSAPHAELVPTET 47

Query: 56  --QNSIPPPESNSAIRRPNTRKAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDS 113
               SIP   S      P+ ++  ++LA+YLG+G + FY V++QIKG K DGILD    +
Sbjct: 48  NCNESIPRTASIFQNLHPSFKRMAIYLAVYLGVGALIFYLVRNQIKGQKTDGILD----A 103

Query: 114 VYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVK 173
           +YF +VTMT +G+GDL+PNS L+KLL CAFV +GMAL  L+V +KA DYL  K  +L+VK
Sbjct: 104 LYFTIVTMTTVGYGDLVPNSHLAKLLACAFVFSGMALIGLIV-SKAADYLVEKQELLLVK 162

Query: 174 ALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICCSC 233
           A+  ++      IL E+ET+K RYK   +   L +LI+V  +F VT++K+DV+DA  C C
Sbjct: 163 AMRMHQKIGSTEILREVETNKTRYKLFLVFSLLLILIIVGTIFLVTVEKLDVIDAFYCVC 222

Query: 234 ATITTLGCGDMSFSKSEGRIFAVYWILISCISLTLLFLYVAELNIERR 281
           +TITTLG GD SFS   GRIFAV+WIL   I+L  LF+Y+AELN E R
Sbjct: 223 STITTLGYGDQSFSTQAGRIFAVFWILTGTITLAQLFVYIAELNTEIR 270

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147776300|emb|CAN63183.1| hypothetical protein VITISV_029267 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461894|ref|XP_002264726.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|154425489|dbj|BAF74750.1| potassium channel [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|3378661|emb|CAA73483.1| putative outward rectifying potassium channel StKCO1a [Solanum tuberosum] Back     alignment and taxonomy information
>gi|224097414|ref|XP_002310924.1| outward rectifying potassium channel [Populus trichocarpa] gi|222850744|gb|EEE88291.1| outward rectifying potassium channel [Populus trichocarpa] Back     alignment and taxonomy information
>gi|9739011|gb|AAF97863.1| outward-rectifying potassium channel KCO1 [Eucalyptus camaldulensis] Back     alignment and taxonomy information
>gi|388496042|gb|AFK36087.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224056449|ref|XP_002298862.1| outward rectifying potassium channel [Populus trichocarpa] gi|222846120|gb|EEE83667.1| outward rectifying potassium channel [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357495031|ref|XP_003617804.1| Outward rectifying potassium channel [Medicago truncatula] gi|355519139|gb|AET00763.1| Outward rectifying potassium channel [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2162162363 KCO1 "CA2+ ACTIVATED OUTWARD R 0.865 0.672 0.436 7.2e-52
UNIPROTKB|Q850M0347 TPKA "Two pore potassium chann 0.890 0.723 0.399 3.5e-43
UNIPROTKB|Q8LIN5349 TPKB "Two pore potassium chann 0.847 0.684 0.382 2.4e-37
TAIR|locus:2141375408 KCO5 "Ca2+ activated outward r 0.879 0.607 0.266 9.6e-24
TAIR|locus:2117681436 KCO6 "Ca2+ activated outward r 0.829 0.536 0.271 2.2e-23
TAIR|locus:2196155284 TPK4 [Arabidopsis thaliana (ta 0.673 0.669 0.320 1.1e-21
TAIR|locus:2170423443 KCO2 "Ca2+ activated outward r 0.826 0.525 0.259 9.6e-20
UNIPROTKB|F1NK95489 KCNF1 "Uncharacterized protein 0.425 0.245 0.262 5.6e-06
TAIR|locus:2170413260 KCO3 "AT5G46360" [Arabidopsis 0.212 0.230 0.316 8.2e-06
MGI|MGI:2687399493 Kcnf1 "potassium voltage-gated 0.390 0.223 0.267 2.8e-05
TAIR|locus:2162162 KCO1 "CA2+ ACTIVATED OUTWARD RECTIFYING K+ CHANNEL 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 538 (194.4 bits), Expect = 7.2e-52, P = 7.2e-52
 Identities = 113/259 (43%), Positives = 150/259 (57%)

