Citrus Sinensis ID: 037843

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---

GNEVLKLSKNDKNPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGAPQESGISFRTVLELGPTMPLFCMGLKCIGEALEGRLYVLLLVSCMGKALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHKKYKHLHGVQFHPESILTSEGKTK

ccccccccccccccEEEEEcccccHHHHHHHHHHcccccccccEEEEEEcccccHHHHHcccccEEEEccccccccccccHHHHHHHHcccccEEccHHHHHHHHHccEEEEcccccccccEEEEEcccccccccccccccccEEEccEEEEEEccccccccEEEEEEccccEEEEEEccccccccccccccccccccccccc

ccEEEEccccccccEEEEEcccccHHHHHHHHHHcHHHcccccEEEEEEcccccHHHHHHHcccEEEEcccccccHHccccHHHHHHHcccccEEEccHHHHHHHHccEEEEcccEEcccccEEEEEccccccEEEccccccEEEEEEEEEEEEcccccccEEEEEEEccccEEEEEEEcccccEEEEEEcccHHEccccccc

gnevlklskndknpivvidnYDSFTYNLCQYMGELELELsqgyhfevyrndelTVAElkrkkprgvvispgpgapqesgisfrtvlelgptmplfCMGLKCIGEALEGRLYVLLLVSCMGKALVYynekeeadgllaglsnpftagryhglviekdsfrsdelevtaWTEDGLIMAARHKKYkhlhgvqfhpesiltsegktk

gnevlklskndknpivviDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTvaelkrkkprgvvispgpgapqesgiSFRTVLELGPTMPLFCMGLKCIGEALEGRLYVLLLVSCMGKALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIekdsfrsdELEVTAWTEDGLIMAARHKKYKHlhgvqfhpesiltsegktk

*************PIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAEL*********************ISFRTVLELGPTMPLFCMGLKCIGEALEGRLYVLLLVSCMGKALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHKKYKHLHGVQFH************

**************IVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGAPQESGISFRTVLELGPTMPLFCMGLKCIGEALEGRLYVLLLVSCMGKALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHKKYKHLHGVQFHPESI*TSE****

*NEVLKLSKNDKNPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGAPQESGISFRTVLELGPTMPLFCMGLKCIGEALEGRLYVLLLVSCMGKALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHKKYKHLHGVQFHPESILTS*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		203	2.2.26 [Sep-21-2011]
P48261		190	Anthranilate synthase com	N/A	no	0.866	0.926	0.470	5e-42
Q08654		589	Anthranilate synthase com	yes	no	0.871	0.300	0.439	6e-38
P51362		189	Anthranilate synthase com	N/A	no	0.866	0.931	0.444	7e-38
Q1XDC5		189	Anthranilate synthase com	N/A	no	0.866	0.931	0.423	9e-37
P00901		198	Anthranilate synthase com	yes	no	0.857	0.878	0.424	1e-34
Q92370		759	Anthranilate synthase com	yes	no	0.866	0.231	0.440	6e-34
P20576		201	Anthranilate synthase com	yes	no	0.857	0.865	0.424	2e-33
P00903		187	Para-aminobenzoate syntha	N/A	no	0.857	0.930	0.414	2e-32
P00902		194	Anthranilate synthase com	yes	no	0.857	0.896	0.404	3e-31
P09575		367	Anthranilate synthase com	N/A	no	0.852	0.471	0.431	7e-31

>sp\|P48261\|TRPG_CYAPA Anthranilate synthase component II OS=Cyanophora paradoxa GN=trpG PE=3 SV=1	Back alignment and function desciption

 Score =  170 bits (431), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 124/189 (65%), Gaps = 13/189 (6%)

Query: 15  IVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGA 74
           I++IDNYDSFTYNL QY+ EL +++       V RND++T+ E+K    +G++ISP PG 
Sbjct: 2   ILLIDNYDSFTYNLAQYLSELNIKVL------VKRNDKITLDEIKNLNIQGIIISPCPGG 55

Query: 75  PQESGISFRTVLELGPTMPLF--CMGLKCIGEALEGRLYVLLLVSCMGKALVYYNEKEEA 132
           P++SGIS   +  LG  +P+   C+G + IG    G++     +     ++++++ K   
Sbjct: 56  PEDSGISQGIIKYLGNQIPILGVCLGHQTIGHVFGGKIIKAPKLIHGKPSIIFHDGK--- 112

Query: 133 DGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHKKYKHLHGVQFHP 192
            G+   L NP TA RYH L+IEK+S   DELE+TAWTEDGLIM  +HKKYK L G+QFHP
Sbjct: 113 -GVFQNLKNPITATRYHSLIIEKESC-PDELEITAWTEDGLIMGIQHKKYKQLQGIQFHP 170

Query: 193 ESILTSEGK 201
           ESILT  GK
Sbjct: 171 ESILTESGK 179

Cyanophora paradoxa (taxid: 2762)
EC: 4EC: .EC: 1EC: .EC: 3EC: .EC: 2EC: 7

>sp\|Q08654\|TRPG_THEMA Anthranilate synthase component II OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2	Back alignment and function description

>sp\|P51362\|TRPG_PORPU Anthranilate synthase component II OS=Porphyra purpurea GN=trpG PE=4 SV=1	Back alignment and function description

>sp\|Q1XDC5\|TRPG_PORYE Anthranilate synthase component II OS=Porphyra yezoensis GN=trpG PE=4 SV=1	Back alignment and function description

>sp\|P00901\|TRPG_PSEPU Anthranilate synthase component II OS=Pseudomonas putida GN=trpG PE=1 SV=2	Back alignment and function description

>sp\|Q92370\|TRPG_SCHPO Anthranilate synthase component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp1 PE=2 SV=2	Back alignment and function description

>sp\|P20576\|TRPG_PSEAE Anthranilate synthase component II OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpG PE=4 SV=2	Back alignment and function description

>sp\|P00903\|PABA_ECOLI Para-aminobenzoate synthase glutamine amidotransferase component II OS=Escherichia coli (strain K12) GN=pabA PE=1 SV=1	Back alignment and function description

>sp\|P00902\|TRPG_ACIAD Anthranilate synthase component 2 OS=Acinetobacter sp. (strain ADP1) GN=trpG PE=4 SV=1	Back alignment and function description

>sp\|P09575\|TRPG_PICAN Anthranilate synthase component 2 (Fragment) OS=Pichia angusta PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		203
356521181		276	PREDICTED: anthranilate synthase compone	0.955	0.702	0.739	4e-78
356558733		272	PREDICTED: anthranilate synthase compone	0.940	0.702	0.731	4e-77
356558731		278	PREDICTED: anthranilate synthase compone	0.940	0.687	0.731	4e-77
224101933		240	anthranilate synthase, beta subunit, ASB	0.916	0.775	0.75	2e-76
224108213		276	anthranilate synthase, beta subunit, ASB	0.906	0.666	0.747	3e-76
255573238		281	Anthranilate synthase component II, puta	0.926	0.669	0.727	8e-75
217072976		270	unknown [Medicago truncatula] gi\|3884985	0.950	0.714	0.707	2e-74
449449078		276	PREDICTED: anthranilate synthase compone	0.921	0.677	0.710	3e-74
297845630		277	hypothetical protein ARALYDRAFT_472860 [	0.921	0.675	0.710	6e-74
25403004		469	probable anthranilate synthase beta subu	0.926	0.400	0.696	9e-74

>gi\|356521181\|ref\|XP_003529236.1\| PREDICTED: anthranilate synthase component II-like [Glycine max]	Back alignment and taxonomy information

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 153/207 (73%), Positives = 167/207 (80%), Gaps = 13/207 (6%)

Query: 2   NEVLKLSKNDK---NPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAEL 58
           N V  +S N K   NPIVVIDNYDSFTYNLCQYMGEL      G+HFEVYRNDELTV EL
Sbjct: 60  NAVEAISANKKSNNNPIVVIDNYDSFTYNLCQYMGEL------GFHFEVYRNDELTVEEL 113

Query: 59  KRKKPRGVVISPGPGAPQESGISFRTVLELGPTMPLF--CMGLKCIGEALEGRLYVLLLV 116
           KRK PRGV+ISPGPGAPQ+SGIS +TVLELGPT+PLF  CMGL+CIGEA  G++      
Sbjct: 114 KRKNPRGVLISPGPGAPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRAPHG 173

Query: 117 SCMGKA-LVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIM 175
              GK+ +VYY+EK E DG+LAGLSNPF AGRYH LVIEK SF  DELEVTAWTEDGLIM
Sbjct: 174 VMHGKSSMVYYDEKGE-DGVLAGLSNPFLAGRYHSLVIEKGSFPDDELEVTAWTEDGLIM 232

Query: 176 AARHKKYKHLHGVQFHPESILTSEGKT 202
           AARHKKYKHL GVQFHPESI+T EGKT
Sbjct: 233 AARHKKYKHLQGVQFHPESIITPEGKT 259

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356558733\|ref\|XP_003547657.1\| PREDICTED: anthranilate synthase component II-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|356558731\|ref\|XP_003547656.1\| PREDICTED: anthranilate synthase component II-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|224101933\|ref\|XP_002312481.1\| anthranilate synthase, beta subunit, ASB2 [Populus trichocarpa] gi\|222852301\|gb\|EEE89848.1\| anthranilate synthase, beta subunit, ASB2 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224108213\|ref\|XP_002314761.1\| anthranilate synthase, beta subunit, ASB1 [Populus trichocarpa] gi\|222863801\|gb\|EEF00932.1\| anthranilate synthase, beta subunit, ASB1 [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255573238\|ref\|XP_002527548.1\| Anthranilate synthase component II, putative [Ricinus communis] gi\|223533098\|gb\|EEF34857.1\| Anthranilate synthase component II, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|217072976\|gb\|ACJ84848.1\| unknown [Medicago truncatula] gi\|388498572\|gb\|AFK37352.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449449078\|ref\|XP_004142292.1\| PREDICTED: anthranilate synthase component II-like [Cucumis sativus] gi\|449513110\|ref\|XP_004164233.1\| PREDICTED: anthranilate synthase component II-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297845630\|ref\|XP_002890696.1\| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi\|297336538\|gb\|EFH66955.1\| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|25403004\|pir\|\|B86381 probable anthranilate synthase beta subunit [imported] - Arabidopsis thaliana	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		203
TAIR\|locus:2174378		273	AT5G57890 [Arabidopsis thalian	0.955	0.710	0.691	3.7e-71
TAIR\|locus:2826092		222	AT1G24909 [Arabidopsis thalian	0.940	0.860	0.693	8.9e-70
TAIR\|locus:2826077		222	AT1G25083 [Arabidopsis thalian	0.940	0.860	0.693	8.9e-70
TAIR\|locus:2825965		222	AT1G25155 [Arabidopsis thalian	0.940	0.860	0.693	8.9e-70
TAIR\|locus:2826037		235	AT1G24807 [Arabidopsis thalian	0.970	0.838	0.665	5.1e-67
TIGR_CMR\|CHY_1586		189	CHY_1586 "para-aminobenzoate/a	0.862	0.925	0.439	3.1e-35
UNIPROTKB\|Q5LRH9		193	trpG "Anthranilate synthase co	0.857	0.901	0.460	1.5e-33
TIGR_CMR\|SPO_2149		193	SPO_2149 "anthranilate synthas	0.857	0.901	0.460	1.5e-33
TIGR_CMR\|BA_0069		195	BA_0069 "para-aminobenzoate sy	0.857	0.892	0.431	2.5e-33
UNIPROTKB\|Q4K501		197	trpG "Anthranilate synthase, c	0.857	0.883	0.435	6.7e-33

TAIR\|locus:2174378 AT5G57890 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 720 (258.5 bits), Expect = 3.7e-71, P = 3.7e-71
 Identities = 141/204 (69%), Positives = 163/204 (79%)

Query:     2 NEVLKLSKNDKNPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRK 61
             N +  +  N   PI+VIDNYDSFTYNLCQYMGEL      G HFEVYRNDELTV ELKRK
Sbjct:    59 NSISSVVVNSSGPIIVIDNYDSFTYNLCQYMGEL------GCHFEVYRNDELTVEELKRK 112

Query:    62 KPRGVVISPGPGAPQESGISFRTVLELGPTMPLF--CMGLKCIGEALEGRLYVLLLVSCM 119
             KPRG++ISPGPG PQ+SGIS +TVLELGP +PLF  CMGL+CIGEA  G++         
Sbjct:   113 KPRGLLISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGVMH 172

Query:   120 GKA-LVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAAR 178
             GK+ +V+Y+EK E +GL +GLSNPF  GRYH LVIEKDSF SDELEVTAWTEDGL+MAAR
Sbjct:   173 GKSSMVHYDEKGE-EGLFSGLSNPFLVGRYHSLVIEKDSFPSDELEVTAWTEDGLVMAAR 231

Query:   179 HKKYKHLHGVQFHPESILTSEGKT 202
             H+KYKH+ GVQFHPESI+T+EGKT
Sbjct:   232 HRKYKHIQGVQFHPESIITTEGKT 255

GO:0005737 "cytoplasm" evidence=ISM

GO:0008152 "metabolic process" evidence=IEA

GO:0000162 "tryptophan biosynthetic process" evidence=TAS

GO:0004049 "anthranilate synthase activity" evidence=IGI

GO:0009617 "response to bacterium" evidence=IEP

TAIR\|locus:2826092 AT1G24909 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2826077 AT1G25083 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2825965 AT1G25155 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2826037 AT1G24807 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_1586 CHY_1586 "para-aminobenzoate/anthranilate synthase glutamine amidotransferase, component II" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5LRH9 trpG "Anthranilate synthase component II" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_2149 SPO_2149 "anthranilate synthase component II" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_0069 BA_0069 "para-aminobenzoate synthase glutamine amidotransferase, component II" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4K501 trpG "Anthranilate synthase, component II" [Pseudomonas protegens Pf-5 (taxid:220664)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P00902	TRPG_ACIAD	4, ., 1, ., 3, ., 2, 7	0.4041	0.8571	0.8969	yes	no
P00901	TRPG_PSEPU	4, ., 1, ., 3, ., 2, 7	0.4248	0.8571	0.8787	yes	no
P28819	PABA_BACSU	4, ., 1, ., 3, ., 2, 7	0.4114	0.8472	0.8865	yes	no
Q57690	TRPG_METJA	4, ., 1, ., 3, ., 2, 7	0.3684	0.8571	0.8832	yes	no
Q9YGB2	TRPG_PYRKO	4, ., 1, ., 3, ., 2, 7	0.3850	0.8177	0.8645	yes	no
Q02003	TRPG_LACLA	4, ., 1, ., 3, ., 2, 7	0.3210	0.8669	0.8888	yes	no
P26923	TRPG_METTM	4, ., 1, ., 3, ., 2, 7	0.3582	0.8325	0.8622	yes	no
P26922	TRPG_AZOBR	4, ., 1, ., 3, ., 2, 7	0.4285	0.8571	0.8877	yes	no
P06193	PABA_SALTY	2, ., 6, ., 1, ., 8, 5	0.3776	0.8571	0.9304	yes	no
O27693	TRPG_METTH	4, ., 1, ., 3, ., 2, 7	0.3834	0.8866	0.9183	yes	no
P20576	TRPG_PSEAE	4, ., 1, ., 3, ., 2, 7	0.4248	0.8571	0.8656	yes	no
P05379	TRPG_THET8	4, ., 1, ., 3, ., 2, 7	0.4010	0.8522	0.8480	yes	no
Q06129	TRPG_SULSO	4, ., 1, ., 3, ., 2, 7	0.3482	0.8078	0.8410	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	4.1.3.27	0.914
3rd Layer	4.1.3	0.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		203
PLN02335		222	PLN02335, PLN02335, anthranilate synthase	1e-110
PRK05670		189	PRK05670, PRK05670, anthranilate synthase componen	2e-73
cd01743		184	cd01743, GATase1_Anthranilate_Synthase, Type 1 glu	5e-68
COG0512		191	COG0512, PabA, Anthranilate/para-aminobenzoate syn	1e-65
CHL00101		190	CHL00101, trpG, anthranilate synthase component 2	6e-65
PRK07765		214	PRK07765, PRK07765, para-aminobenzoate synthase co	1e-54
PRK14607		534	PRK14607, PRK14607, bifunctional glutamine amidotr	2e-54
PRK07649		195	PRK07649, PRK07649, para-aminobenzoate/anthranilat	4e-53
pfam00117		186	pfam00117, GATase, Glutamine amidotransferase clas	8e-49
TIGR00566		188	TIGR00566, trpG_papA, glutamine amidotransferase o	5e-46
PRK08007		187	PRK08007, PRK08007, para-aminobenzoate synthase co	6e-46
PRK06774		191	PRK06774, PRK06774, para-aminobenzoate synthase co	1e-43
PRK08857		193	PRK08857, PRK08857, para-aminobenzoate synthase co	2e-39
PRK13566		720	PRK13566, PRK13566, anthranilate synthase; Provisi	3e-34
TIGR01815		717	TIGR01815, TrpE-clade3, anthranilate synthase, alp	1e-24
PRK09522		531	PRK09522, PRK09522, bifunctional glutamine amidotr	1e-23
PRK06895		190	PRK06895, PRK06895, putative anthranilate synthase	1e-17
PRK05637		208	PRK05637, PRK05637, anthranilate synthase componen	4e-14
PLN02889		918	PLN02889, PLN02889, oxo-acid-lyase/anthranilate sy	1e-13
TIGR01823		742	TIGR01823, PabB-fungal, aminodeoxychorismate synth	2e-13
cd01742		181	cd01742, GATase1_GMP_Synthase, Type 1 glutamine am	1e-09
PRK00074		511	PRK00074, guaA, GMP synthase; Reviewed	3e-08
TIGR00888		188	TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd	5e-08
PRK12838		354	PRK12838, PRK12838, carbamoyl phosphate synthase s	7e-07
cd01744		178	cd01744, GATase1_CPSase, Small chain of the glutam	2e-06
cd01745		189	cd01745, GATase1_2, Subgroup of proteins having th	3e-06
COG2071		243	COG2071, COG2071, Predicted glutamine amidotransfe	4e-06
PRK00758		184	PRK00758, PRK00758, GMP synthase subunit A; Valida	9e-06
PLN02771		415	PLN02771, PLN02771, carbamoyl-phosphate synthase (	1e-05
COG0518		198	COG0518, GuaA, GMP synthase - Glutamine amidotrans	2e-05
PRK12564		360	PRK12564, PRK12564, carbamoyl phosphate synthase s	2e-05
TIGR01368		358	TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synt	7e-05
CHL00197		382	CHL00197, carA, carbamoyl-phosphate synthase argin	2e-04
pfam07722		219	pfam07722, Peptidase_C26, Peptidase C26	8e-04
cd01741		188	cd01741, GATase1_1, Subgroup of proteins having th	0.002

>gnl\|CDD\|177969 PLN02335, PLN02335, anthranilate synthase	Back alignment and domain information

 Score =  312 bits (802), Expect = e-110
 Identities = 142/202 (70%), Positives = 161/202 (79%), Gaps = 10/202 (4%)

Query: 4   VLKLSKNDKNPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKP 63
           V+  S     PI+VIDNYDSFTYNLCQYMGEL      G HFEVYRNDELTV ELKRK P
Sbjct: 10  VVINSSKQNGPIIVIDNYDSFTYNLCQYMGEL------GCHFEVYRNDELTVEELKRKNP 63

Query: 64  RGVVISPGPGAPQESGISFRTVLELGPTMPLF--CMGLKCIGEALEGRLYVLLLVSCMGK 121
           RGV+ISPGPG PQ+SGIS +TVLELGP +PLF  CMGL+CIGEA  G++         GK
Sbjct: 64  RGVLISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGK 123

Query: 122 -ALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHK 180
            + V+Y+EK E +GL +GL NPFTAGRYH LVIEKD+F SDELEVTAWTEDGLIMAARH+
Sbjct: 124 SSPVHYDEKGE-EGLFSGLPNPFTAGRYHSLVIEKDTFPSDELEVTAWTEDGLIMAARHR 182

Query: 181 KYKHLHGVQFHPESILTSEGKT 202
           KYKH+ GVQFHPESI+T+EGKT
Sbjct: 183 KYKHIQGVQFHPESIITTEGKT 204

Length = 222

>gnl\|CDD\|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional	Back alignment and domain information

>gnl\|CDD\|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase	Back alignment and domain information

>gnl\|CDD\|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|214365 CHL00101, trpG, anthranilate synthase component 2	Back alignment and domain information

>gnl\|CDD\|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>gnl\|CDD\|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated	Back alignment and domain information

>gnl\|CDD\|215729 pfam00117, GATase, Glutamine amidotransferase class-I	Back alignment and domain information

>gnl\|CDD\|233027 TIGR00566, trpG_papA, glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase	Back alignment and domain information

>gnl\|CDD\|181194 PRK08007, PRK08007, para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>gnl\|CDD\|180689 PRK06774, PRK06774, para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>gnl\|CDD\|181566 PRK08857, PRK08857, para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>gnl\|CDD\|237429 PRK13566, PRK13566, anthranilate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade	Back alignment and domain information

>gnl\|CDD\|181927 PRK09522, PRK09522, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|235882 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional	Back alignment and domain information

>gnl\|CDD\|180178 PRK05637, PRK05637, anthranilate synthase component II; Provisional	Back alignment and domain information

>gnl\|CDD\|215481 PLN02889, PLN02889, oxo-acid-lyase/anthranilate synthase	Back alignment and domain information

>gnl\|CDD\|233588 TIGR01823, PabB-fungal, aminodeoxychorismate synthase, fungal clade	Back alignment and domain information

>gnl\|CDD\|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase	Back alignment and domain information

>gnl\|CDD\|234614 PRK00074, guaA, GMP synthase; Reviewed	Back alignment and domain information

>gnl\|CDD\|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit	Back alignment and domain information

>gnl\|CDD\|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>gnl\|CDD\|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II	Back alignment and domain information

>gnl\|CDD\|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

>gnl\|CDD\|224982 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated	Back alignment and domain information

>gnl\|CDD\|178370 PLN02771, PLN02771, carbamoyl-phosphate synthase (glutamine-hydrolyzing)	Back alignment and domain information

>gnl\|CDD\|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|237139 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>gnl\|CDD\|233378 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit	Back alignment and domain information

>gnl\|CDD\|214392 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|219535 pfam07722, Peptidase_C26, Peptidase C26	Back alignment and domain information

>gnl\|CDD\|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		203
COG0512		191	PabA Anthranilate/para-aminobenzoate synthases com	100.0
PRK08007		187	para-aminobenzoate synthase component II; Provisio	100.0
PRK07649		195	para-aminobenzoate/anthranilate synthase glutamine	100.0
PLN02335		222	anthranilate synthase	100.0
TIGR00566		188	trpG_papA glutamine amidotransferase of anthranila	100.0
PRK06774		191	para-aminobenzoate synthase component II; Provisio	100.0
CHL00101		190	trpG anthranilate synthase component 2	100.0
PRK05637		208	anthranilate synthase component II; Provisional	100.0
PRK05670		189	anthranilate synthase component II; Provisional	100.0
KOG0026		223	consensus Anthranilate synthase, beta chain [Amino	100.0
PRK08857		193	para-aminobenzoate synthase component II; Provisio	100.0
PRK06895		190	putative anthranilate synthase component II; Provi	100.0
TIGR00888		188	guaA_Nterm GMP synthase (glutamine-hydrolyzing), N	100.0
cd01743		184	GATase1_Anthranilate_Synthase Type 1 glutamine ami	100.0
PRK07765		214	para-aminobenzoate synthase component II; Provisio	100.0
PRK09522		531	bifunctional glutamine amidotransferase/anthranila	100.0
cd01742		181	GATase1_GMP_Synthase Type 1 glutamine amidotransfe	100.0
PRK00758		184	GMP synthase subunit A; Validated	100.0
COG0518		198	GuaA GMP synthase - Glutamine amidotransferase dom	100.0
PRK14607		534	bifunctional glutamine amidotransferase/anthranila	100.0
PLN02347		536	GMP synthetase	100.0
PF00117		192	GATase: Glutamine amidotransferase class-I; InterP	100.0
PRK00074		511	guaA GMP synthase; Reviewed	100.0
PLN02889		918	oxo-acid-lyase/anthranilate synthase	100.0
TIGR01815		717	TrpE-clade3 anthranilate synthase, alpha proteobac	100.0
PRK13566		720	anthranilate synthase; Provisional	100.0
cd01744		178	GATase1_CPSase Small chain of the glutamine-depend	100.0
PRK09065		237	glutamine amidotransferase; Provisional	100.0
PLN02771		415	carbamoyl-phosphate synthase (glutamine-hydrolyzin	100.0
PRK07053		234	glutamine amidotransferase; Provisional	99.98
PRK12564		360	carbamoyl phosphate synthase small subunit; Review	99.98
TIGR01368		358	CPSaseIIsmall carbamoyl-phosphate synthase, small	99.98
PRK06490		239	glutamine amidotransferase; Provisional	99.98
PRK07567		242	glutamine amidotransferase; Provisional	99.97
CHL00197		382	carA carbamoyl-phosphate synthase arginine-specifi	99.97
PRK05665		240	amidotransferase; Provisional	99.97
PRK12838		354	carbamoyl phosphate synthase small subunit; Review	99.97
COG0505		368	CarA Carbamoylphosphate synthase small subunit [Am	99.97
TIGR01823		742	PabB-fungal aminodeoxychorismate synthase, fungal	99.97
PRK08250		235	glutamine amidotransferase; Provisional	99.97
cd01741		188	GATase1_1 Subgroup of proteins having the Type 1 g	99.97
PRK13146		209	hisH imidazole glycerol phosphate synthase subunit	99.96
PRK13170		196	hisH imidazole glycerol phosphate synthase subunit	99.96
COG0118		204	HisH Glutamine amidotransferase [Amino acid transp	99.96
cd01748		198	GATase1_IGP_Synthase Type 1 glutamine amidotransfe	99.96
CHL00188		210	hisH imidazole glycerol phosphate synthase subunit	99.96
PRK11366		254	puuD gamma-glutamyl-gamma-aminobutyrate hydrolase;	99.95
PRK13181		199	hisH imidazole glycerol phosphate synthase subunit	99.95
PRK13141		205	hisH imidazole glycerol phosphate synthase subunit	99.94
PRK13152		201	hisH imidazole glycerol phosphate synthase subunit	99.94
KOG1622		552	consensus GMP synthase [Nucleotide transport and m	99.94
TIGR01855		196	IMP_synth_hisH imidazole glycerol phosphate syntha	99.94
cd01747		273	GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot	99.94
PRK14004		210	hisH imidazole glycerol phosphate synthase subunit	99.94
cd01745		189	GATase1_2 Subgroup of proteins having the Type 1 g	99.94
cd01746		235	GATase1_CTP_Synthase Type 1 glutamine amidotransfe	99.93
PRK13143		200	hisH imidazole glycerol phosphate synthase subunit	99.93
PRK13525		189	glutamine amidotransferase subunit PdxT; Provision	99.93
PRK13527		200	glutamine amidotransferase subunit PdxT; Provision	99.93
PF07722		217	Peptidase_C26: Peptidase C26; InterPro: IPR011697	99.93
KOG1224		767	consensus Para-aminobenzoate (PABA) synthase ABZ1	99.92
COG2071		243	Predicted glutamine amidotransferases [General fun	99.92
KOG3179		245	consensus Predicted glutamine synthetase [Nucleoti	99.92
PRK06186		229	hypothetical protein; Validated	99.91
PLN02617		538	imidazole glycerol phosphate synthase hisHF	99.9
TIGR00337		525	PyrG CTP synthase. CTP synthase is involved in pyr	99.89
PRK05380		533	pyrG CTP synthetase; Validated	99.89
PRK13142		192	hisH imidazole glycerol phosphate synthase subunit	99.88
KOG0370		1435	consensus Multifunctional pyrimidine synthesis pro	99.88
cd01749		183	GATase1_PB Glutamine Amidotransferase (GATase_I) i	99.88
TIGR03800		184	PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl	99.86
COG0504		533	PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide	99.86
PLN02327		557	CTP synthase	99.86
PRK05368		302	homoserine O-succinyltransferase; Provisional	99.84
TIGR01737		227	FGAM_synth_I phosphoribosylformylglycinamidine syn	99.82
KOG2387		585	consensus CTP synthase (UTP-ammonia lyase) [Nucleo	99.73
PRK03619		219	phosphoribosylformylglycinamidine synthase I; Prov	99.72
PLN02832		248	glutamine amidotransferase subunit of pyridoxal 5'	99.64
KOG1559		340	consensus Gamma-glutamyl hydrolase [Coenzyme trans	99.63
PRK13526		179	glutamine amidotransferase subunit PdxT; Provision	99.58
KOG0623		541	consensus Glutamine amidotransferase/cyclase [Amin	99.58
cd01740		238	GATase1_FGAR_AT Type 1 glutamine amidotransferase	99.43
PRK01175		261	phosphoribosylformylglycinamidine synthase I; Prov	99.31
COG0311		194	PDX2 Predicted glutamine amidotransferase involved	99.22
COG0047		231	PurL Phosphoribosylformylglycinamidine (FGAM) synt	99.2
PF13507		259	GATase_5: CobB/CobQ-like glutamine amidotransferas	99.01
PF01174		188	SNO: SNO glutamine amidotransferase family; InterP	99.0
PF04204		298	HTS: Homoserine O-succinyltransferase ; InterPro:	98.93
cd03131		175	GATase1_HTS Type 1 glutamine amidotransferase (GAT	98.89
TIGR01001		300	metA homoserine O-succinyltransferase. The apparen	98.72
TIGR01735		1310	FGAM_synt phosphoribosylformylglycinamidine syntha	98.62
cd01750		194	GATase1_CobQ Type 1 glutamine amidotransferase (GA	98.59
TIGR01857		1239	FGAM-synthase phosphoribosylformylglycinamidine sy	98.55
PLN03206		1307	phosphoribosylformylglycinamidine synthase; Provis	98.5
PRK05297		1290	phosphoribosylformylglycinamidine synthase; Provis	98.48
cd03130		198	GATase1_CobB Type 1 glutamine amidotransferase (GA	98.38
PHA03366		1304	FGAM-synthase; Provisional	98.02
KOG3210		226	consensus Imidazoleglycerol-phosphate synthase sub	97.95
TIGR01739		1202	tegu_FGAM_synt herpesvirus tegument protein/v-FGAM	97.93
PRK06278		476	cobyrinic acid a,c-diamide synthase; Validated	97.92
cd01653		115	GATase1 Type 1 glutamine amidotransferase (GATase1	97.76
PRK00784		488	cobyric acid synthase; Provisional	97.68
PRK11780		217	isoprenoid biosynthesis protein with amidotransfer	97.67
COG1897		307	MetA Homoserine trans-succinylase [Amino acid tran	97.63
PF07685		158	GATase_3: CobB/CobQ-like glutamine amidotransferas	97.61
cd03128		92	GAT_1 Type 1 glutamine amidotransferase (GATase1)-	97.49
TIGR00379		449	cobB cobyrinic acid a,c-diamide synthase. This mod	97.49
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	97.36
cd03169		180	GATase1_PfpI_1 Type 1 glutamine amidotransferase (	97.28
TIGR01382		166	PfpI intracellular protease, PfpI family. The memb	96.96
COG3442		250	Predicted glutamine amidotransferase [General func	96.96
cd03146		212	GAT1_Peptidase_E Type 1 glutamine amidotransferase	96.92
cd03134		165	GATase1_PfpI_like A type 1 glutamine amidotransfer	96.85
PRK13896		433	cobyrinic acid a,c-diamide synthase; Provisional	96.83
cd03133		213	GATase1_ES1 Type 1 glutamine amidotransferase (GAT	96.83
cd03132		142	GATase1_catalase Type 1 glutamine amidotransferase	96.82
KOG1907		1320	consensus Phosphoribosylformylglycinamidine syntha	96.56
cd03147		231	GATase1_Ydr533c_like Type 1 glutamine amidotransfe	96.53
PRK11574		196	oxidative-stress-resistance chaperone; Provisional	96.47
COG0693		188	ThiJ Putative intracellular protease/amidase [Gene	96.14
PRK05282		233	(alpha)-aspartyl dipeptidase; Validated	96.05
TIGR00313		475	cobQ cobyric acid synthase CobQ.	95.96
COG1492		486	CobQ Cobyric acid synthase [Coenzyme metabolism]	95.59
PRK04155		287	chaperone protein HchA; Provisional	95.55
PRK11249		752	katE hydroperoxidase II; Provisional	95.39
PF01965		147	DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T	95.32
cd03140		170	GATase1_PfpI_3 Type 1 glutamine amidotransferase (	95.27
PF09825		367	BPL_N: Biotin-protein ligase, N terminal; InterPro	95.27
cd03148		232	GATase1_EcHsp31_like Type 1 glutamine amidotransfe	95.25
cd03135		163	GATase1_DJ-1 Type 1 glutamine amidotransferase (GA	94.87
cd03129		210	GAT1_Peptidase_E_like Type 1 glutamine amidotransf	94.86
cd03141		221	GATase1_Hsp31_like Type 1 glutamine amidotransfera	94.83
COG1797		451	CobB Cobyrinic acid a,c-diamide synthase [Coenzyme	94.38
PRK05568		142	flavodoxin; Provisional	93.98
cd03137		187	GATase1_AraC_1 AraC transcriptional regulators hav	93.71
PRK11104		177	hemG protoporphyrinogen oxidase; Provisional	93.62
cd03144		114	GATase1_ScBLP_like Type 1 glutamine amidotransfera	93.53
TIGR01383		179	not_thiJ DJ-1 family protein. This model represent	93.29
PF06283		217	ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A.	92.61
PRK05569		141	flavodoxin; Provisional	92.48
PF06490		109	FleQ: Flagellar regulatory protein FleQ; InterPro:	92.43
cd00886		152	MogA_MoaB MogA_MoaB family. Members of this family	92.43
cd03138		195	GATase1_AraC_2 AraC transcriptional regulators hav	92.35
TIGR02667		163	moaB_proteo molybdenum cofactor biosynthesis prote	92.12
PF00072		112	Response_reg: Response regulator receiver domain;	91.93
cd03139		183	GATase1_PfpI_2 Type 1 glutamine amidotransferase (	91.61
PF13278		166	DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M	90.44
KOG2764		247	consensus Putative transcriptional regulator DJ-1	89.47
cd03136		185	GATase1_AraC_ArgR_like AraC transcriptional regula	89.13
PRK06756		148	flavodoxin; Provisional	88.85
smart00852		135	MoCF_biosynth Probable molybdopterin binding domai	88.62
TIGR02069		250	cyanophycinase cyanophycinase. This model describe	87.79
PRK03673		396	hypothetical protein; Provisional	86.96
cd03145		217	GAT1_cyanophycinase Type 1 glutamine amidotransfer	86.87
PRK14690		419	molybdopterin biosynthesis protein MoeA; Provision	86.53
COG0303		404	MoeA Molybdopterin biosynthesis enzyme [Coenzyme m	86.27
PRK14497		546	putative molybdopterin biosynthesis protein MoeA/u	85.22
PRK09393		322	ftrA transcriptional activator FtrA; Provisional	85.16
PRK09468		239	ompR osmolarity response regulator; Provisional	84.97
PRK05452		479	anaerobic nitric oxide reductase flavorubredoxin;	84.65
COG2185		143	Sbm Methylmalonyl-CoA mutase, C-terminal domain/su	84.46
PRK10680		411	molybdopterin biosynthesis protein MoeA; Provision	84.43
cd00758		133	MoCF_BD MoCF_BD: molybdenum cofactor (MoCF) bindin	84.28
COG1440		102	CelA Phosphotransferase system cellobiose-specific	84.18
PRK01215		264	competence damage-inducible protein A; Provisional	84.16
PRK03767		200	NAD(P)H:quinone oxidoreductase; Provisional	83.72
PF00994		144	MoCF_biosynth: Probable molybdopterin binding doma	83.62
TIGR00177		144	molyb_syn molybdenum cofactor synthesis domain. Th	83.52
PRK11921		394	metallo-beta-lactamase/flavodoxin domain-containin	83.29
PF03698		80	UPF0180: Uncharacterised protein family (UPF0180);	83.27
COG1058		255	CinA Predicted nucleotide-utilizing enzyme related	83.23
cd00885		170	cinA Competence-damaged protein. CinA is the first	82.41
PRK09267		169	flavodoxin FldA; Validated	81.86
PF03575		154	Peptidase_S51: Peptidase family S51; InterPro: IPR	81.66
COG3340		224	PepE Peptidase E [Amino acid transport and metabol	81.18
cd02067		119	B12-binding B12 binding domain (B12-BD). This doma	81.15
PF10087		97	DUF2325: Uncharacterized protein conserved in bact	81.06
PRK04539		296	ppnK inorganic polyphosphate/ATP-NAD kinase; Provi	80.69
PRK01372		304	ddl D-alanine--D-alanine ligase; Reviewed	80.56
PRK09417		193	mogA molybdenum cofactor biosynthesis protein MogA	80.5

>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

Probab=100.00  E-value=9.8e-47  Score=287.11  Aligned_cols=177  Identities=48%  Similarity=0.844  Sum_probs=160.5

Q ss_pred             CCcEEEEeCCchHHHHHHHHHHHhhhhhcCCceEEEEeCCcccHHHHhccCCCEEEECCCCCCCCCcchHHHHHHHhCCC
Q 037843           12 KNPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGAPQESGISFRTVLELGPT   91 (203)
Q Consensus        12 ~~~i~iid~~~~~~~~l~~~l~~~~~~~~~g~~~~v~~~~~~~~~~l~~~~~dgiil~GG~~~~~~~~~~~~~i~~~~~~   91 (203)
                      |+||++|||+|||++||+++++++      |+++.+++.+..+.++++..++|+||||||||.|.+.+...++|+++.++
T Consensus         1 ~~~IL~IDNyDSFtyNLv~yl~~l------g~~v~V~rnd~~~~~~~~~~~pd~iviSPGPG~P~d~G~~~~~i~~~~~~   74 (191)
T COG0512           1 MMMILLIDNYDSFTYNLVQYLREL------GAEVTVVRNDDISLELIEALKPDAIVISPGPGTPKDAGISLELIRRFAGR   74 (191)
T ss_pred             CceEEEEECccchHHHHHHHHHHc------CCceEEEECCccCHHHHhhcCCCEEEEcCCCCChHHcchHHHHHHHhcCC
Confidence            578999999999999999999999      99999999876777777777899999999999999999999999999888


Q ss_pred             Ccee--ehhHHHHHHHhCCeeccccccccccc-eeEEEcccccccccccCCCCceEEeecccceeecCCCCCCCeEEEEE
Q 037843           92 MPLF--CMGLKCIGEALEGRLYVLLLVSCMGK-ALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAW  168 (203)
Q Consensus        92 ~Pil--ClG~Qlla~a~gg~v~~~~~~~~~g~-~~i~~~~~~~~~~lf~~~~~~~~~~~~H~~~v~~~~l~~~~~~~~a~  168 (203)
                      +|||  |||||.|++++||+|.+.. .+.||+ +.+.+..    +.+|++++++|.+.+|||..+.++++ |+.++++|+
T Consensus        75 ~PiLGVCLGHQai~~~fGg~V~~a~-~~~HGK~s~i~h~g----~~iF~glp~~f~v~RYHSLvv~~~~l-P~~l~vtA~  148 (191)
T COG0512          75 IPILGVCLGHQAIAEAFGGKVVRAK-EPMHGKTSIITHDG----SGLFAGLPNPFTVTRYHSLVVDPETL-PEELEVTAE  148 (191)
T ss_pred             CCEEEECccHHHHHHHhCCEEEecC-CCcCCeeeeeecCC----cccccCCCCCCEEEeeEEEEecCCCC-CCceEEEEE
Confidence            9999  9999999999999999998 789999 4333332    57999999999999999999988776 499999999


Q ss_pred             cCC-CcEEEEEeCCCCcEEEEcCCCCCCCCCCCC
Q 037843          169 TED-GLIMAARHKKYKHLHGVQFHPESILTSEGK  201 (203)
Q Consensus       169 s~~-~~v~a~~~~~~~~i~gvQfHPE~~~~~~g~  201 (203)
                      +++ +.++|++++++| ++|+|||||+..|+.|.
T Consensus       149 ~~d~~~IMai~h~~~p-i~gvQFHPESilT~~G~  181 (191)
T COG0512         149 SEDGGVIMAVRHKKLP-IYGVQFHPESILTEYGH  181 (191)
T ss_pred             eCCCCEEEEEeeCCCC-EEEEecCCccccccchH
Confidence            965 599999999999 99999999999999985

>PRK08007 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated	Back alignment and domain information

>PLN02335 anthranilate synthase	Back alignment and domain information

>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase	Back alignment and domain information

>PRK06774 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>CHL00101 trpG anthranilate synthase component 2	Back alignment and domain information

>PRK05637 anthranilate synthase component II; Provisional	Back alignment and domain information

>PRK05670 anthranilate synthase component II; Provisional	Back alignment and domain information

>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08857 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>PRK06895 putative anthranilate synthase component II; Provisional	Back alignment and domain information

>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit	Back alignment and domain information

>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase	Back alignment and domain information

>PRK07765 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase	Back alignment and domain information

>PRK00758 GMP synthase subunit A; Validated	Back alignment and domain information

>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>PLN02347 GMP synthetase	Back alignment and domain information

>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group []	Back alignment and domain information

>PRK00074 guaA GMP synthase; Reviewed	Back alignment and domain information

>PLN02889 oxo-acid-lyase/anthranilate synthase	Back alignment and domain information

>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade	Back alignment and domain information

>PRK13566 anthranilate synthase; Provisional	Back alignment and domain information

>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II	Back alignment and domain information

>PRK09065 glutamine amidotransferase; Provisional	Back alignment and domain information

>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing)	Back alignment and domain information

>PRK07053 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit	Back alignment and domain information

>PRK06490 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK07567 glutamine amidotransferase; Provisional	Back alignment and domain information

>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional	Back alignment and domain information

>PRK05665 amidotransferase; Provisional	Back alignment and domain information

>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade	Back alignment and domain information

>PRK08250 glutamine amidotransferase; Provisional	Back alignment and domain information

>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS)	Back alignment and domain information

>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional	Back alignment and domain information

>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional	Back alignment and domain information

>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit	Back alignment and domain information

>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase	Back alignment and domain information

>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase	Back alignment and domain information

>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK13525 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>PRK13527 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2071 Predicted glutamine amidotransferases [General function prediction only]	Back alignment and domain information

>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK06186 hypothetical protein; Validated	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>TIGR00337 PyrG CTP synthase	Back alignment and domain information

>PRK05380 pyrG CTP synthetase; Validated	Back alignment and domain information

>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]	Back alignment and domain information

>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis	Back alignment and domain information

>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2	Back alignment and domain information

>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN02327 CTP synthase	Back alignment and domain information

>PRK05368 homoserine O-succinyltransferase; Provisional	Back alignment and domain information

>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I	Back alignment and domain information

>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex	Back alignment and domain information

>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK13526 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase	Back alignment and domain information

>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A	Back alignment and domain information

>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ]	Back alignment and domain information

>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi	Back alignment and domain information

>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS)	Back alignment and domain information

>TIGR01001 metA homoserine O-succinyltransferase	Back alignment and domain information

>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ)	Back alignment and domain information

>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II	Back alignment and domain information

>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase	Back alignment and domain information

>PHA03366 FGAM-synthase; Provisional	Back alignment and domain information

>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase	Back alignment and domain information

>PRK06278 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK00784 cobyric acid synthase; Provisional	Back alignment and domain information

>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional	Back alignment and domain information

>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism]	Back alignment and domain information

>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea []	Back alignment and domain information

>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>TIGR01382 PfpI intracellular protease, PfpI family	Back alignment and domain information

>COG3442 Predicted glutamine amidotransferase [General function prediction only]	Back alignment and domain information

>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E	Back alignment and domain information

>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus	Back alignment and domain information

>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional	Back alignment and domain information

>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1	Back alignment and domain information

>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases	Back alignment and domain information

>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein	Back alignment and domain information

>PRK11574 oxidative-stress-resistance chaperone; Provisional	Back alignment and domain information

>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only]	Back alignment and domain information

>PRK05282 (alpha)-aspartyl dipeptidase; Validated	Back alignment and domain information

>TIGR00313 cobQ cobyric acid synthase CobQ	Back alignment and domain information

>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK04155 chaperone protein HchA; Provisional	Back alignment and domain information

>PRK11249 katE hydroperoxidase II; Provisional	Back alignment and domain information

>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity	Back alignment and domain information

>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown	Back alignment and domain information

>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31)	Back alignment and domain information

>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1	Back alignment and domain information

>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins	Back alignment and domain information

>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein	Back alignment and domain information

>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK05568 flavodoxin; Provisional	Back alignment and domain information

>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK11104 hemG protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP)	Back alignment and domain information

>TIGR01383 not_thiJ DJ-1 family protein	Back alignment and domain information

>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A	Back alignment and domain information

>PRK05569 flavodoxin; Provisional	Back alignment and domain information

>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e	Back alignment and domain information

>cd00886 MogA_MoaB MogA_MoaB family	Back alignment and domain information

>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial	Back alignment and domain information

>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []	Back alignment and domain information

>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C	Back alignment and domain information

>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms]	Back alignment and domain information

>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK06756 flavodoxin; Provisional	Back alignment and domain information

>smart00852 MoCF_biosynth Probable molybdopterin binding domain	Back alignment and domain information

>TIGR02069 cyanophycinase cyanophycinase	Back alignment and domain information

>PRK03673 hypothetical protein; Provisional	Back alignment and domain information

>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase	Back alignment and domain information

>PRK14690 molybdopterin biosynthesis protein MoeA; Provisional	Back alignment and domain information

>COG0303 MoeA Molybdopterin biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PRK14497 putative molybdopterin biosynthesis protein MoeA/unknown domain fusion protein; Provisional	Back alignment and domain information

>PRK09393 ftrA transcriptional activator FtrA; Provisional	Back alignment and domain information

>PRK09468 ompR osmolarity response regulator; Provisional	Back alignment and domain information

>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional	Back alignment and domain information

>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]	Back alignment and domain information

>PRK10680 molybdopterin biosynthesis protein MoeA; Provisional	Back alignment and domain information

>cd00758 MoCF_BD MoCF_BD: molybdenum cofactor (MoCF) binding domain (BD)	Back alignment and domain information

>COG1440 CelA Phosphotransferase system cellobiose-specific component IIB [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK01215 competence damage-inducible protein A; Provisional	Back alignment and domain information

>PRK03767 NAD(P)H:quinone oxidoreductase; Provisional	Back alignment and domain information

>PF00994 MoCF_biosynth: Probable molybdopterin binding domain; InterPro: IPR001453 Eukaryotic and prokaryotic molybdoenzymes require a molybdopterin cofactor (MoCF) for their activity	Back alignment and domain information

>TIGR00177 molyb_syn molybdenum cofactor synthesis domain	Back alignment and domain information

>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional	Back alignment and domain information

>PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins	Back alignment and domain information

>COG1058 CinA Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only]	Back alignment and domain information

>cd00885 cinA Competence-damaged protein	Back alignment and domain information

>PRK09267 flavodoxin FldA; Validated	Back alignment and domain information

>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG3340 PepE Peptidase E [Amino acid transport and metabolism]	Back alignment and domain information

>cd02067 B12-binding B12 binding domain (B12-BD)	Back alignment and domain information

>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional	Back alignment and domain information

>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed	Back alignment and domain information

>PRK09417 mogA molybdenum cofactor biosynthesis protein MogA; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		203
1qdl_B		195	The Crystal Structure Of Anthranilate Synthase From		3e-23
1i7q_B		193	Anthranilate Synthase From S. Marcescens Length = 1		5e-18
1i1q_B		192	Structure Of The Cooperative Allosteric Anthranilat		5e-18
1gpm_A		525	Escherichia Coli Gmp Synthetase Complexed With Amp		9e-04

>pdb|1QDL|B Chain B, The Crystal Structure Of Anthranilate Synthase From Sulfolobus Solfataricus Length = 195

Back alignment and structure

Iteration: 1

Score = 104 bits (260), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 70/201 (34%), Positives = 104/201 (51%), Gaps = 37/201 (18%) Query: 16 VVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGAP 75 ++IDNYDSF YN+ Q +GEL G + V RNDE+++ ++R P ++ISPGPG P Sbjct: 5 LIIDNYDSFVYNIAQIVGEL------GSYPIVIRNDEISIKGIERIDPDRLIISPGPGTP 58 Query: 76 QES---GISFRTVLELGPTMPLF--CMGLKCIGEA-----------LEGRLYVLLLVSCM 119 ++ G+S + LG P+ C+G + IG A G++ ++LV+ Sbjct: 59 EKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNS 118 Query: 120 GKALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARH 179 +L Y G++ F A RYH LV+ D + ED IMA H Sbjct: 119 PLSLYY------------GIAKEFKATRYHSLVV--DEVHRPLIVDAISAEDNEIMAIHH 164 Query: 180 KKYKHLHGVQFHPESILTSEG 200 ++Y ++GVQFHPES+ TS G Sbjct: 165 EEYP-IYGVQFHPESVGTSLG 184

PyMOL of 1qdl

>pdb|1I7Q|B Chain B, Anthranilate Synthase From S. Marcescens Length = 193

Back alignment and structure

>pdb|1I1Q|B Chain B, Structure Of The Cooperative Allosteric Anthranilate Synthase From Salmonella Typhimurium Length = 192

Back alignment and structure

>pdb|1GPM|A Chain A, Escherichia Coli Gmp Synthetase Complexed With Amp And Pyrophosphate Length = 525

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		203
1qdl_B		195	Protein (anthranilate synthase (TRPG-SUBUNIT)); tr	2e-77
1i1q_B		192	Anthranilate synthase component II; tryptophan bio	2e-72
3r75_A		645	Anthranilate/para-aminobenzoate synthases compone;	8e-28
1l9x_A		315	Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO	2e-19
2vxo_A		697	GMP synthase [glutamine-hydrolyzing]; proto-oncoge	3e-10
2ywb_A		503	GMP synthase [glutamine-hydrolyzing]; GMP syntheta	3e-09
3tqi_A		527	GMP synthase [glutamine-hydrolyzing]; ligase; 2.84	5e-09
1gpm_A		525	GMP synthetase, XMP aminase; class I glutamine ami	7e-09
2vpi_A		218	GMP synthase; guanine monophosphate synthetase, ph	3e-08
1wl8_A		189	GMP synthase [glutamine-hydrolyzing] subunit A; tr	4e-08
2a9v_A		212	GMP synthase; structural genomics, joint center fo	7e-06
3fij_A		254	LIN1909 protein; 11172J, uncharacterized protein,	1e-05
3uow_A		556	GMP synthetase; structural genomics consortium, SG	1e-05
1o1y_A		239	Conserved hypothetical protein TM1158; flavodoxin-	2e-05

>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195	Back alignment and structure

 Score =  229 bits (587), Expect = 2e-77
 Identities = 67/197 (34%), Positives = 101/197 (51%), Gaps = 23/197 (11%)

Query: 15  IVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGA 74
            ++IDNYDSF YN+ Q +GEL      G +  V RNDE+++  ++R  P  ++ISPGPG 
Sbjct: 4   TLIIDNYDSFVYNIAQIVGEL------GSYPIVIRNDEISIKGIERIDPDRLIISPGPGT 57

Query: 75  P---QESGISFRTVLELGPTMPLF--CMGLKCIGEALEGRLYVLLLVSC---M-GKALVY 125
           P   ++ G+S   +  LG   P+   C+G + IG A   +     +        GK    
Sbjct: 58  PEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAK-----IRRARKVFHGKISNI 112

Query: 126 YNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHKKYKHL 185
                    L  G++  F A RYH LV+++       ++  +  ED  IMA  H++Y  +
Sbjct: 113 ILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHR-PLIVDAISA-EDNEIMAIHHEEYP-I 169

Query: 186 HGVQFHPESILTSEGKT 202
           +GVQFHPES+ TS G  
Sbjct: 170 YGVQFHPESVGTSLGYK 186

PyMOL of 1qdl

>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192	Back alignment and structure

>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Length = 645	Back alignment and structure

>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315	Back alignment and structure

>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697	Back alignment and structure

>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503	Back alignment and structure

>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527	Back alignment and structure

>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525	Back alignment and structure

>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218	Back alignment and structure

>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189	Back alignment and structure

>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212	Back alignment and structure

>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254	Back alignment and structure

>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556	Back alignment and structure

>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		203
1qdl_B		195	Protein (anthranilate synthase (TRPG-SUBUNIT)); tr	100.0
1i1q_B		192	Anthranilate synthase component II; tryptophan bio	100.0
1wl8_A		189	GMP synthase [glutamine-hydrolyzing] subunit A; tr	100.0
3tqi_A		527	GMP synthase [glutamine-hydrolyzing]; ligase; 2.84	100.0
2a9v_A		212	GMP synthase; structural genomics, joint center fo	100.0
2vpi_A		218	GMP synthase; guanine monophosphate synthetase, ph	100.0
3uow_A		556	GMP synthetase; structural genomics consortium, SG	100.0
1gpm_A		525	GMP synthetase, XMP aminase; class I glutamine ami	100.0
2ywb_A		503	GMP synthase [glutamine-hydrolyzing]; GMP syntheta	100.0
3m3p_A		250	Glutamine amido transferase; structural genomics,	100.0
2vxo_A		697	GMP synthase [glutamine-hydrolyzing]; proto-oncoge	99.98
1a9x_B		379	Carbamoyl phosphate synthetase (small chain); amid	99.97
3r75_A		645	Anthranilate/para-aminobenzoate synthases compone;	99.97
3l7n_A		236	Putative uncharacterized protein; glutamine amidot	99.97
1o1y_A		239	Conserved hypothetical protein TM1158; flavodoxin-	99.97
3fij_A		254	LIN1909 protein; 11172J, uncharacterized protein,	99.97
4gud_A		211	Imidazole glycerol phosphate synthase subunit His;	99.96
2w7t_A		273	CTP synthetase, putative cytidine triphosphate syn	99.95
1l9x_A		315	Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO	99.95
3d54_D		213	Phosphoribosylformylglycinamidine synthase 1; alph	99.95
2ywj_A		186	Glutamine amidotransferase subunit PDXT; uncharact	99.94
2v4u_A		289	CTP synthase 2; pyrimidine biosynthesis, glutamine	99.93
1ka9_H		200	Imidazole glycerol phosphtate synthase; riken stru	99.93
2nv0_A		196	Glutamine amidotransferase subunit PDXT; 3-layer(A	99.93
1vco_A		550	CTP synthetase; tetramer, riken structural genomic	99.92
1gpw_B		201	Amidotransferase HISH; lyase/transferase, complex	99.92
1s1m_A		545	CTP synthase; CTP synthetase, UTP:ammonia ligase (	99.91
3nva_A		535	CTP synthase; rossman fold, nucleotide binding, LI	99.91
1q7r_A		219	Predicted amidotransferase; structural genomics, Y	99.91
2iss_D		208	Glutamine amidotransferase subunit PDXT; (beta/alp	99.89
2ywd_A		191	Glutamine amidotransferase subunit PDXT; pyridoxin	99.89
2vdj_A		301	Homoserine O-succinyltransferase; methionine biosy	99.88
1jvn_A		555	Glutamine, bifunctional histidine biosynthesis pro	99.87
2h2w_A		312	Homoserine O-succinyltransferase; TM0881, (EC 2.3.	99.87
2abw_A		227	PDX2 protein, glutaminase; PLP-synthase, vitamin B	99.82
3ugj_A		1303	Phosphoribosylformylglycinamidine synthase; amidot	99.06
1fy2_A		229	Aspartyl dipeptidase; serine protease, catalytic t	98.45
3l4e_A		206	Uncharacterized peptidase LMO0363; hypothetical pr	98.36
4hcj_A		177	THIJ/PFPI domain protein; structural genomics, PSI	97.94
1oi4_A		193	Hypothetical protein YHBO; PFPI/THIJ family, compl	97.89
1vhq_A		232	Enhancing lycopene biosynthesis protein 2; structu	97.59
2rk3_A		197	Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha	97.46
3l18_A		168	Intracellular protease I; gatase1_PFPI_LIKE, hydro	97.46
2ab0_A		205	YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase	97.45
3l3b_A		242	ES1 family protein; ssgcid, NIH, niaid, SBRI, UW,	97.44
1u9c_A		224	APC35852; structural genomics, protein structure i	97.35
3ot1_A		208	4-methyl-5(B-hydroxyethyl)-thiazole monophosphate	97.25
4e08_A		190	DJ-1 beta; flavodoxin-like fold, stress response,	97.23
2vrn_A		190	Protease I, DR1199; cysteine sulfenic acid, DJ-1/T	97.13
3gra_A		202	Transcriptional regulator, ARAC family; transcript	97.05
3ej6_A		688	Catalase-3; heme, hydrogen iron, metal-binding, ox	96.99
3cne_A		175	Putative protease I; structural genomics, PSI-2, M	96.97
2fex_A		188	Conserved hypothetical protein; structural genomic	96.83
3efe_A		212	THIJ/PFPI family protein; structural GEN csgid, ce	96.82
3f5d_A		206	Protein YDEA; unknow protein, PSI-II, nysgrc, stru	96.71
3n7t_A		247	Macrophage binding protein; seattle structural gen	96.66
3uk7_A		396	Class I glutamine amidotransferase-like domain-CO	96.63
3er6_A		209	Putative transcriptional regulator protein; struct	96.53
3uk7_A		396	Class I glutamine amidotransferase-like domain-CO	96.36
3ttv_A		753	Catalase HPII; heme orientation, oxidoreductase; H	96.3
3noq_A		231	THIJ/PFPI family protein; DJ-1 superfamily, isocya	96.15
3fse_A		365	Two-domain protein containing DJ-1/THIJ/PFPI-like	96.13
2iuf_A		688	Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen	96.11
3kkl_A		244	Probable chaperone protein HSP33; peptidase, heat	95.87
1rw7_A		243	YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe	95.83
4gdh_A		194	DJ-1, uncharacterized protein C22E12.03C; unknown	95.36
1sy7_A		715	Catalase 1; heme oxidation, singlet oxygen, oxidor	95.2
3bhn_A		236	THIJ/PFPI domain protein; structural genomics, joi	94.92
3ewn_A		253	THIJ/PFPI family protein; monomer, PSI nysgrc, str	94.63
1n57_A		291	Chaperone HSP31, protein YEDU; alpha-beta sandwich	94.58
2rdm_A		132	Response regulator receiver protein; structural ge	94.52
3eod_A		130	Protein HNR; response regulator, phosphoprotein, t	94.4
3grc_A		140	Sensor protein, kinase; protein structure initiati	94.3
3gt7_A		154	Sensor protein; structural genomics, signal receiv	94.22
3hdg_A		137	Uncharacterized protein; two-component sensor acti	94.17
3cg4_A		142	Response regulator receiver domain protein (CHEY-;	93.95
2qxy_A		142	Response regulator; regulation of transcription, N	93.77
3h5i_A		140	Response regulator/sensory box protein/ggdef domai	93.74
3i42_A		127	Response regulator receiver domain protein (CHEY-	93.53
3kht_A		144	Response regulator; PSI-II, 11023K, structural gen	93.51
3jte_A		143	Response regulator receiver protein; structural ge	93.46
2pbq_A		178	Molybdenum cofactor biosynthesis MOG; molybdopteri	93.44
3a10_A		116	Response regulator; phosphoacceptor, signaling pro	93.37
2zay_A		147	Response regulator receiver protein; structural ge	93.28
2gkg_A		127	Response regulator homolog; social motility, recei	93.18
3cz5_A		153	Two-component response regulator, LUXR family; str	93.18
3hv2_A		153	Response regulator/HD domain protein; PSI-2, NYSGX	92.97
4e7p_A		150	Response regulator; DNA binding, cytosol, transcri	92.96
2gwr_A		238	DNA-binding response regulator MTRA; two-component	92.85
3hdv_A		136	Response regulator; PSI-II, structural genomics, P	92.8
3kbq_A		172	Protein TA0487; structural genomics, CINA, protein	92.65
3en0_A		291	Cyanophycinase; serine protease, beta peptide spec	92.65
2rjn_A		154	Response regulator receiver:metal-dependent phosph	92.61
3cnb_A		143	DNA-binding response regulator, MERR family; signa	92.56
2j48_A		119	Two-component sensor kinase; pseudo-receiver, circ	92.5
3snk_A		135	Response regulator CHEY-like protein; P-loop conta	92.44
3hzh_A		157	Chemotaxis response regulator (CHEY-3); phosphatas	92.32
2pln_A		137	HP1043, response regulator; signaling protein; 1.8	92.27
3lte_A		132	Response regulator; structural genomics, PSI, prot	92.2
3rht_A		259	(gatase1)-like protein; structural genomics, PSI-b	92.07
3cg0_A		140	Response regulator receiver modulated diguanylate	91.98
1k66_A		149	Phytochrome response regulator RCPB; CHEY homologu	91.97
3f6c_A		134	Positive transcription regulator EVGA; structural	91.92
1mvo_A		136	PHOP response regulator; phosphate regulon, transc	91.85
2qr3_A		140	Two-component system response regulator; structura	91.75
1kgs_A		225	DRRD, DNA binding response regulator D; DNA-bindin	91.61
1qkk_A		155	DCTD, C4-dicarboxylate transport transcriptional r	91.44
1srr_A		124	SPO0F, sporulation response regulatory protein; as	91.38
3rfq_A		185	Pterin-4-alpha-carbinolamine dehydratase MOAB2; st	91.16
3crn_A		132	Response regulator receiver domain protein, CHEY-;	91.11
3ff4_A		122	Uncharacterized protein; structural genomics, PSI-	90.79
3f6p_A		120	Transcriptional regulatory protein YYCF; unphospho	90.71
3gl9_A		122	Response regulator; beta-sheet, surrounded by alph	90.68
2g2c_A		167	Putative molybdenum cofactor biosynthesis protein;	90.66
3pzy_A		164	MOG; ssgcid, seattle structural genomics center fo	90.38
2ark_A		188	Flavodoxin; FMN, structural genomics, PSI, structu	90.33
3cfy_A		137	Putative LUXO repressor protein; structural genomi	90.0
3nhm_A		133	Response regulator; protein structure initiative I	89.98
1tmy_A		120	CHEY protein, TMY; chemotaxis, phosphoryl transfer	89.96
2is8_A		164	Molybdopterin biosynthesis enzyme, MOAB; globular	89.85
2lpm_A		123	Two-component response regulator; transcription re	89.81
2b4a_A		138	BH3024; flavodoxin-like fold, structural genomics,	89.62
2qvg_A		143	Two component response regulator; NYSGXRC, PSI-2,	89.56
2fz5_A		137	Flavodoxin; alpha/beta doubly-wound topology, non-	89.54
2pl1_A		121	Transcriptional regulatory protein PHOP; CHEY-like	89.33
1k68_A		140	Phytochrome response regulator RCPA; phosphorylate	89.31
1y5e_A		169	Molybdenum cofactor biosynthesis protein B; struct	89.3
3eq2_A		394	Probable two-component response regulator; adaptor	89.29
3rqi_A		184	Response regulator protein; structural genomics, s	88.88
1dbw_A		126	Transcriptional regulatory protein FIXJ; doubly wo	88.65
4dad_A		146	Putative pilus assembly-related protein; response	88.59
3mgk_A		211	Intracellular protease/amidase related enzyme (THI	88.56
3fni_A		159	Putative diflavin flavoprotein A 3; alpha-beta pro	88.26
3r0j_A		250	Possible two component system response transcript	88.18
3lua_A		140	Response regulator receiver protein; two-component	88.0
3ilh_A		146	Two component response regulator; NYSGXRC, PSI-II,	87.97
3to5_A		134	CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p	87.68
2jba_A		127	Phosphate regulon transcriptional regulatory PROT;	87.43
2pjk_A		178	178AA long hypothetical molybdenum cofactor biosyn	87.34
1zgz_A		122	Torcad operon transcriptional regulatory protein;	87.17
1mkz_A		172	Molybdenum cofactor biosynthesis protein B; MAD, W	87.16
1ys7_A		233	Transcriptional regulatory protein PRRA; response	87.08
2a9o_A		120	Response regulator; essential protein, YYCF/YYCG h	86.95
1xhf_A		123	DYE resistance, aerobic respiration control protei	86.84
5nul_A		138	Flavodoxin; electron transport, flavoprotein, FMN;	86.84
1jlj_A		189	Gephyrin; globular alpha/beta fold, structural pro	86.71
3eul_A		152	Possible nitrate/nitrite response transcriptional	86.65
3iwt_A		178	178AA long hypothetical molybdenum cofactor biosy	86.43
3kto_A		136	Response regulator receiver protein; PSI-II,struct	86.25
4eg0_A		317	D-alanine--D-alanine ligase; structural genomics,	86.12
2a5l_A		200	Trp repressor binding protein WRBA; APC5760, PA094	86.01
1yio_A		208	Response regulatory protein; transcription regulat	86.0
3heb_A		152	Response regulator receiver domain protein (CHEY);	85.92
3c3m_A		138	Response regulator receiver protein; structural ge	85.46
3t8y_A		164	CHEB, chemotaxis response regulator protein-glutam	85.42
2ayx_A		254	Sensor kinase protein RCSC; two independent struct	85.36
2qv0_A		143	Protein MRKE; structural genomics, transcription,	85.28
2an1_A		292	Putative kinase; structural genomics, PSI, protein	85.21
1zh2_A		121	KDP operon transcriptional regulatory protein KDPE	84.93
3t6k_A		136	Response regulator receiver; flavodoxin-like, stru	84.55
3f6r_A		148	Flavodoxin; FMN binding, oxidized, electron transp	84.38
3b2n_A		133	Uncharacterized protein Q99UF4; structural genomic	84.37
3mm4_A		206	Histidine kinase homolog; receiver domain, CKI1, c	83.79
2qsj_A		154	DNA-binding response regulator, LUXR family; struc	83.61
3hly_A		161	Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein	83.44
3m6m_D		143	Sensory/regulatory protein RPFC; RPFF, REC, enoyl-	83.41
2oqr_A		230	Sensory transduction protein REGX3; response regul	83.38
2zki_A		199	199AA long hypothetical Trp repressor binding prot	83.16
3kcn_A		151	Adenylate cyclase homolog; SGX, PSI 2, structural	83.1
1mb3_A		124	Cell division response regulator DIVK; signal tran	83.1
3eqz_A		135	Response regulator; structural genomics, unknown f	82.69
3c97_A		140	Signal transduction histidine kinase; structural g	82.66
1iow_A		306	DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho	82.19
1di6_A		195	MOGA, molybdenum cofactor biosynthetic enzyme; MOC	82.19
2hqr_A		223	Putative transcriptional regulator; phosporylation	81.43
3cu5_A		141	Two component transcriptional regulator, ARAC FAM;	81.12
2qzj_A		136	Two-component response regulator; 11017X, PSI-II,	81.05
3rpe_A		218	MDAB, modulator of drug activity B; structural gen	80.79
1p6q_A		129	CHEY2; chemotaxis, signal transduction, response r	80.27

>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1	Back alignment and structure

Probab=100.00  E-value=9.2e-38  Score=243.67  Aligned_cols=176  Identities=39%  Similarity=0.673  Sum_probs=146.8

Q ss_pred             CcEEEEeCCchHHHHHHHHHHHhhhhhcCCceEEEEeCCcccHHHHhccCCCEEEECCCCCCCCCc---chHHHHHHHhC
Q 037843           13 NPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGAPQES---GISFRTVLELG   89 (203)
Q Consensus        13 ~~i~iid~~~~~~~~l~~~l~~~~~~~~~g~~~~v~~~~~~~~~~l~~~~~dgiil~GG~~~~~~~---~~~~~~i~~~~   89 (203)
                      +||+|||++++|+.++.+++++.      |+.+.+++++..+.+++...++|||||+||++++.+.   +...++++++.
T Consensus         2 ~mi~iid~~~s~~~~~~~~l~~~------G~~~~v~~~~~~~~~~~~~~~~dglil~gG~~~~~~~~~~~~~~~~i~~~~   75 (195)
T 1qdl_B            2 DLTLIIDNYDSFVYNIAQIVGEL------GSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLG   75 (195)
T ss_dssp             CEEEEEECSCSSHHHHHHHHHHT------TCEEEEEETTTSCHHHHHHHCCSEEEECCCSSCTTSHHHHTTHHHHHHHHT
T ss_pred             CEEEEEECCCchHHHHHHHHHhC------CCEEEEEeCCCCCHHHHhhCCCCEEEECCCCCChhhhhhhhHHHHHHHHhc
Confidence            45999999999999999999999      9999999876445667765468999999999998763   33456777777


Q ss_pred             CCCcee--ehhHHHHHHHhCCeecccccccccc-ceeEEEcccccccccccCCCCceEEeecccceeecCCCCCCCeEEE
Q 037843           90 PTMPLF--CMGLKCIGEALEGRLYVLLLVSCMG-KALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVT  166 (203)
Q Consensus        90 ~~~Pil--ClG~Qlla~a~gg~v~~~~~~~~~g-~~~i~~~~~~~~~~lf~~~~~~~~~~~~H~~~v~~~~l~~~~~~~~  166 (203)
                      .++|+|  |+|||+|+.++||++.+.. ...+| +..+.++.. ..+++|+++++.+.++++|++.|..   +|++++++
T Consensus        76 ~~~PvLGIC~G~QlL~~~~gg~v~~~~-~~~~g~~~~v~~~~~-~~~~l~~~~~~~~~v~~~H~~~v~~---l~~~~~vl  150 (195)
T 1qdl_B           76 KRTPILGVCLGHQAIGYAFGAKIRRAR-KVFHGKISNIILVNN-SPLSLYYGIAKEFKATRYHSLVVDE---VHRPLIVD  150 (195)
T ss_dssp             TTSCEEEETHHHHHHHHHTTCEEEEEE-EEEEEEEEEEEECCS-SCCSTTTTCCSEEEEEEEEEEEEEC---CCTTEEEE
T ss_pred             CCCcEEEEehHHHHHHHHhCCEEeccC-CCcCCCceEEEECCC-CHhHHHhcCCCceEEeccccchhhh---CCCCcEEE
Confidence            789999  9999999999999999876 34455 466766532 1128999998889999999999976   67999999


Q ss_pred             EEc-CCCcEEEEEeCCCCcEEEEcCCCCCCCCCCC
Q 037843          167 AWT-EDGLIMAARHKKYKHLHGVQFHPESILTSEG  200 (203)
Q Consensus       167 a~s-~~~~v~a~~~~~~~~i~gvQfHPE~~~~~~g  200 (203)
                      |++ +++.++|+++++++ ++|+|||||++.+++|
T Consensus       151 a~s~~~g~i~a~~~~~~~-~~gvQfHPE~~~~~~g  184 (195)
T 1qdl_B          151 AISAEDNEIMAIHHEEYP-IYGVQFHPESVGTSLG  184 (195)
T ss_dssp             EEESSSCCEEEEEESSSS-EEEESSBTTSTTCTTH
T ss_pred             EEECCCCcEEEEEeCCCC-EEEEecCCCCCCCccH
Confidence            999 89999999998876 9999999999987765

PyMOL of 1qdl

>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B*	Back alignment and structure

>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A	Back alignment and structure

>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii}	Back alignment and structure

>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1	Back alignment and structure

>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens}	Back alignment and structure

>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum}	Back alignment and structure

>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1	Back alignment and structure

>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A*	Back alignment and structure

>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A*	Back alignment and structure

>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens}	Back alignment and structure

>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B*	Back alignment and structure

>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A*	Back alignment and structure

>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans}	Back alignment and structure

>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1	Back alignment and structure

>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua}	Back alignment and structure

>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae}	Back alignment and structure

>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei}	Back alignment and structure

>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1	Back alignment and structure

>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima}	Back alignment and structure

>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii}	Back alignment and structure

>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A	Back alignment and structure

>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1	Back alignment and structure

>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B*	Back alignment and structure

>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A	Back alignment and structure

>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B	Back alignment and structure

>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A*	Back alignment and structure

>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1	Back alignment and structure

>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima}	Back alignment and structure

>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A	Back alignment and structure

>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A	Back alignment and structure

>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima}	Back alignment and structure

>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G	Back alignment and structure

>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A*	Back alignment and structure

>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A	Back alignment and structure

>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii}	Back alignment and structure

>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2	Back alignment and structure

>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A	Back alignment and structure

>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ...	Back alignment and structure

>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A	Back alignment and structure

>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2	Back alignment and structure

>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2	Back alignment and structure

>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0	Back alignment and structure

>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster}	Back alignment and structure

>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans}	Back alignment and structure

>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida}	Back alignment and structure

>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa}	Back alignment and structure

>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2	Back alignment and structure

>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis}	Back alignment and structure

>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis}	Back alignment and structure

>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0	Back alignment and structure

>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana}	Back alignment and structure

>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus}	Back alignment and structure

>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana}	Back alignment and structure

>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ...	Back alignment and structure

>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A	Back alignment and structure

>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A*	Back alignment and structure

>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A*	Back alignment and structure

>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A	Back alignment and structure

>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A	Back alignment and structure

>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3	Back alignment and structure

>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4}	Back alignment and structure

>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV}	Back alignment and structure

>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A	Back alignment and structure

>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae}	Back alignment and structure

>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12}	Back alignment and structure

>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP}	Back alignment and structure

>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB}	Back alignment and structure

>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0	Back alignment and structure

>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1}	Back alignment and structure

>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima}	Back alignment and structure

>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901}	Back alignment and structure

>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0	Back alignment and structure

>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0	Back alignment and structure

>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>2pbq_A Molybdenum cofactor biosynthesis MOG; molybdopterin, MPT, structural genomics, NPPSFA, national PR protein structural and functional analyses; 1.70A {Aquifex aeolicus} PDB: 2qq1_A 3mci_A 3mcj_A 3k6a_A* 2f7w_A 2f7y_A 2fuw_A	Back alignment and structure

>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A*	Back alignment and structure

>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans}	Back alignment and structure

>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A	Back alignment and structure

>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP}	Back alignment and structure

>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5}	Back alignment and structure

>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A	Back alignment and structure

>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A	Back alignment and structure

>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0	Back alignment and structure

>3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum}	Back alignment and structure

>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP}	Back alignment and structure

>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis}	Back alignment and structure

>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea}	Back alignment and structure

>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus}	Back alignment and structure

>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti}	Back alignment and structure

>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi}	Back alignment and structure

>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A	Back alignment and structure

>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri}	Back alignment and structure

>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus}	Back alignment and structure

>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1	Back alignment and structure

>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12}	Back alignment and structure

>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1	Back alignment and structure

>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis}	Back alignment and structure

>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A*	Back alignment and structure

>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A	Back alignment and structure

>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E	Back alignment and structure

>3rfq_A Pterin-4-alpha-carbinolamine dehydratase MOAB2; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: B3P; 2.25A {Mycobacterium marinum} PDB: 3tcr_A	Back alignment and structure

>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1}	Back alignment and structure

>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A	Back alignment and structure

>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C	Back alignment and structure

>2g2c_A Putative molybdenum cofactor biosynthesis protein; structural genomics, PSI, protein structure initiative; 1.50A {Corynebacterium diphtheriae} SCOP: c.57.1.1	Back alignment and structure

>3pzy_A MOG; ssgcid, seattle structural genomics center for infectious DI biosynthetic protein; 1.80A {Mycobacterium avium subsp} PDB: 3oi9_A 2g4r_A	Back alignment and structure

>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8	Back alignment and structure

>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus}	Back alignment and structure

>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y	Back alignment and structure

>2is8_A Molybdopterin biosynthesis enzyme, MOAB; globular alpha/beta fold, structu genomics, NPPSFA; 1.64A {Thermus thermophilus} PDB: 3mch_A	Back alignment and structure

>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti}	Back alignment and structure

>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1	Back alignment and structure

>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp}	Back alignment and structure

>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1	Back alignment and structure

>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A	Back alignment and structure

>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1	Back alignment and structure

>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1	Back alignment and structure

>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A	Back alignment and structure

>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei}	Back alignment and structure

>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A*	Back alignment and structure

>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A	Back alignment and structure

>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A	Back alignment and structure

>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis}	Back alignment and structure

>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum}	Back alignment and structure

>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii}	Back alignment and structure

>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae}	Back alignment and structure

>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A	Back alignment and structure

>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1	Back alignment and structure

>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B	Back alignment and structure

>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A	Back alignment and structure

>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A*	Back alignment and structure

>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A	Back alignment and structure

>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A*	Back alignment and structure

>1jlj_A Gephyrin; globular alpha/beta fold, structural protein; 1.60A {Homo sapiens} SCOP: c.57.1.1 PDB: 1ihc_A	Back alignment and structure

>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>3iwt_A 178AA long hypothetical molybdenum cofactor biosy protein B; biosynthesis, structural genomics, UNKN function, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0	Back alignment and structure

>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A	Back alignment and structure

>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A*	Back alignment and structure

>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A	Back alignment and structure

>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0	Back alignment and structure

>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1}	Back alignment and structure

>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima}	Back alignment and structure

>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A	Back alignment and structure

>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae}	Back alignment and structure

>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium}	Back alignment and structure

>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A	Back alignment and structure

>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0	Back alignment and structure

>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A*	Back alignment and structure

>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus}	Back alignment and structure

>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A	Back alignment and structure

>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301}	Back alignment and structure

>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV}	Back alignment and structure

>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV}	Back alignment and structure

>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii}	Back alignment and structure

>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica}	Back alignment and structure

>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A	Back alignment and structure

>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0	Back alignment and structure

>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40}	Back alignment and structure

>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A*	Back alignment and structure

>1di6_A MOGA, molybdenum cofactor biosynthetic enzyme; MOCO, MOCO biosynthesis, gephyrin function; 1.45A {Escherichia coli} SCOP: c.57.1.1 PDB: 1di7_A	Back alignment and structure

>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori}	Back alignment and structure

>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg}	Back alignment and structure

>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile}	Back alignment and structure

>3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis}	Back alignment and structure

>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		203
d1qdlb_		195	c.23.16.1 (B:) Anthranilate synthase GAT subunit,	4e-35
d1i7qb_		192	c.23.16.1 (B:) Anthranilate synthase GAT subunit,	4e-29
d1wl8a1		188	c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA	2e-23
d2a9va1		196	c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA	4e-23
d1gpma2		205	c.23.16.1 (A:3-207) GMP synthetase {Escherichia co	6e-18
d1a9xb2		228	c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe	1e-16
d1l9xa_		288	c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho	1e-10
d1o1ya_		230	c.23.16.1 (A:) Hypothetical protein TM1158 {Thermo	7e-07
d2nv0a1		195	c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bac	0.001
d1k9vf_		200	c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i	0.002

>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Anthranilate synthase GAT subunit, TrpG
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

 Score =  120 bits (302), Expect = 4e-35
 Identities = 62/192 (32%), Positives = 92/192 (47%), Gaps = 13/192 (6%)

Query: 15  IVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPG- 73
            ++IDNYDSF YN+ Q +GEL      G +  V RNDE+++  ++R  P  ++ISPGPG 
Sbjct: 4   TLIIDNYDSFVYNIAQIVGEL------GSYPIVIRNDEISIKGIERIDPDRLIISPGPGT 57

Query: 74  --APQESGISFRTVLELGPTMPLFCMGLKCIGEALEGRLYVLLL-VSCMGKALVYYNEKE 130
               ++ G+S   +  LG   P+  + L            +        GK         
Sbjct: 58  PEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNN 117

Query: 131 EADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEVTAWTEDGLIMAARHKKYKHLHGVQF 190
               L  G++  F A RYH LV+++       +      ED  IMA  H++Y  ++GVQF
Sbjct: 118 SPLSLYYGIAKEFKATRYHSLVVDEVHR--PLIVDAISAEDNEIMAIHHEEYP-IYGVQF 174

Query: 191 HPESILTSEGKT 202
           HPES+ TS G  
Sbjct: 175 HPESVGTSLGYK 186

PyMOL of d1qdlb_

>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192	Back information, alignment and structure

>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196	Back information, alignment and structure

>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205	Back information, alignment and structure

>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228	Back information, alignment and structure

>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Length = 230	Back information, alignment and structure

>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Length = 195	Back information, alignment and structure

>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		203
d1qdlb_		195	Anthranilate synthase GAT subunit, TrpG {Archaeon	100.0
d1wl8a1		188	GMP synthase subunit A, GuaAA {Archaeon Pyrococcus	100.0
d2a9va1		196	GMP synthase subunit A, GuaAA {Archaeon Thermoplas	100.0
d1i7qb_		192	Anthranilate synthase GAT subunit, TrpG {Serratia	100.0
d1gpma2		205	GMP synthetase {Escherichia coli [TaxId: 562]}	100.0
d1a9xb2		228	Carbamoyl phosphate synthetase, small subunit C-te	100.0
d1o1ya_		230	Hypothetical protein TM1158 {Thermotoga maritima [	99.97
d1l9xa_		288	gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta	99.93
d2nv0a1		195	Hypothetical protein YaaE {Bacillus subtilis [TaxI	99.92
d1s1ma1		258	CTP synthase PyrG, C-terminal domain {Escherichia	99.91
d1vcoa1		250	CTP synthase PyrG, C-terminal domain {Thermus ther	99.9
d1jvna2		232	GAT subunit, HisH, (or domain) of imidazoleglycero	99.89
d1ka9h_		195	GAT subunit, HisH, (or domain) of imidazoleglycero	99.88
d1k9vf_		200	GAT subunit, HisH, (or domain) of imidazoleglycero	99.88
d1q7ra_		202	Hypothetical protein YaaE {Bacillus stearothermoph	99.88
d2ghra1		281	Homoserine O-succinyltransferase HTS (MetA) {Bacil	99.81
d2abwa1		218	Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p	99.8
d1t3ta2		262	FGAM synthase PurL, amidotransferase domain {Salmo	99.16
d1vhqa_		217	Putative sigma cross-reacting protein 27A (SCRP-27	97.94
d1p80a1		156	Catalase, C-terminal domain {Escherichia coli, HPI	97.46
d1oi4a1		170	Hypothetical protein YhbO {Escherichia coli [TaxId	97.35
d1g2ia_		166	Intracellular protease {Archaeon Pyrococcus horiko	97.22
d2fexa1		188	Hypothetical protein Atu0886 {Agrobacterium tumefa	97.17
d1p5fa_		186	DJ-1 {Human (Homo sapiens) [TaxId: 9606]}	97.07
d1sy7a1		184	Catalase, C-terminal domain {Neurospora crassa [Ta	96.94
d1u9ca_		221	GK2698 ortholog {Bacillus stearothermophilus [TaxI	96.88
d1ys7a2		121	Transcriptional regulatory protein PrrA, N-termina	96.02
d2ab0a1		195	Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]	95.68
d1mvoa_		121	PhoP receiver domain {Bacillus subtilis [TaxId: 14	95.41
d1krwa_		123	NTRC receiver domain {Salmonella typhimurium [TaxI	95.35
d2ayxa1		133	Sensor kinase protein RcsC, C-terminal domain {Esc	95.13
d1peya_		119	Sporulation response regulator Spo0F {Bacillus sub	94.73
d1ycga1		149	Nitric oxide reductase C-terminal domain {Moorella	94.7
d1xhfa1		121	Aerobic respiration control protein ArcA, N-termin	94.7
d1yioa2		128	Response regulatory protein StyR, N-terminal domai	94.64
d1kgsa2		122	PhoB receiver domain {Thermotoga maritima [TaxId:	94.31
d1ny5a1		137	Transcriptional activator sigm54 (NtrC1), N-termin	94.25
d2pl1a1		119	PhoP receiver domain {Escherichia coli [TaxId: 562	94.14
d1mb3a_		123	Cell division response regulator DivK {Caulobacter	94.06
d1qvwa_		236	Hypothetical protein Ydr533Cp {Baker's yeast (Sacc	93.84
d1u0sy_		118	CheY protein {Thermotoga maritima [TaxId: 2336]}	93.83
d2arka1		184	Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]}	93.76
d1qkka_		140	Transcriptional regulatory protein DctD, receiver	93.64
d1zesa1		121	PhoB receiver domain {Escherichia coli [TaxId: 562	93.5
d1e5da1		152	Rubredoxin oxygen:oxidoreductase (ROO), C-terminal	93.14
d2b4aa1		118	Hypothetical protein BH3024 {Bacillus halodurans [	92.83
d2a5la1		196	Trp repressor binding protein WrbA {Pseudomonas ae	92.54
d1iowa1		96	D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge	92.47
d2a9pa1		117	DNA-binding response regulator MicA, N-terminal do	92.38
d1dbwa_		123	Transcriptional regulatory protein FixJ, receiver	91.67
d1dcfa_		134	Receiver domain of the ethylene receptor {Thale cr	91.33
d2fz5a1		137	Flavodoxin {Megasphaera elsdenii [TaxId: 907]}	91.15
d1uz5a3		148	MoeA, central domain {Archaeon Pyrococcus horikosh	90.38
d2ftsa3		155	Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId	90.31
d1zgza1		120	TorCAD operon transcriptional regulator TorD, N-te	90.3
d2nqra3		149	MoeA, central domain {Escherichia coli [TaxId: 562	90.22
d1ydga_		201	Trp repressor binding protein WrbA {Deinococcus ra	90.03
d7reqa2		168	Methylmalonyl-CoA mutase alpha subunit, C-terminal	89.74
d1n57a_		279	HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]}	89.02
d1zh2a1		119	Transcriptional regulatory protein KdpE, N-termina	88.16
d1w25a1		139	Response regulator PleD, receiver domain {Caulobac	87.78
d1jbea_		128	CheY protein {Escherichia coli [TaxId: 562]}	87.7
d1iiba_		103	Enzyme IIB-cellobiose {Escherichia coli [TaxId: 56	87.27
d1vmea1		148	ROO-like flavoprotein TM0755, C-terminal domain {T	86.84
d1z0sa1		249	Inorganic polyphosphate/ATP-NAD kinase PpnK {Archa	86.41
d2pv7a2		152	Prephenate dehydrogenase TyrA {Haemophilus influen	86.29
d1mkza_		170	MoaB {Escherichia coli [TaxId: 562]}	86.26
d1ccwa_		137	Glutamate mutase, small subunit {Clostridium cochl	85.85
d1p6qa_		129	CheY protein {Sinorhizobium meliloti, CheY2 [TaxId	84.97
d1qo0d_		189	Positive regulator of the amidase operon AmiR {Pse	84.8
d2r25b1		128	Response regulator Sin1 {Baker's yeast (Saccharomy	84.16
d1wu2a3		144	MoeA, central domain {Pyrococcus horikoshii, PH164	84.08
d1sc6a2		132	Phosphoglycerate dehydrogenase {Escherichia coli [	83.62
d1fyea_		229	Aspartyl dipeptidase PepE {Salmonella typhimurium	83.24
d1f4pa_		147	Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}	80.73
d1y5ea1		155	MoaB {Bacillus cereus [TaxId: 1396]}	80.39

>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Anthranilate synthase GAT subunit, TrpG
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=100.00  E-value=1.5e-39  Score=251.76  Aligned_cols=178  Identities=39%  Similarity=0.642  Sum_probs=146.7

Q ss_pred             CCcEEEEeCCchHHHHHHHHHHHhhhhhcCCceEEEEeCCcccHHHHhccCCCEEEECCCCCCCCCcch---HHHHHHHh
Q 037843           12 KNPIVVIDNYDSFTYNLCQYMGELELELSQGYHFEVYRNDELTVAELKRKKPRGVVISPGPGAPQESGI---SFRTVLEL   88 (203)
Q Consensus        12 ~~~i~iid~~~~~~~~l~~~l~~~~~~~~~g~~~~v~~~~~~~~~~l~~~~~dgiil~GG~~~~~~~~~---~~~~i~~~   88 (203)
                      |.||||||++|||++|++++|+++      |+++++++++..+.++++..++||||++|||+++.+...   ...+.+.+
T Consensus         1 ~~~~liiD~~dsft~Ni~~~l~~l------G~~~~vi~~d~~~~~~i~~~~~~gvilsgGp~~~~~~~~~~~~~~i~~~~   74 (195)
T d1qdlb_           1 MDLTLIIDNYDSFVYNIAQIVGEL------GSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYL   74 (195)
T ss_dssp             CCEEEEEECSCSSHHHHHHHHHHT------TCEEEEEETTTSCHHHHHHHCCSEEEECCCSSCTTSHHHHTTHHHHHHHH
T ss_pred             CCEEEEEECCCchHHHHHHHHHhC------CCeEEEEeCCCCCHHHHHhhCCCccccCCCCCccccccccccchhhhhhh
Confidence            568999999999999999999999      999999998777888888778999999999999987543   23334446


Q ss_pred             CCCCcee--ehhHHHHHHHhCCeeccccccccccc-eeEEEcccccccccccCCCCceEEeecccceeecCCCCCCCeEE
Q 037843           89 GPTMPLF--CMGLKCIGEALEGRLYVLLLVSCMGK-ALVYYNEKEEADGLLAGLSNPFTAGRYHGLVIEKDSFRSDELEV  165 (203)
Q Consensus        89 ~~~~Pil--ClG~Qlla~a~gg~v~~~~~~~~~g~-~~i~~~~~~~~~~lf~~~~~~~~~~~~H~~~v~~~~l~~~~~~~  165 (203)
                      ..++|+|  |||||+|+.++|+++.+.. ...+|. ..+... ......+|.++++.+.++++|++.+..   .+.++..
T Consensus        75 ~~~~PiLGIClG~Qll~~~~G~~v~~~~-~~~~~~~~~~~~~-~~~~~~lf~~~~~~~~~~~~h~~~~~~---~~~~~~~  149 (195)
T d1qdlb_          75 GKRTPILGVCLGHQAIGYAFGAKIRRAR-KVFHGKISNIILV-NNSPLSLYYGIAKEFKATRYHSLVVDE---VHRPLIV  149 (195)
T ss_dssp             TTTSCEEEETHHHHHHHHHTTCEEEEEE-EEEEEEEEEEEEC-CSSCCSTTTTCCSEEEEEEEEEEEEEC---CCTTEEE
T ss_pred             cCCCCEEEeehhhhhhhhccCCEEEeec-ccccccccccccc-cccccccccCCCccceeeecceeeeec---cccCccc
Confidence            7899999  9999999999999999887 344554 333333 233467999999999999999999876   5567766


Q ss_pred             EEEc-CCCcEEEEEeCCCCcEEEEcCCCCCCCCCCCC
Q 037843          166 TAWT-EDGLIMAARHKKYKHLHGVQFHPESILTSEGK  201 (203)
Q Consensus       166 ~a~s-~~~~v~a~~~~~~~~i~gvQfHPE~~~~~~g~  201 (203)
                      ++.+ +++.++|+++++++ +||+|||||++.++.|.
T Consensus       150 ~~~~~~~~~i~ai~~~~~~-i~GvQFHPE~~~s~~G~  185 (195)
T d1qdlb_         150 DAISAEDNEIMAIHHEEYP-IYGVQFHPESVGTSLGY  185 (195)
T ss_dssp             EEEESSSCCEEEEEESSSS-EEEESSBTTSTTCTTHH
T ss_pred             ceeccCCCcEEEEEECCCC-EEEEEcCCCCCCCcchH
Confidence            6544 67899999999887 99999999999998874

PyMOL of d1qdlb_

>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}	Back information, alignment and structure

>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]}	Back information, alignment and structure

>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]}	Back information, alignment and structure

>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]}	Back information, alignment and structure

>d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Archaeon Pyrococcus horikoshii, PH0582 [TaxId: 53953]}	Back information, alignment and structure

>d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2nqra3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}	Back information, alignment and structure

>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1mkza_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]}	Back information, alignment and structure

>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}	Back information, alignment and structure

>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}	Back information, alignment and structure

>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure