Citrus Sinensis ID: 037814
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| 224122712 | 945 | cc-nbs-lrr resistance protein [Populus t | 0.969 | 0.234 | 0.462 | 3e-51 | |
| 224114836 | 477 | cc-nbs resistance protein [Populus trich | 0.969 | 0.465 | 0.480 | 6e-51 | |
| 224114840 | 566 | cc-nbs resistance protein [Populus trich | 0.965 | 0.390 | 0.469 | 1e-48 | |
| 224115620 | 963 | cc-nbs-lrr resistance protein [Populus t | 0.934 | 0.222 | 0.508 | 3e-48 | |
| 224110232 | 486 | cc-nbs resistance protein [Populus trich | 0.960 | 0.452 | 0.466 | 3e-48 | |
| 359482792 | 922 | PREDICTED: putative disease resistance p | 0.960 | 0.238 | 0.473 | 9e-48 | |
| 224114848 | 571 | cc-nbs resistance protein [Populus trich | 0.960 | 0.385 | 0.458 | 1e-47 | |
| 359482784 | 919 | PREDICTED: putative disease resistance p | 0.960 | 0.239 | 0.473 | 1e-47 | |
| 225470202 | 910 | PREDICTED: putative disease resistance p | 0.960 | 0.241 | 0.454 | 3e-46 | |
| 359482798 | 932 | PREDICTED: putative disease resistance p | 0.960 | 0.236 | 0.454 | 4e-46 |
| >gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 207 bits (527), Expect = 3e-51, Method: Compositional matrix adjust.
Identities = 106/229 (46%), Positives = 165/229 (72%), Gaps = 7/229 (3%)
Query: 1 MVDAIISPLLEQLISVAVEEAKEQVRLVTGVGKEVKKLTSSLRAVQAVLHDAEKRQVKEE 60
M +A++SP+LEQL ++ ++ +E+V LV GV K+V KL S+L +Q+VL DA+++QVK++
Sbjct: 1 MAEALLSPILEQLTTIVAQQVQEEVNLVVGVKKQVDKLKSNLLDIQSVLEDADRKQVKDK 60
Query: 61 TVRLWLDQLRDACYDMEDVLGEWNTARLKLQIDGVDDHLNDALVPKKKVCSLFPAASCFA 120
VR W+D+L+DACYDM+DVL EW+TA L+ +++ +++ + ++K+ F + CF
Sbjct: 61 AVRDWVDKLKDACYDMDDVLDEWSTAILRWKMEEAEENTHS----RQKIRCSFLGSPCFC 116
Query: 121 RKPLVLRRDIALKIKEINETLDDIAKQRDMFGFAVNVIKSNERADQRVPSISSIDESEIF 180
+V RRDIALKIKE++E +DDIAK+R +GF ++ K + QR+ + S +DES +
Sbjct: 117 FNQVVRRRDIALKIKEVSEKVDDIAKERAKYGF--DLYKGTDEL-QRLTTTSFVDESSVI 173
Query: 181 GREKEKNELVNRLLCESSEERKGPRIISLVGMGGIGKTTLAQFAYNNDD 229
GR+ EK +V++LL ESS E + +ISLVG+GGIGKTTLAQ A+N+ +
Sbjct: 174 GRDGEKRNVVSKLLAESSHEARDVDVISLVGLGGIGKTTLAQLAFNDSE 222
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224114836|ref|XP_002332294.1| cc-nbs resistance protein [Populus trichocarpa] gi|222832456|gb|EEE70933.1| cc-nbs resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224114840|ref|XP_002332295.1| cc-nbs resistance protein [Populus trichocarpa] gi|222832457|gb|EEE70934.1| cc-nbs resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115620|ref|XP_002332101.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874921|gb|EEF12052.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224110232|ref|XP_002333124.1| cc-nbs resistance protein [Populus trichocarpa] gi|222834935|gb|EEE73384.1| cc-nbs resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224114848|ref|XP_002332297.1| cc-nbs resistance protein [Populus trichocarpa] gi|222832459|gb|EEE70936.1| cc-nbs resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225470202|ref|XP_002269053.1| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359482798|ref|XP_002268266.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| TAIR|locus:2091672 | 1054 | AT3G14470 [Arabidopsis thalian | 0.790 | 0.171 | 0.305 | 1.1e-19 | |
| TAIR|locus:2011982 | 857 | AT1G50180 [Arabidopsis thalian | 0.908 | 0.242 | 0.281 | 2.8e-14 | |
| TAIR|locus:2176486 | 908 | RPP8 "RECOGNITION OF PERONOSPO | 0.895 | 0.225 | 0.271 | 5.4e-12 | |
| TAIR|locus:504956483 | 847 | AT3G46730 [Arabidopsis thalian | 0.917 | 0.247 | 0.283 | 1.7e-11 | |
| TAIR|locus:2152536 | 908 | AT5G48620 [Arabidopsis thalian | 0.895 | 0.225 | 0.25 | 2.4e-11 | |
| TAIR|locus:2075170 | 835 | RPP13 "RECOGNITION OF PERONOSP | 0.917 | 0.251 | 0.296 | 3.4e-10 | |
| TAIR|locus:2091662 | 1424 | AT3G14460 [Arabidopsis thalian | 0.917 | 0.147 | 0.266 | 1.6e-09 | |
| TAIR|locus:2025916 | 906 | AT1G59780 "AT1G59780" [Arabido | 0.423 | 0.107 | 0.314 | 4.2e-09 | |
| TAIR|locus:504956186 | 1138 | AT1G58602 [Arabidopsis thalian | 0.441 | 0.088 | 0.284 | 7.9e-09 | |
| TAIR|locus:2037623 | 899 | AT1G58410 [Arabidopsis thalian | 0.847 | 0.215 | 0.258 | 1e-08 |
| TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 247 (92.0 bits), Expect = 1.1e-19, P = 1.1e-19
Identities = 59/193 (30%), Positives = 111/193 (57%)
Query: 35 VKKLTSSLRAVQAVLHDAEKRQVKEETVRLWLDQLRDACYDMEDVLGEWNTARLKLQIDG 94
+++L+++L + AVL DAE++Q+ V W+++LRD Y ED L + T L+L I G
Sbjct: 39 LERLSTALLTITAVLIDAEEKQITNPVVEKWVNELRDVVYHAEDALDDIATEALRLNI-G 97
Query: 95 VDDHLNDALVPKKKVCSLFPAASCFARKPLVLRRDIALKIKEINETLDDIAKQRDMFGFA 154
+ ++ L + SL + + +++++ L+ +A QR++ G
Sbjct: 98 AESSSSNRLRQLRGRMSLGDFLDGNSEH-------LETRLEKVTIRLERLASQRNILGLK 150
Query: 155 VNVIKSNERADQRVPSISSIDESEIFGREKEKNELVNRLLCESSEERKGPRIISLVGMGG 214
+ QR+P+ S +DESE+FGR+ +K+E++ L+ E+ ++ G ++++VG+GG
Sbjct: 151 ELTAMIPK---QRLPTTSLVDESEVFGRDDDKDEIMRFLIPENGKDN-GITVVAIVGIGG 206
Query: 215 IGKTTLAQFAYNN 227
+GKTTL+Q YN+
Sbjct: 207 VGKTTLSQLLYND 219
|
|
| TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 6e-08 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 51.6 bits (124), Expect = 6e-08
Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (8%)
Query: 182 REKEKNELVNRLLCESSEERKGPRIISLVGMGGIGKTTLAQFAYNND 228
RE L+ +L E ++ +VGMGG+GKTTLA+ YN+D
Sbjct: 1 REDMIEALIEKL----LEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD 43
|
Length = 285 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.84 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.99 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.3 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.03 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.94 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.89 | |
| PF05659 | 147 | RPW8: Arabidopsis broad-spectrum mildew resistance | 97.78 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.67 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.63 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.56 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.51 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 97.47 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.44 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.37 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.35 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.32 | |
| PF12061 | 402 | DUF3542: Protein of unknown function (DUF3542); In | 97.31 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.3 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.27 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.27 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.23 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 97.23 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.22 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.21 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.19 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.16 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.15 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.15 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.14 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.13 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.13 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.11 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 97.08 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.05 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.0 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.0 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.98 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.92 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.92 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.88 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.87 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.85 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 96.84 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.82 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 96.8 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.79 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.76 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 96.74 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 96.74 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.74 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.71 | |
| PRK06620 | 214 | hypothetical protein; Validated | 96.71 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 96.7 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.69 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.69 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 96.66 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 96.66 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.65 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.65 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 96.64 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.59 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 96.59 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 96.57 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 96.56 | |
| PLN02200 | 234 | adenylate kinase family protein | 96.56 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 96.55 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.53 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.53 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.52 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.5 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 96.48 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.47 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 96.47 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.46 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 96.46 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.45 | |
| PLN02348 | 395 | phosphoribulokinase | 96.45 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 96.45 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.43 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.42 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 96.41 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 96.41 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 96.38 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 96.36 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 96.35 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 96.35 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.34 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.33 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.31 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 96.31 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 96.31 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.31 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.29 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.28 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 96.25 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 96.25 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.24 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 96.24 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 96.24 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.23 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 96.23 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.22 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 96.22 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.22 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 96.21 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 96.21 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.19 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 96.19 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.18 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 96.18 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 96.18 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.18 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 96.17 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.16 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 96.15 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.14 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 96.14 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 96.14 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.13 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 96.13 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 96.11 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 96.11 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 96.1 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.1 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 96.09 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.09 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 96.08 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 96.05 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.04 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 96.03 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.03 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 96.03 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 96.02 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.01 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 96.01 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.0 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 96.0 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 95.99 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.97 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 95.97 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 95.97 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 95.96 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 95.96 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 95.95 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 95.95 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.95 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 95.94 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 95.93 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.93 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 95.93 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.91 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 95.91 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 95.91 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 95.9 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 95.9 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 95.89 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 95.86 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.86 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 95.85 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 95.85 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.82 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 95.82 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 95.81 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 95.81 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 95.81 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 95.81 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.81 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 95.8 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 95.77 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.77 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 95.75 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 95.75 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 95.73 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 95.7 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.7 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.7 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 95.69 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 95.67 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 95.67 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 95.66 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.65 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.65 | |
| PRK06526 | 254 | transposase; Provisional | 95.65 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 95.65 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 95.65 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 95.65 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 95.65 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 95.64 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 95.64 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 95.63 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 95.61 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 95.61 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 95.6 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.6 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 95.6 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.6 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 95.59 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 95.59 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 95.57 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 95.57 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 95.56 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 95.56 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 95.55 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 95.54 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 95.54 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 95.53 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 95.53 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.52 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 95.51 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 95.5 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 95.49 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 95.49 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 95.48 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 95.48 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 95.48 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.48 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 95.47 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 95.47 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 95.47 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 95.47 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 95.47 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 95.47 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 95.47 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 95.45 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 95.45 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 95.44 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 95.44 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 95.43 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 95.43 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 95.42 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 95.42 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.42 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 95.4 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 95.4 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 95.38 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 95.38 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 95.38 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 95.38 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 95.37 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 95.36 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 95.35 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 95.35 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 95.34 | |
| PRK12377 | 248 | putative replication protein; Provisional | 95.32 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 95.32 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 95.3 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 95.3 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 95.3 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 95.29 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 95.29 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.29 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 95.29 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 95.28 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 95.28 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 95.27 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 95.26 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 95.26 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.25 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 95.24 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 95.21 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 95.19 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 95.19 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 95.17 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 95.13 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 95.12 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 95.11 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 95.11 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 95.1 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.1 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.07 | |
| PHA02244 | 383 | ATPase-like protein | 95.05 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 95.04 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 95.03 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 95.01 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 95.0 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 94.97 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 94.96 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 94.94 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 94.93 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 94.92 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 94.92 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 94.9 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 94.89 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 94.89 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.88 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 94.87 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 94.86 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.84 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 94.83 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 94.81 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 94.79 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 94.78 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 94.77 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 94.74 | |
| PLN02199 | 303 | shikimate kinase | 94.74 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 94.73 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 94.73 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 94.72 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 94.71 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 94.7 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.7 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 94.67 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 94.65 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 94.64 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.62 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 94.61 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 94.6 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 94.59 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 94.59 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 94.56 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 94.55 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 94.54 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 94.54 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 94.54 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 94.53 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 94.51 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 94.51 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.49 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 94.48 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 94.48 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 94.46 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 94.44 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 94.43 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 94.42 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 94.41 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 94.41 | |
| PRK08181 | 269 | transposase; Validated | 94.38 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 94.37 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 94.37 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 94.36 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 94.35 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 94.35 | |
| PTZ00494 | 664 | tuzin-like protein; Provisional | 94.33 | |
| PHA02624 | 647 | large T antigen; Provisional | 94.32 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 94.31 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 94.3 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 94.3 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 94.26 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 94.24 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 94.22 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 94.22 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 94.21 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 94.18 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 94.14 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 94.09 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 94.05 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 94.04 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 94.02 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 93.94 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 93.93 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 93.92 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 93.9 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 93.9 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 93.9 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 93.87 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 93.87 | |
| PLN02772 | 398 | guanylate kinase | 93.86 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 93.84 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 93.84 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 93.82 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 93.81 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 93.81 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 93.79 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 93.79 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 93.76 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 93.71 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 93.68 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 93.68 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 93.66 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 93.66 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 93.64 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 93.63 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 93.63 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.6 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 93.59 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 93.59 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 93.58 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 93.55 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 93.51 | |
| PRK13764 | 602 | ATPase; Provisional | 93.49 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 93.44 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 93.43 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 93.42 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 93.41 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 93.39 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 93.3 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 93.29 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 93.27 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 93.26 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 93.21 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 93.19 | |
| KOG4181 | 491 | consensus Uncharacterized conserved protein [Funct | 93.17 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 93.14 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 93.11 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 93.11 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 93.09 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 93.09 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 93.08 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 93.08 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 93.01 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 93.01 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 93.0 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 93.0 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 92.96 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 92.95 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 92.95 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 92.94 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 92.94 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 92.86 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 92.86 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 92.8 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 92.79 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 92.79 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 92.78 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 92.78 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 92.77 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 92.69 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 92.67 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 92.67 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 92.64 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 92.64 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 92.63 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 92.6 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 92.57 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 92.53 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 92.47 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 92.46 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 92.45 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 92.42 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 92.33 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 92.27 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 92.25 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 92.23 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 92.23 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 92.22 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 92.1 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 92.09 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 92.07 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 92.03 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 91.98 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 91.98 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 91.97 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 91.94 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 91.88 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 91.83 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 91.79 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 91.78 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 91.77 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 91.73 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 91.71 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 91.59 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 91.59 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 91.58 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 91.56 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 91.56 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 91.47 | |
| KOG0410 | 410 | consensus Predicted GTP binding protein [General f | 91.4 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 91.4 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 91.39 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 91.39 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 91.34 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 91.29 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 91.28 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 91.26 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 91.25 | |
| KOG2743 | 391 | consensus Cobalamin synthesis protein [Coenzyme tr | 91.21 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 91.2 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 91.2 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 91.19 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 91.18 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 91.17 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 91.15 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 91.15 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 91.14 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 91.05 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 91.03 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 90.96 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 90.95 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 90.9 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 90.84 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 90.83 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 90.61 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 90.54 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 90.5 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 90.5 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 90.49 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 90.48 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 90.46 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 90.37 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 90.33 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 90.3 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 90.25 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 90.21 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 90.21 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 90.21 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 90.18 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 90.16 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 90.14 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 90.0 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 89.96 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.84 E-value=4.5e-20 Score=167.44 Aligned_cols=199 Identities=20% Similarity=0.282 Sum_probs=136.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhcccCcHHHHHHHHHHHHHhhhhhhhhhhh
Q 037814 4 AIISPLLEQLISVAVEEAKEQVRLVTGVGKEVKKLTSSLRAVQAVLHDAEKRQVKEETVRLWLDQLRDACYDMEDVLGEW 83 (229)
Q Consensus 4 ~~v~~~~~~l~~~l~~~l~~~~~~~~~~~~~l~~L~~~l~~i~~~l~~a~~~~~~~~~~~~wl~~l~~~~yd~eD~lD~~ 83 (229)
+.++..++++.+. +.+....+.+.++.+..|++.|..++.++++++........+..|...++++.|+++|+++.|
T Consensus 3 ~~~s~~~~~~~~~----l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~ 78 (889)
T KOG4658|consen 3 ACVSFGVEKLDQL----LNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLF 78 (889)
T ss_pred eEEEEehhhHHHH----HHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3444455666665 778888899999999999999999999999999998888999999999999999999999999
Q ss_pred HHHHHHHHhhccCCccccCCCcccccccccCCccccccCchhhhHHHHHHHHHHHHHHHHHHHHhhhhCCcccccccc--
Q 037814 84 NTARLKLQIDGVDDHLNDALVPKKKVCSLFPAASCFARKPLVLRRDIALKIKEINETLDDIAKQRDMFGFAVNVIKSN-- 161 (229)
Q Consensus 84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~l~~~~~~~~~~~~~~~~~~~~-- 161 (229)
.......+..+.- .......+.+ |.+ .++++.+..+..+..++..+.+....+..........
T Consensus 79 ~v~~~~~~~~~~l-------~~~~~~~~~~----c~~----~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~ 143 (889)
T KOG4658|consen 79 LVEEIERKANDLL-------STRSVERQRL----CLC----GFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGES 143 (889)
T ss_pred HHHHHHHHHhHHh-------hhhHHHHHHH----hhh----hhHhHhhhhhHhHHHHHHHHHHHHHHhccccceeccccc
Confidence 9666554322110 0000000100 001 3344455555555555555544444444322111111
Q ss_pred cccCCCCCCCCCCCCCcceechhhHHHHHHHhhcCCCCCCCCCEEEEEecCCCCcHHHHHHHHhcCC
Q 037814 162 ERADQRVPSISSIDESEIFGREKEKNELVNRLLCESSEERKGPRIISLVGMGGIGKTTLAQFAYNND 228 (229)
Q Consensus 162 ~~~~~~~~~~~~~~~~~~vG~~~~~~~l~~~L~~~~~~~~~~~~Vi~IvG~gGvGKTTLa~~vy~d~ 228 (229)
......+++.+..+... ||.+..++++++.|++++ ..|++|+||||+||||||++|||+.
T Consensus 144 ~~~~~~~e~~~~~~~~~-VG~e~~~~kl~~~L~~d~------~~iv~i~GMGGvGKTTL~~qi~N~~ 203 (889)
T KOG4658|consen 144 LDPREKVETRPIQSESD-VGLETMLEKLWNRLMEDD------VGIVGIYGMGGVGKTTLARQIFNKF 203 (889)
T ss_pred ccchhhcccCCCCcccc-ccHHHHHHHHHHHhccCC------CCEEEEECCCcccHHHHHHHHhccc
Confidence 11122344555555555 999999999999999876 2899999999999999999999985
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PTZ00494 tuzin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG4181 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >KOG0410 consensus Predicted GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 1e-23 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 1e-23 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 2e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-12 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 6e-07 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Score = 97.4 bits (242), Expect = 1e-23
Identities = 26/184 (14%), Positives = 51/184 (27%), Gaps = 17/184 (9%)
Query: 48 VLHDAEKRQVKEETVRLWLDQLRDACYDMEDVLGEWNTARLKLQIDGVDDHLNDALVPKK 107
L A R + + R L L ED + +
Sbjct: 9 ALSTAHTRLIHDFEPRDALTYLEGKNIFTED------------HSELISKMSTRLERIAN 56
Query: 108 KVCSLFPAASCFARKPLVLRRDIALKIKEINETLDDIAKQRDMF--GFAVNVIKSNERAD 165
+ AS + + + E D A + S + D
Sbjct: 57 FLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLD 116
Query: 166 QRVPSISSIDESEIFGREKEKNELVNRLLCESSEERKGPRIISLVGMGGIGKTTLAQFAY 225
+++ + + + RE + ++ +L + + L G G GK+ +A A
Sbjct: 117 RKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLD---SFFLFLHGRAGSGKSVIASQAL 173
Query: 226 NNDD 229
+ D
Sbjct: 174 SKSD 177
|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 99.79 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.26 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.1 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 98.93 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 98.83 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 98.33 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.19 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.19 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.1 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.08 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.05 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.02 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.0 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.96 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.68 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.66 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.64 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.57 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.56 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.52 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.51 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.47 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.47 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.43 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.38 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.37 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.36 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.36 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.35 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.35 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.34 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.33 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.33 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.29 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.29 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.29 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.25 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.21 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.21 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.2 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.2 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.19 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.17 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.17 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.15 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.13 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.13 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.11 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.11 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.09 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.07 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.04 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.03 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.03 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.02 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.02 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.01 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.01 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 96.99 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.98 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.97 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.97 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.96 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.94 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.92 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 96.91 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.89 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.86 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 96.85 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 96.83 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.82 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.81 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.8 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 96.79 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.79 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.76 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.75 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 96.75 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 96.75 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.73 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 96.72 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 96.72 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 96.71 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 96.7 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 96.7 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 96.69 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 96.69 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.67 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 96.67 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 96.66 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.65 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 96.64 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.63 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 96.62 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.57 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 96.55 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.54 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 96.53 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.47 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.45 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.44 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.44 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 96.42 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 96.4 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 96.4 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 96.37 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.37 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.33 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.33 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.31 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.31 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 96.3 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.29 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 96.29 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.29 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.26 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.25 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.23 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.21 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 96.19 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.19 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.17 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.16 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.16 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 96.14 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.13 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.09 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 96.07 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.07 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.05 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 96.04 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 96.02 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 96.0 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 96.0 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 95.96 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 95.94 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 95.92 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 95.92 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 95.91 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.9 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 95.9 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.9 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 95.89 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 95.86 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 95.84 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 95.83 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 95.79 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 95.79 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 95.79 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 95.77 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 95.77 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 95.76 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 95.76 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 95.75 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 95.71 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 95.67 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 95.67 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 95.63 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 95.6 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 95.53 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 95.53 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 95.53 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 95.53 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.52 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 95.46 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 95.42 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.41 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 95.41 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 95.39 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 95.38 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 95.35 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 95.24 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 95.22 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.21 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 95.2 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 95.2 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.18 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 95.17 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 95.14 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 95.12 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 95.1 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 94.96 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 94.92 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 94.9 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 94.84 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 94.82 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 94.82 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.79 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 94.77 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 94.71 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 94.66 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 94.65 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 94.62 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 94.59 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 94.52 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 94.52 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 94.45 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 94.4 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 94.39 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 94.36 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 94.33 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 94.33 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 94.32 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 94.27 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.24 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 94.19 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 94.04 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 94.04 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 93.97 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 93.96 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 93.8 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 93.68 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 93.68 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 93.61 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 93.43 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 93.4 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 93.35 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 93.33 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 93.17 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 93.12 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 92.96 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 92.7 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 92.67 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 92.66 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 92.59 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 92.59 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 92.58 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 92.54 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 92.34 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 92.32 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 92.14 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 92.12 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 92.07 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 92.05 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 91.99 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 91.97 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 91.85 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 91.85 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 91.81 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 91.68 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 91.68 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 91.53 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 91.53 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 91.35 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 91.26 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 91.2 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 90.96 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 90.95 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 90.89 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 90.89 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 90.85 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 90.74 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 90.21 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 90.05 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 90.04 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 89.63 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 89.45 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 89.45 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 89.22 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 88.87 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 88.56 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 88.43 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 88.39 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 87.76 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 87.12 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 86.1 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 86.08 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 85.95 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 85.91 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 85.91 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 85.69 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 85.43 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 85.41 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 85.17 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 85.04 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 84.61 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 84.58 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 84.36 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 84.02 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 83.32 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 83.13 | |
| 2olr_A | 540 | Phosphoenolpyruvate carboxykinase; carbon dioxide, | 83.05 | |
| 1ytm_A | 532 | Phosphoenolpyruvate carboxykinase [ATP], phosphoen | 82.97 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 82.95 | |
| 1ii2_A | 524 | Phosphoenolpyruvate carboxykinase; phosphate bindi | 82.82 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 82.7 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 81.89 | |
| 1j3b_A | 529 | ATP-dependent phosphoenolpyruvate carboxykinase; a | 81.38 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 81.37 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 81.18 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 81.01 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 80.95 |
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
Probab=99.79 E-value=2.5e-20 Score=129.15 Aligned_cols=80 Identities=28% Similarity=0.457 Sum_probs=72.8
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhc--ccCcHHHHHHHHHHHHHhhhhhhhhh
Q 037814 4 AIISPLLEQLISVAVEEAKEQVRLVTGVGKEVKKLTSSLRAVQAVLHDAEKR--QVKEETVRLWLDQLRDACYDMEDVLG 81 (229)
Q Consensus 4 ~~v~~~~~~l~~~l~~~l~~~~~~~~~~~~~l~~L~~~l~~i~~~l~~a~~~--~~~~~~~~~wl~~l~~~~yd~eD~lD 81 (229)
|+|+++++++.+. +.+++.++.+++++++.|+++|+.|++||.+++.. ...++.++.|+.+||+++||+||+||
T Consensus 1 a~v~~ll~KL~~l----l~~E~~l~~gv~~~i~~Lk~eL~~m~a~L~da~~~~~~~~d~~vk~W~~~vrdlaYD~ED~iD 76 (115)
T 3qfl_A 1 AAISNLIPKLGEL----LTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVD 76 (115)
T ss_dssp CTTCSHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCGGGCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CcHHHHHHHHHHH----HHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHHhccccCCHHHHHHHHHHHHHHHHHHHHHH
Confidence 3567778888777 78999999999999999999999999999999987 45789999999999999999999999
Q ss_pred hhHHHH
Q 037814 82 EWNTAR 87 (229)
Q Consensus 82 ~~~~~~ 87 (229)
+|.|..
T Consensus 77 ~f~~~~ 82 (115)
T 3qfl_A 77 KFLVQV 82 (115)
T ss_dssp HHHHHH
T ss_pred HHHHHh
Confidence 999765
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* | Back alignment and structure |
|---|
| >1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 229 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 4e-12 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 61.8 bits (149), Expect = 4e-12
Identities = 13/70 (18%), Positives = 29/70 (41%), Gaps = 3/70 (4%)
Query: 160 SNERADQRVPSISSIDESEIFGREKEKNELVNRLLCESSEERKGPRIISLVGMGGIGKTT 219
S + D+++ + + + RE + ++ +L + + L G G GK+
Sbjct: 3 SRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDS---FFLFLHGRAGSGKSV 59
Query: 220 LAQFAYNNDD 229
+A A + D
Sbjct: 60 IASQALSKSD 69
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.48 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.38 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.24 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.02 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.0 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.98 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.91 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.87 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.84 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.84 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.84 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.62 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.03 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.03 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.91 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.9 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.9 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.87 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.83 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.74 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 96.72 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.72 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.71 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.71 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.29 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 96.25 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.98 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.97 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.64 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.37 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.35 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.91 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.77 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 94.66 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 93.84 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 93.68 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 93.26 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 92.88 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 92.84 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 92.47 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 92.12 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 92.07 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.7 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 91.59 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 91.42 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 90.96 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 90.37 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 90.0 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 89.6 | |
| d1o5za2 | 296 | Folylpolyglutamate synthetase {Thermotoga maritima | 88.2 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 88.15 | |
| d2gc6a2 | 296 | Folylpolyglutamate synthetase {Lactobacillus casei | 86.27 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 85.13 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 82.51 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 82.3 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 80.32 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.48 E-value=1.2e-14 Score=114.23 Aligned_cols=50 Identities=20% Similarity=0.257 Sum_probs=43.9
Q ss_pred CCCcceechhhHHHHHHHhhcCCCCCCCCCEEEEEecCCCCcHHHHHHHHhcC
Q 037814 175 DESEIFGREKEKNELVNRLLCESSEERKGPRIISLVGMGGIGKTTLAQFAYNN 227 (229)
Q Consensus 175 ~~~~~vG~~~~~~~l~~~L~~~~~~~~~~~~Vi~IvG~gGvGKTTLa~~vy~d 227 (229)
.++.+|||+.++++|+++|....+ ++..+|+||||||+||||||++|||+
T Consensus 18 ~~~~~~gR~~~~~~i~~~L~~~~~---~~~~~v~I~GmgGiGKTtLA~~v~~~ 67 (277)
T d2a5yb3 18 KQMTCYIREYHVDRVIKKLDEMCD---LDSFFLFLHGRAGSGKSVIASQALSK 67 (277)
T ss_dssp CCCCSCCCHHHHHHHHHHHHHHTT---SSSEEEEEECSTTSSHHHHHHHHHHH
T ss_pred CCCceeCcHHHHHHHHHHHHhccC---CCceEEEEECCCCCCHHHHHHHHHHh
Confidence 456789999999999999986543 56899999999999999999999986
|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|