Query:    33 NKDAPNGRRRRLHRSTSAPAAP-LQNSI-----PPPESNS----AIRRPNTRKAVVFLAI 82
             N    + R+RRL RS SAP    + N       PPP  +     +   PN R+ ++FLA+
Sbjct:    26 NSRTSSSRKRRLRRSRSAPRGDCMYNDDVKIDEPPPHPSKIPMFSDLNPNLRRVIMFLAL 85

Query:    83 YLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCA 142
             YL IGT+CFY V+ QI G K  G+    +D++YFC+VTMT +G+GDL+PNS  S+LL CA
Sbjct:    86 YLTIGTLCFYLVRDQISGHKTSGV----VDALYFCIVTMTTVGYGDLVPNSSASRLLACA 141

Query:   143 FVLTGMXXXXXXXXXXXXDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRYKCXXX 202
             FV +GM            DYL  K   L+V+A H  +      IL E+ T+K+RYKC   
Sbjct:   142 FVFSGMVLVGHLLSRAA-DYLVEKQEALLVRAFHLRQSFGPTDILKELHTNKLRYKCYAT 200

Query:   203 XXXXXXXXXVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSEGRIFAVYWILIS 262
                      V  +F V ++KM V+ A  C C+T+TTLG GD SF+   GR+FAV+WIL S
Sbjct:   201 CLVLVVLFIVGTIFLVMVEKMPVISAFYCVCSTVTTLGYGDKSFNSEAGRLFAVFWILTS 260

Query:   263 CISLTLLFLYVAELNIERR 281
              I L   FLYVAELN E +
Sbjct:   261 SICLAQFFLYVAELNTENK 279
GO:0005267 "potassium channel activity" evidence=IEA
GO:0015271 "outward rectifier potassium channel activity" evidence=ISS;IDA
GO:0016020 "membrane" evidence=IEA
GO:0071805 "potassium ion transmembrane transport" evidence=IEA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005216 "ion channel activity" evidence=IDA
GO:0051260 "protein homooligomerization" evidence=IPI
GO:0010029 "regulation of seed germination" evidence=IMP
GO:0010119 "regulation of stomatal movement" evidence=IMP
GO:0030007 "cellular potassium ion homeostasis" evidence=IMP
GO:0000271 "polysaccharide biosynthetic process" evidence=RCA
GO:0006816 "calcium ion transport" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
GO:0015269 "calcium-activated potassium channel activity" evidence=IDA
UNIPROTKB|Q850M0 TPKA "Two pore potassium channel a" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8LIN5 TPKB "Two pore potassium channel b" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2141375 KCO5 "Ca2+ activated outward rectifying K+ channel 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117681 KCO6 "Ca2+ activated outward rectifying K+ channel 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196155 TPK4 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170423 KCO2 "Ca2+ activated outward rectifying K+ channel 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NK95 KCNF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2170413 KCO3 "AT5G46360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2687399 Kcnf1 "potassium voltage-gated channel, subfamily F, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
pfam0788574 pfam07885, Ion_trans_2, Ion channel 8e-09
pfam0788574 pfam07885, Ion_trans_2, Ion channel 0.002
PRK10537393 PRK10537, PRK10537, voltage-gated potassium channe 0.004
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information 
 Score = 51.1 bits (123), Expect = 8e-09
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 78  VFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSK 137
           + L + L  GT+ +   +        +G     +D++YF  VT+T IG+GD++P +   +
Sbjct: 1   ILLLLVLIFGTVYYSLEE--------EGWGWDFLDALYFSFVTLTTIGYGDIVPLTDAGR 52

Query: 138 LLVCAFVLTGMALFALLV 155
           L    ++L G+ LF L +
Sbjct: 53  LFTIIYILIGIPLFLLFL 70

This family includes the two membrane helix type ion channels found in bacteria. Length = 74
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
KOG4404350 consensus Tandem pore domain K+ channel TASK3/THIK 100.0
KOG1418 433 consensus Tandem pore domain K+ channel [Inorganic 99.95
KOG3713477 consensus Voltage-gated K+ channel KCNB/KCNC [Inor 99.66
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.62
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.57
KOG1419 654 consensus Voltage-gated K+ channel KCNQ [Inorganic 99.44
KOG1545507 consensus Voltage-gated shaker-like K+ channel KCN 99.41
KOG3713477 consensus Voltage-gated K+ channel KCNB/KCNC [Inor 99.25
KOG1419 654 consensus Voltage-gated K+ channel KCNQ [Inorganic 99.23
PRK10537393 voltage-gated potassium channel; Provisional 99.18
PRK10537 393 voltage-gated potassium channel; Provisional 99.15
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.11
KOG4390632 consensus Voltage-gated A-type K+ channel KCND [In 99.07
KOG1545507 consensus Voltage-gated shaker-like K+ channel KCN 99.03
KOG1418 433 consensus Tandem pore domain K+ channel [Inorganic 99.02
KOG4404 350 consensus Tandem pore domain K+ channel TASK3/THIK 98.97
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.76
KOG1420 1103 consensus Ca2+-activated K+ channel Slowpoke, alph 98.74
KOG1420 1103 consensus Ca2+-activated K+ channel Slowpoke, alph 98.73
KOG3684489 consensus Ca2+-activated K+ channel proteins (inte 98.6
KOG0498 727 consensus K+-channel ERG and related proteins, con 98.57
KOG4390 632 consensus Voltage-gated A-type K+ channel KCND [In 98.36
KOG3193 1087 consensus K+ channel subunit [Inorganic ion transp 98.23
KOG3193 1087 consensus K+ channel subunit [Inorganic ion transp 98.09
KOG3684 489 consensus Ca2+-activated K+ channel proteins (inte 98.09
PF01007336 IRK: Inward rectifier potassium channel; InterPro: 97.9
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 97.88
KOG0498 727 consensus K+-channel ERG and related proteins, con 97.87
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 97.38
PF01007 336 IRK: Inward rectifier potassium channel; InterPro: 97.19
TIGR00933390 2a38 potassium uptake protein, TrkH family. The pr 96.55
PF00520200 Ion_trans: Ion transport protein calcium channel s 96.54
KOG3827 400 consensus Inward rectifier K+ channel [Inorganic i 96.51
KOG0500 536 consensus Cyclic nucleotide-gated cation channel C 96.36
PRK10750483 potassium transporter; Provisional 95.49
PRK05482559 potassium-transporting ATPase subunit A; Provision 95.35
TIGR00933390 2a38 potassium uptake protein, TrkH family. The pr 94.82
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 94.0
KOG0499 815 consensus Cyclic nucleotide-gated cation channel C 93.64
PRK10750 483 potassium transporter; Provisional 93.63
KOG3827 400 consensus Inward rectifier K+ channel [Inorganic i 93.22
PF00520200 Ion_trans: Ion transport protein calcium channel s 93.2
KOG0500 536 consensus Cyclic nucleotide-gated cation channel C 92.12
TIGR00934800 2a38euk potassium uptake protein, Trk family. The 92.08
PF02386354 TrkH: Cation transport protein; InterPro: IPR00344 91.87
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 90.55
COG0168499 TrkG Trk-type K+ transport systems, membrane compo 89.74
KOG0499 815 consensus Cyclic nucleotide-gated cation channel C 87.23
KOG4440 993 consensus NMDA selective glutamate-gated ion chann 83.03
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-35  Score=258.29  Aligned_cols=196  Identities=20%  Similarity=0.238  Sum_probs=158.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhc-----------------------------------CCCCCCCcccchhheeee
Q 037810           73 TRKAVVFLAIYLGIGTICFYAVKSQIK-----------------------------------GMKNDGILDGIIDSVYFC  117 (282)
Q Consensus        73 ~~~~~~~l~~~l~~g~~~~~~~~~~~e-----------------------------------~~~~~~~~~~~~~a~yf~  117 (282)
                      ...++++.+.|+++|+.+|.++|...|                                   ..++....|.|..||||+
T Consensus         9 ~l~Livct~tYLLvGAaVFdaLEse~E~~~r~~l~~~~~~~~~kyn~s~~d~r~~er~i~~s~ph~ag~qWkF~GaFYFa   88 (350)
T KOG4404|consen    9 TLLLIVCTFTYLLVGAAVFDALESENEARERERLERRLANLKRKYNLSEEDYRELERVILKSEPHKAGPQWKFAGAFYFA   88 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHhcCccccccccccCcceEEE
Confidence            346777889999999999999987766                                   122445678899999999


Q ss_pred             eeeEeeeecccccccCcchhHHHHHHHHhHHHHHHHHHHHHHHHHHHhHHHHHHHHhhhhccccccccccccccccccch
Q 037810          118 VVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEIETSKVRY  197 (282)
Q Consensus       118 ~~t~tTvGyGd~~P~t~~gr~~~~~~~~~Gi~~~~~i~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~e~~~~~~r~  197 (282)
                      .+.+||||||..+|.|..||+||++|+++|+++..+ +++.+++.+..... .+++++++.....        ......+
T Consensus        89 ~TVItTIGyGhstP~T~~GK~Fcm~Yal~Gipl~lv-mFqs~gERlnt~~a-yil~~~r~~~~~r--------~~~~S~~  158 (350)
T KOG4404|consen   89 TTVITTIGYGHSTPSTDGGKAFCMFYALVGIPLTLV-MFQSIGERLNTFVA-YILRRCRRRLGRR--------RWDVSVY  158 (350)
T ss_pred             EEEEeeeccCCCCCCCcCceehhhhHHHhcCchHHH-HHHHHHHHHHHHHH-HHHHHHHHHhccc--------cCCCcHH
Confidence            999999999999999999999999999999999999 99999998865432 3344444432110        0122233


Q ss_pred             hhh-hhhhhhhhhHHHHhhhhhhhccCCCccceeeEEeeeeeeecCCcccCCcc--------chhhHHHHHHHHHHHHHH
Q 037810          198 KCI-KILISLPLLILVSAVFQVTIDKMDVVDAICCSCATITTLGCGDMSFSKSE--------GRIFAVYWILISCISLTL  268 (282)
Q Consensus       198 k~~-~~~~~~~~~~~~ga~~~~~~E~~~~~ds~yf~~vT~tTIGyGD~~p~~~~--------gr~~~~~~il~G~~~~a~  268 (282)
                      .++ +.+..+++.++.||..|..+|+|+|+||+||||||+|||||||+++...-        -+.+.++||++|+.+++.
T Consensus       159 ~l~~i~~~~~~~~i~~gaa~fs~~E~Wsyfds~YyCFITltTIGFGDyValQ~~~alq~qplYv~~sf~fIL~Gl~vi~a  238 (350)
T KOG4404|consen  159 NLVLILFTACILLICCGAAMFSSVEGWSYFDSYYYCFITLTTIGFGDYVALQQDAALQSQPLYVFFSFVFILLGLCVIYA  238 (350)
T ss_pred             HHHHHHHHHHHHHHHhhHHHhhcccCcchhhhhheeeeeeeeccccchhhhcchhhhhCCCceehHhHHHHHHHHHHHHH
Confidence            433 44455666888999999999999999999999999999999999998762        278999999999999999


Q ss_pred             HHHHHHHHHH
Q 037810          269 LFLYVAELNI  278 (282)
Q Consensus       269 ~~~~i~~~~~  278 (282)
                      ++|.+.-.+.
T Consensus       239 ~~NllvLrf~  248 (350)
T KOG4404|consen  239 LLNLLVLRFM  248 (350)
T ss_pred             HHHHHHHHHH
Confidence            9999887665

>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>TIGR00933 2a38 potassium uptake protein, TrkH family Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK10750 potassium transporter; Provisional Back     alignment and domain information
>PRK05482 potassium-transporting ATPase subunit A; Provisional Back     alignment and domain information
>TIGR00933 2a38 potassium uptake protein, TrkH family Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK10750 potassium transporter; Provisional Back     alignment and domain information
>KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00934 2a38euk potassium uptake protein, Trk family Back     alignment and domain information
>PF02386 TrkH: Cation transport protein; InterPro: IPR003445 This family consists of various potassium transport proteins (Trk) and V-type sodium ATP synthase subunit J or translocating ATPase J (3 Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>COG0168 TrkG Trk-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3lnm_B514 F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Chan 5e-04
3tet_A97 Crystal Structure Of Nak2k Channel Y66f Mutant Leng 5e-04
3t4d_A97 Crystal Structure Of Nak2k Channel Y55f Mutant Leng 5e-04
2r9r_B514 Shaker Family Voltage Dependent Potassium Channel ( 5e-04
3ouf_A97 Structure Of A K+ Selective Nak Mutant Length = 97 5e-04
2a79_B499 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 5e-04
3lut_B499 A Structural Model For The Full-Length Shaker Potas 5e-04
3t4z_A97 Crystal Structure Of Nak2k Channel Y55w Mutant Leng 6e-04
3t2m_A97 Crystal Structure Of Nak Channel N68d Mutant Length 8e-04
>pdb|3LNM|B Chain B, F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Channel Length = 514 Back     alignment and structure 
Iteration: 1

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
Query: 80  LAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLL 139
           L  +L IG I F +     +  + D     I D+ ++ VV+MT +G+GD++P ++  K++
Sbjct: 346 LIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIV 405
Query: 140 --VCA 142
             +CA
Sbjct: 406 GSLCA 410
>pdb|3TET|A Chain A, Crystal Structure Of Nak2k Channel Y66f Mutant Length = 97 Back     alignment and structure
>pdb|3T4D|A Chain A, Crystal Structure Of Nak2k Channel Y55f Mutant Length = 97 Back     alignment and structure
>pdb|2R9R|B Chain B, Shaker Family Voltage Dependent Potassium Channel (Kv1.2-Kv2.1 Paddle Chimera Channel) In Association With Beta Subunit Length = 514 Back     alignment and structure
>pdb|3OUF|A Chain A, Structure Of A K+ Selective Nak Mutant Length = 97 Back     alignment and structure
>pdb|2A79|B Chain B, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 499 Back     alignment and structure
>pdb|3LUT|B Chain B, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 499 Back     alignment and structure
>pdb|3T4Z|A Chain A, Crystal Structure Of Nak2k Channel Y55w Mutant Length = 97 Back     alignment and structure
>pdb|3T2M|A Chain A, Crystal Structure Of Nak Channel N68d Mutant Length = 97 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3ukm_A280 Potassium channel subfamily K member 1; membrane p 1e-13
3ukm_A280 Potassium channel subfamily K member 1; membrane p 8e-06
3um7_A309 Potassium channel subfamily K member 4; potassium 5e-12
3um7_A309 Potassium channel subfamily K member 4; potassium 3e-05
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 2e-11
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 5e-09
3ouf_A97 Potassium channel protein; ION channel, membrane, 1e-10
3ouf_A97 Potassium channel protein; ION channel, membrane, 2e-09
2q67_A114 Potassium channel protein; inverted teepee, helix 1e-10
2q67_A114 Potassium channel protein; inverted teepee, helix 4e-09
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 4e-10
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 6e-10
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 2e-06
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 2e-09
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 4e-08
2a9h_A155 Voltage-gated potassium channel; potassium channel 2e-07
1xl4_A301 Inward rectifier potassium channel; integral membr 2e-07
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 2e-07
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1lnq_A 336 MTHK channels, potassium channel related protein; 5e-07
1lnq_A 336 MTHK channels, potassium channel related protein; 5e-06
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 9e-07
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 2e-06
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 2e-06
1p7b_A333 Integral membrane channel and cytosolic domains; t 5e-06
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 Back     alignment and structure
 Score = 68.3 bits (166), Expect = 1e-13
 Identities = 28/178 (15%), Positives = 66/178 (37%), Gaps = 14/178 (7%)

Query: 112 DSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLI 171
            +++F    ++  G+G  +P S   K     + + G+    LL L   V  +        
Sbjct: 96  SALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFT-LLFLTAVVQRITVHVTRRP 154

Query: 172 VKALHTYEIADLNGILNEIETSKVRYKCIKILISLPLLILVSAVFQVTIDKMDVVDAICC 231
           V   H           ++   + V    +  +       + +AVF V  D  + +++   
Sbjct: 155 VLYFHIRWGF------SKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYF 208

Query: 232 SCATITTLGCGDMSFSKSEG-------RIFAVYWILISCISLTLLFLYVAELNIERRL 282
              +++T+G GD    +          +I    ++L+  I++ ++     EL+  ++ 
Sbjct: 209 CFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF 266
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
3ukm_A280 Potassium channel subfamily K member 1; membrane p 100.0
3um7_A309 Potassium channel subfamily K member 4; potassium 100.0
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.74
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.73
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.73
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.71
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.71
2q67_A114 Potassium channel protein; inverted teepee, helix 99.7
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.68
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.67
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.67
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.67
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.66
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.66
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.65
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.63
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.63
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.63
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.61
2q67_A114 Potassium channel protein; inverted teepee, helix 99.6
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.57
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.52
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.5
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.47
1xl4_A301 Inward rectifier potassium channel; integral membr 99.45
1lnq_A 336 MTHK channels, potassium channel related protein; 99.44
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.4
3um7_A309 Potassium channel subfamily K member 4; potassium 99.35
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.35
1p7b_A333 Integral membrane channel and cytosolic domains; t 99.35
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 99.31
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.31
3beh_A 355 MLL3241 protein; transmembrane protein, membrane p 99.3
1xl4_A 301 Inward rectifier potassium channel; integral membr 99.26
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 99.26
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 99.26
1p7b_A 333 Integral membrane channel and cytosolic domains; t 99.23
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.19
1lnq_A 336 MTHK channels, potassium channel related protein; 99.17
3sya_A340 G protein-activated inward rectifier potassium CH; 99.03
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 98.97
3spc_A343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.92
3sya_A 340 G protein-activated inward rectifier potassium CH; 98.75
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.65
3rvy_A285 ION transport protein; tetrameric ION channel, vol 98.47
3rvy_A285 ION transport protein; tetrameric ION channel, vol 98.15
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 96.09
3pjz_A494 Potassium uptake protein TRKH; structural genomics 95.31
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 94.39
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 94.11
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 92.12
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3e-38  Score=279.03  Aligned_cols=199  Identities=15%  Similarity=0.235  Sum_probs=153.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhc---------------------------------------C-----CCCCCCcccc
Q 037810           75 KAVVFLAIYLGIGTICFYAVKSQIK---------------------------------------G-----MKNDGILDGI  110 (282)
Q Consensus        75 ~~~~~l~~~l~~g~~~~~~~~~~~e---------------------------------------~-----~~~~~~~~~~  110 (282)
                      .+++.+++|+++|+.+|..+|.+.|                                       |     +......|++
T Consensus        15 lLil~~~~Yl~~GA~vF~~LE~p~E~~~r~~~~~~~~~fl~~~~~~s~~~l~~~~~~~~~a~~~g~~~~~~~~~~~~w~~   94 (280)
T 3ukm_A           15 FLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSQASGNWNWDF   94 (280)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHHHHHHTTTCCCC------CCSSH
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCccHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHhcCCccccCCCCCCCCCh
Confidence            4455568899999999999998776                                       1     1122335889


Q ss_pred             hhheeeeeeeEeeeecccccccCcchhHHHHHHHHhHHHHHHHHHHHHHHHHHHhHHHHHHHHhhhhccccccccccccc
Q 037810          111 IDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALLVLAKAVDYLFNKHAVLIVKALHTYEIADLNGILNEI  190 (282)
Q Consensus       111 ~~a~yf~~~t~tTvGyGd~~P~t~~gr~~~~~~~~~Gi~~~~~i~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~e~  190 (282)
                      .||+||+++|+|||||||++|.|+.||+++++|+++|++++++ +++.+++.+.+...++..+.++++...+      + 
T Consensus        95 ~~a~yf~~~t~tTvGyGd~~P~T~~Gk~f~~~~~l~Gi~~~~~-~~~~~~~~l~~~~~~~~~~~~~~~~~~~------~-  166 (280)
T 3ukm_A           95 TSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLL-FLTAVVQRITVHVTRRPVLYFHIRWGFS------K-  166 (280)
T ss_dssp             HHHHHHHHHHHTTCCCCSSCCCSHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHSSTTTTTC------C------C-
T ss_pred             hcchhheeeeeeccccCCcCCCCchhHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHhcCC------h-
Confidence            9999999999999999999999999999999999999999999 9999888775533222122222111100      0 


Q ss_pred             cccccchhhhhhhhhhhhhHHHHhhhhhhhc-cCCCccceeeEEeeeeeeecCCcccCCccc-------hhhHHHHHHHH
Q 037810          191 ETSKVRYKCIKILISLPLLILVSAVFQVTID-KMDVVDAICCSCATITTLGCGDMSFSKSEG-------RIFAVYWILIS  262 (282)
Q Consensus       191 ~~~~~r~k~~~~~~~~~~~~~~ga~~~~~~E-~~~~~ds~yf~~vT~tTIGyGD~~p~~~~g-------r~~~~~~il~G  262 (282)
                      .+......+...+.++++++++|+.+++..| +|+++||+||+++|+|||||||++|.++.|       |+++++|+++|
T Consensus       167 ~~~~~~~~~~l~~~~~~~~~~~ga~~~~~~E~~~s~~da~y~~~iTltTvGyGD~~p~t~~~~~~~~l~r~~~~~~il~G  246 (280)
T 3ukm_A          167 QVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLG  246 (280)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTHHHHHHHHHHSSSCCHHHHHHHHHHHHTTCCCCSCCSSCSSSCTTHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhcCCchhhhhhheeeeeecccCCCCCCCCCcccccchhHHHHHHHHHHHH
Confidence            0001111233344555567889999999999 899999999999999999999999999975       99999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhc
Q 037810          263 CISLTLLFLYVAELNIERR  281 (282)
Q Consensus       263 ~~~~a~~~~~i~~~~~~~~  281 (282)
                      ++++++.++.++|...+++
T Consensus       247 l~~~~~~~~~i~~~~~~~~  265 (280)
T 3ukm_A          247 LIAMLVVLETFCELHELKK  265 (280)
T ss_dssp             HHHHHHHHHHHHTSHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            9999999999999888765
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure
>3pjz_A Potassium uptake protein TRKH; structural genomics, PSI-2, protein structure initiative, NE consortium on membrane protein structure; 3.51A {Vibrio parahaemolyticus} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 4e-10
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 2e-08
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 5e-09
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 1e-04
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 2e-08
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 1e-06
d2h8pc157 f.14.1.1 (C:22-78) Potassium channel protein {Stre 0.002
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel-related protein MthK
species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]

 Score = 53.2 bits (128), Expect = 4e-10
 Identities = 16/81 (19%), Positives = 36/81 (44%), Gaps = 11/81 (13%)

Query: 75  KAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSV 134
           + ++ +   +  GT  F+ ++            +    S+Y+  VT+  +G+GD  P++ 
Sbjct: 4   RILLLVLAVIIYGTAGFHFIEG-----------ESWTVSLYWTFVTIATVGYGDYSPSTP 52

Query: 135 LSKLLVCAFVLTGMALFALLV 155
           L        ++ G+  FA+ V
Sbjct: 53  LGMYFTVTLIVLGIGTFAVAV 73
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.73
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.7
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.69
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.55
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.53
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.48
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.39
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.39
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 98.61
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 98.06
d2p7tc134 Potassium channel protein {Streptomyces lividans [ 81.13
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]

Probab=99.73  E-value=1.7e-18  Score=129.56  Aligned_cols=89  Identities=22%  Similarity=0.355  Sum_probs=70.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhcCCCCCCCcccchhheeeeeeeEeeeecccccccCcchhHHHHHHHHhHHHHHHHH
Q 037810           75 KAVVFLAIYLGIGTICFYAVKSQIKGMKNDGILDGIIDSVYFCVVTMTAIGHGDLMPNSVLSKLLVCAFVLTGMALFALL  154 (282)
Q Consensus        75 ~~~~~l~~~l~~g~~~~~~~~~~~e~~~~~~~~~~~~~a~yf~~~t~tTvGyGd~~P~t~~gr~~~~~~~~~Gi~~~~~i  154 (282)
                      ...+++++.+++++.+++..|+..+    ++.+.++.||+||+++|+|||||||++|+|+.||++++++++.|+.++++ 
T Consensus        10 ~~~~~~~~~~~~~s~~~~~~e~~~~----~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~~-   84 (103)
T d1r3jc_          10 AATVLLVIVLLAGSYLAVLAERGAP----GAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGL-   84 (103)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTST----TCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccCC----CcccCchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHHH-
Confidence            3344445555667777766654332    23357779999999999999999999999999999999999999999999 


Q ss_pred             HHHHHHHHHHhHHH
Q 037810          155 VLAKAVDYLFNKHA  168 (282)
Q Consensus       155 ~~~~~~~~~~~~~~  168 (282)
                      .++.+++.+.++++
T Consensus        85 ~~~~i~~~~~~~~~   98 (103)
T d1r3jc_          85 VTAALATWFVGREQ   98 (103)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            99999888866544
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2p7tc1 f.14.1.1 (C:86-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure