Citrus Sinensis ID: 037847
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 542 | ||||||
| 24461866 | 890 | NBS-LRR type disease resistance protein | 0.981 | 0.597 | 0.463 | 1e-122 | |
| 24461865 | 892 | NBS-LRR type disease resistance protein | 0.981 | 0.596 | 0.464 | 1e-116 | |
| 24461864 | 899 | NBS-LRR type disease resistance protein | 0.976 | 0.588 | 0.456 | 1e-112 | |
| 24461863 | 889 | NBS-LRR type disease resistance protein | 0.985 | 0.600 | 0.453 | 1e-109 | |
| 225443158 | 903 | PREDICTED: probable disease resistance p | 0.974 | 0.584 | 0.425 | 1e-106 | |
| 24461861 | 890 | NBS-LRR type disease resistance protein | 0.974 | 0.593 | 0.448 | 1e-105 | |
| 224055915 | 880 | cc-nbs-lrr resistance protein [Populus t | 0.981 | 0.604 | 0.407 | 1e-103 | |
| 224122896 | 820 | cc-nbs-lrr resistance protein [Populus t | 0.964 | 0.637 | 0.410 | 2e-99 | |
| 225442867 | 893 | PREDICTED: probable disease resistance p | 0.964 | 0.585 | 0.419 | 3e-99 | |
| 255553103 | 910 | Disease resistance protein RPS5, putativ | 0.979 | 0.583 | 0.412 | 7e-99 |
| >gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 444 bits (1141), Expect = e-122, Method: Compositional matrix adjust.
Identities = 254/548 (46%), Positives = 352/548 (64%), Gaps = 16/548 (2%)
Query: 4 EKLEVYSLAHDKAWELFQEMVERSTLDSHTSIPELAETLARECGGLPLALKIVGRAMKSQ 63
+K +V L+ AWELFQ+ V TL S I +LA+T A+ECGGLPLAL +GRAM +
Sbjct: 306 KKFKVACLSDIDAWELFQQKVGEETLKS-PDIRQLAQTAAKECGGLPLALITIGRAMACK 364
Query: 64 RKVGDWKRAINKMRTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCYLYPEDYEIP 123
+ +W AI +RTS+S+F G+ EV+ LKFSYDSL +D +RSCLLYC LYPEDY I
Sbjct: 365 KTPEEWTYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCLLYCCLYPEDYCIS 424
Query: 124 KRELIDYWISEGFVYDFD------DGCDFIDDLLQACLLEEEGDDHVKMHDMIREMSLWI 177
K LID WI EGF+ + D G + LL ACLLEE GD VKMHD++R+M+LWI
Sbjct: 425 KEILIDCWIGEGFLTERDRFGEQNQGYHILGILLHACLLEEGGDGEVKMHDVVRDMALWI 484
Query: 178 ACTVDKEEQNFLVRAGVKLTEAPKVEEWEGAKRISLTANGIGSLSEIPTCPRLVTLLLDG 237
AC ++KE+ NFLV AGV L EAP V WE A+R+SL N I +LSE+ TCP L+TL L+
Sbjct: 485 ACAIEKEKDNFLVYAGVGLIEAPDVSGWEKARRLSLMHNQITNLSEVATCPHLLTLFLNE 544
Query: 238 NRIEEITDGFFQSLSTLRVLSLRGNFPPSTLPSGISGLVSLHHLDLSSTDITGLPQELKA 297
N ++ I + FF+ + +L+VL+L + + LP GIS LVSL HLDLS + I LP ELKA
Sbjct: 545 NELQMIHNDFFRFMPSLKVLNL-ADSSLTNLPEGISKLVSLQHLDLSKSSIEELPLELKA 603
Query: 298 LEKLRYLNLDYAFHLSIIPHQLISCFSKLEVLRLCGCGRFGVIKGKEGNVLCDGAEPLMK 357
L L+ LNL+Y + L+ IP QLIS S+L VLR+ + E ++L G E +++
Sbjct: 604 LVNLKCLNLEYTWSLTTIPRQLISNLSRLHVLRMFAASHSAFDRASEDSILFGGGELIVE 663
Query: 358 ELLGLKHLNVLSWSFGSSLAVQKFLKYPKLVSITQSVWVECGTYTRPPFNVLHLAYMENL 417
ELLGLK+L V+S++ SS +Q FL KL S T+++ ++C + V LA ++ L
Sbjct: 664 ELLGLKYLEVISFTLRSSHGLQSFLSSHKLRSCTRALLLQCFNDS-TSLEVSALADLKQL 722
Query: 418 QELELESC-NLEEMKIDSTEEVKKLFRNGFRNLNTVVLRSC-RGKDLTWLVFVQNLKQLN 475
L + C LEE+K+D T EV++ F +L V + +C + KDLT+LVF NL+ +
Sbjct: 723 NRLWITECKKLEELKMDYTREVQQFV---FHSLKKVEILACSKLKDLTFLVFAPNLESIE 779
Query: 476 MQGF-TMEEIISVEKLSDISEVIGSEHNFFPRLEYLTMWRGTNLKSVYPNPQPFPKLKKI 534
+ G MEE++S+ K +++ EV+ + N F +L+ L ++ TNLKS+Y P PFP LK +
Sbjct: 780 LMGCPAMEEMVSMGKFAEVPEVVAN-LNPFAKLQNLKLFGATNLKSIYWKPLPFPHLKSM 838
Query: 535 QAFHCRQL 542
HC +L
Sbjct: 839 SFSHCYKL 846
|
Source: Citrus trifoliata Species: Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|224055915|ref|XP_002298700.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222845958|gb|EEE83505.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224122896|ref|XP_002318943.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857319|gb|EEE94866.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255553103|ref|XP_002517594.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223543226|gb|EEF44758.1| Disease resistance protein RPS5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 542 | ||||||
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.952 | 0.577 | 0.398 | 8e-85 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.953 | 0.582 | 0.377 | 2.4e-83 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.953 | 0.581 | 0.383 | 3.6e-82 | |
| TAIR|locus:2036214 | 851 | AT1G15890 [Arabidopsis thalian | 0.964 | 0.614 | 0.375 | 5.8e-82 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.966 | 0.587 | 0.364 | 7.4e-82 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.946 | 0.580 | 0.382 | 2.5e-81 | |
| TAIR|locus:2201986 | 885 | RFL1 "AT1G12210" [Arabidopsis | 0.952 | 0.583 | 0.373 | 4.1e-81 | |
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.950 | 0.572 | 0.363 | 6.2e-78 | |
| TAIR|locus:2197739 | 762 | AT1G61300 [Arabidopsis thalian | 0.948 | 0.674 | 0.369 | 3.4e-77 | |
| TAIR|locus:2170892 | 848 | AT5G43730 [Arabidopsis thalian | 0.968 | 0.619 | 0.355 | 8.1e-76 |
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 849 (303.9 bits), Expect = 8.0e-85, P = 8.0e-85
Identities = 221/555 (39%), Positives = 305/555 (54%)
Query: 4 EKLEVYSLAHDKAWELFQEMVERSTLDSHTSIPELAETLARECGGLPLALKIVGRAMKSQ 63
+ +EV L ++AWELFQ V +TL H IPELA +A +C GLPLAL ++G M +
Sbjct: 306 DPMEVSCLEPNEAWELFQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACK 365
Query: 64 RKVGDWKRAINKMRTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCYLYPEDYEIP 123
R V +W+ AI+ + + A++F GM E++ LK+SYD+L+ ++++ C LYC L+PEDY +
Sbjct: 366 RMVQEWRNAIDVLSSYAAEFPGM-EQILPILKYSYDNLNKEQVKPCFLYCSLFPEDYRME 424
Query: 124 KRELIDYWISEGFVYXXXXXXXXXXX-------LLQACLLEEEG--DDHVKMHDMIREMS 174
K LIDYWI EGF+ L++ACLL EE + VKMHD++REM+
Sbjct: 425 KERLIDYWICEGFIDENESRERALSQGYEIIGILVRACLLLEEAINKEQVKMHDVVREMA 484
Query: 175 LWIACTVDKEEQNFLVRAGVKLTEAPKVEEWEGAKRISLTANGIGSLSEIPTCPRLVTLL 234
LWIA + + ++ +V+ GV L E PKV+ W +R+SL N I LS P C L TL
Sbjct: 485 LWIASDLGEHKERCIVQVGVGLREVPKVKNWSSVRRMSLMENEIEILSGSPECLELTTLF 544
Query: 235 LDGN-RIEEITDGFFQSLSTLRVLSLRGNFPPSTLPSGISGLVSLHHLDLSSTDITGLPQ 293
L N + I+D FF+ + L VL L GN LP+ IS LVSL +LDLS T I LP
Sbjct: 545 LQKNDSLLHISDEFFRCIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTYIKRLPV 604
Query: 294 ELKALEKLRYLNLDYAFHLSIIPHQLISCFSKLEVLRLCGCGRFGVIKGKEGNVLCDGAE 353
L+ L+KLRYL LDY L I IS S L L+L + + D +
Sbjct: 605 GLQELKKLRYLRLDYMKRLKSISG--ISNISSLRKLQLL-----------QSKMSLDMS- 650
Query: 354 PLMKELLGLKHLNVLSWSFGSSLAVQKFLKYPKLVSITQSVWVECGTYTRPPFNVLHLAY 413
L++EL L+HL VL+ S SSL V+K L P+LV Q + V G VL L
Sbjct: 651 -LVEELQLLEHLEVLNISIKSSLVVEKLLNAPRLVKCLQ-ILVLRGVQEESS-GVLTLPD 707
Query: 414 MENLQELELESCNLEEMKID----STEEVKKLFRNGFRNLNTVVLRSCRG-KDLTWLVFV 468
M+NL ++ + C + E+KI+ S + NL+TV + SC G KDLTWL+F
Sbjct: 708 MDNLNKVIIRKCGMCEIKIERKTLSLSSNRSPKTQFLHNLSTVHISSCDGLKDLTWLLFA 767
Query: 469 QNLKQLN-MQGFTMEEIISVEKLSDISEVIGSEHNFFPRLEYLTMWRGTNLKSVYPNPQP 527
NL L + +E II+ EK +S +I F +LE L + L+S+Y P
Sbjct: 768 PNLTSLEVLDSELVEGIINQEKAMTMSGIIP-----FQKLESLRLHNLAMLRSIYWQPLS 822
Query: 528 FPKLKKIQAFHCRQL 542
FP LK I C +L
Sbjct: 823 FPCLKTIHITKCPEL 837
|
|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 542 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 9e-34 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 6e-08 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 2e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 4e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.003 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.004 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 129 bits (326), Expect = 9e-34
Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
Query: 4 EKLEVYSLAHDKAWELFQEMVERSTLDSHTSIPELAETLARECGGLPLALKIVGRAMKSQ 63
+ EV SL +++WELF V L + E+A+ + +C GLPLALK++G + +
Sbjct: 149 KPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFK 208
Query: 64 RKVGDWKRAINKMRTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCYLYPEDYEIP 123
V +W+ + ++ + G+ EV S L SYD+L L+ C LY L+PEDY I
Sbjct: 209 STVQEWEHVLEQLNNELAGRDGL-NEVLSILSLSYDNLP-MHLKRCFLYLALFPEDYNIR 266
Query: 124 KRELIDYWISEGFVYDFDD 142
K +LI WI+EGFV D
Sbjct: 267 KEQLIKLWIAEGFVIPSDI 285
|
Length = 285 |
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 542 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.89 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.88 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.85 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.85 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.81 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.79 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.79 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.76 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.75 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.63 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.6 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.52 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.52 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.51 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.47 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.45 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.44 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.43 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.42 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.42 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.29 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.27 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.24 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.17 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.97 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.96 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.94 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.77 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.75 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.72 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.7 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.65 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.57 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.56 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.53 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.49 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.49 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.46 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.43 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.42 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.41 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.28 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.21 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.18 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.17 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.11 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.09 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.03 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.97 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.95 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.83 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.83 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.57 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.56 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.5 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.48 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.31 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.29 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.26 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.23 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.09 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.75 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.74 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.65 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.56 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.2 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.84 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.8 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 94.9 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.8 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.45 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.38 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.16 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.1 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 90.72 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 90.68 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 90.57 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 90.57 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 89.75 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 88.34 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 87.01 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 87.01 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 86.15 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 84.95 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 83.96 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-64 Score=540.36 Aligned_cols=515 Identities=41% Similarity=0.666 Sum_probs=415.1
Q ss_pred CCeeecCCCChhhHHHHHHHHhccccCCCCCCHHHHHHHHHHHhCCChhHHHHHHHHHhcCCChhHHHHHHHHHhcc-cC
Q 037847 3 AEKLEVYSLAHDKAWELFQEMVERSTLDSHTSIPELAETLARECGGLPLALKIVGRAMKSQRKVGDWKRAINKMRTS-AS 81 (542)
Q Consensus 3 ~~~~~l~~L~~~~a~~Lf~~~a~~~~~~~~~~~~~~~~~i~~kc~GlPlai~~ig~~L~~~~~~~~W~~~~~~l~~~-~~ 81 (542)
...+++++|.++|||+||++.||......++.+.++|++||++|+|+|||++++|+.|+.|.+.++|+++.+.+.+. ..
T Consensus 309 ~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~ 388 (889)
T KOG4658|consen 309 DYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAA 388 (889)
T ss_pred CccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccC
Confidence 46799999999999999999999886667777999999999999999999999999999999999999999999887 45
Q ss_pred CCCCChHHHHHHHHhhcCCCCchhhhHHHhhhccCCCCcccChHHHHHHHHHcCCcccc-------chhchHHHHHHHhc
Q 037847 82 KFSGMKEEVFSRLKFSYDSLSTDELRSCLLYCYLYPEDYEIPKRELIDYWISEGFVYDF-------DDGCDFIDDLLQAC 154 (542)
Q Consensus 82 ~~~~~~~~~~~~l~~sy~~L~~~~~k~cfl~~~~fp~~~~~~~~~Li~~w~a~g~i~~~-------~~~~~~~~~L~~~~ 154 (542)
..+++.+.++++|++|||.||+ ++|.||+|||+||+||.|++++||.+||||||+.+. ++|+.|+++|+.++
T Consensus 389 ~~~~~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~ 467 (889)
T KOG4658|consen 389 DFSGMEESILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRAS 467 (889)
T ss_pred CCCchhhhhHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHH
Confidence 5567788999999999999996 999999999999999999999999999999999773 89999999999999
Q ss_pred ccccc----CCCeEEeehHHHHHHHHHHcccCcccceEEEecCcccccCCcccccccceEEEeecCCcCCCCCCCCCCCc
Q 037847 155 LLEEE----GDDHVKMHDMIREMSLWIACTVDKEEQNFLVRAGVKLTEAPKVEEWEGAKRISLTANGIGSLSEIPTCPRL 230 (542)
Q Consensus 155 l~~~~----~~~~~~mhdl~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~L 230 (542)
++..+ ....|+|||+++++|.+++.+....+++.++..+......|....+..+|++++.++.+..++.-..+++|
T Consensus 468 Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L 547 (889)
T KOG4658|consen 468 LLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKL 547 (889)
T ss_pred HHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCcc
Confidence 99985 45899999999999999999877777777777776777789999999999999999999999888888899
Q ss_pred cEEEccCcc--cccccchhhccCCCccEEEecCCCCCCcCccccCCCCCCCEEeccCCCCCcccHHhhcCCCCCEEeccC
Q 037847 231 VTLLLDGNR--IEEITDGFFQSLSTLRVLSLRGNFPPSTLPSGISGLVSLHHLDLSSTDITGLPQELKALEKLRYLNLDY 308 (542)
Q Consensus 231 ~~L~l~~~~--~~~~~~~~~~~l~~L~~L~l~~~~~~~~lp~~i~~l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~l~~ 308 (542)
++|.+.+|. +..++..+|..++.|++||+++|.....+|++|+.|.+||||+++++.++.+|.++++|++|.+|++..
T Consensus 548 ~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~ 627 (889)
T KOG4658|consen 548 RTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEV 627 (889)
T ss_pred ceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecccc
Confidence 999999996 777888889999999999999998999999999999999999999999999999999999999999999
Q ss_pred CcccCccchhhcCCCCCCcEEeccCccccccccCCCCccccCCCcchhHhhccccCCceeeeEecchHHHHHhhcCchhh
Q 037847 309 AFHLSIIPHQLISCFSKLEVLRLCGCGRFGVIKGKEGNVLCDGAEPLMKELLGLKHLNVLSWSFGSSLAVQKFLKYPKLV 388 (542)
Q Consensus 309 ~~~~~~lp~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~l~~~~~~~ 388 (542)
+..+..+|. +...|++||+|.+..... ......+.++..|++|+.+++........+.+..+..+.
T Consensus 628 ~~~l~~~~~-i~~~L~~Lr~L~l~~s~~-------------~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~ 693 (889)
T KOG4658|consen 628 TGRLESIPG-ILLELQSLRVLRLPRSAL-------------SNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLR 693 (889)
T ss_pred ccccccccc-hhhhcccccEEEeecccc-------------ccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHH
Confidence 977777755 366799999999976542 335567888899999999999776665556677777777
Q ss_pred ccceeEEeccccCCCCCceecccccccccceeeecccCccceeeccchhhcccccc-cccccCEEEEccCCC-CCcchhh
Q 037847 389 SITQSVWVECGTYTRPPFNVLHLAYMENLQELELESCNLEEMKIDSTEEVKKLFRN-GFRNLNTVVLRSCRG-KDLTWLV 466 (542)
Q Consensus 389 ~~l~~l~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~-~l~~L~~L~L~~c~~-~~~~~l~ 466 (542)
...+.+.+.++ ......+.+..+.+|+.|.|.+|.+.+....+... .... .|+++.++.+.+|.. ..+.|..
T Consensus 694 ~~~~~l~~~~~---~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~---~~~~~~f~~l~~~~~~~~~~~r~l~~~~ 767 (889)
T KOG4658|consen 694 SLLQSLSIEGC---SKRTLISSLGSLGNLEELSILDCGISEIVIEWEES---LIVLLCFPNLSKVSILNCHMLRDLTWLL 767 (889)
T ss_pred HHhHhhhhccc---ccceeecccccccCcceEEEEcCCCchhhcccccc---cchhhhHHHHHHHHhhccccccccchhh
Confidence 77776665432 23445567788999999999999998754433221 1111 256777777777777 7777777
Q ss_pred hccCcceEEEec-cchhhhcccccccccccccCCcCCCCCcccee-ecccCCcccccCCCCCCCCCcceEeeccCCC
Q 037847 467 FVQNLKQLNMQG-FTMEEIISVEKLSDISEVIGSEHNFFPRLEYL-TMWRGTNLKSVYPNPQPFPKLKKIQAFHCRQ 541 (542)
Q Consensus 467 ~l~~L~~L~L~~-~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~l~~c~~l~~~~~~~~~~p~L~~L~i~~C~~ 541 (542)
..|+|+.|.+.. ..+++++..+....... .....|.++..+ .+.+.+.+.++.+.+..+++|+.+.+..||+
T Consensus 768 f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~---~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~ 841 (889)
T KOG4658|consen 768 FAPHLTSLSLVSCRLLEDIIPKLKALLELK---ELILPFNKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVEECPK 841 (889)
T ss_pred ccCcccEEEEecccccccCCCHHHHhhhcc---cEEecccccccceeeecCCCCceeEecccCccchhheehhcCcc
Confidence 777888888877 55555443332211100 012345555555 3555555555544444445555555555554
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 542 | ||||
| 2z80_A | 353 | Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu | 4e-06 | ||
| 2z7x_A | 549 | Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu | 2e-05 | ||
| 3rfs_A | 272 | Design Of A Binding Scaffold Based On Variable Lymp | 2e-04 | ||
| 3zyn_A | 321 | Crystal Structure Of The N-Terminal Leucine Rich Re | 8e-04 |
| >pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 | Back alignment and structure |
|
| >pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 | Back alignment and structure |
| >pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 | Back alignment and structure |
| >pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 542 | |||
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 8e-29 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 2e-27 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-18 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-17 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-11 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-11 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-09 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-18 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-17 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-14 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 8e-13 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-09 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 7e-18 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 8e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-17 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-16 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-13 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-12 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-11 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-17 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-14 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-14 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 9e-14 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-13 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-08 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-17 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-15 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 8e-14 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-17 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-15 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-15 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-14 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-17 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 9e-17 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-14 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-16 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 6e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-16 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-14 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-13 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-13 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-12 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-10 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-16 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-13 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-16 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-13 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-09 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-16 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-14 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-13 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-11 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-10 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 9e-16 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 7e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-15 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-12 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-10 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-15 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-14 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 6e-14 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-12 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 9e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-15 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-13 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-10 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-15 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-14 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-14 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-13 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-12 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-09 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-15 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-14 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-14 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-13 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-13 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-13 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-13 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-12 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-14 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-13 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-14 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-14 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 5e-14 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 4e-13 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-12 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-14 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-12 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-13 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-13 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 7e-12 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 7e-12 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-08 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-13 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 4e-11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 8e-10 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-13 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-08 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 5e-13 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 5e-13 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 8e-12 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-10 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 6e-13 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-08 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 6e-13 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-12 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 7e-12 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-11 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-12 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-11 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-10 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-12 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 5e-09 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-12 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-10 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-10 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-10 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-11 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-11 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-10 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-07 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-11 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-11 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-09 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-11 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-10 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-11 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-11 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-10 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 5e-11 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-08 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-08 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 5e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 5e-11 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 5e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-10 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-10 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-10 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-07 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-10 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-10 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-07 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 8e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-10 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-10 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 5e-10 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 6e-10 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 8e-10 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-10 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 9e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 7e-08 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-09 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-07 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-09 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 3e-08 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 6e-08 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-04 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 5e-08 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 2e-06 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 3e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-05 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 2e-07 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 6e-07 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 1e-06 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 2e-06 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 4e-06 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 3e-06 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 7e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-05 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 4e-05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 9e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 9e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 5e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 5e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 9e-04 |
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
Score = 119 bits (300), Expect = 8e-29
Identities = 29/177 (16%), Positives = 64/177 (36%), Gaps = 20/177 (11%)
Query: 11 LAHDKAWELFQEMVERSTLDSHTSIPELAETLARECGGLPLALKIVGRAMKSQRKVGDWK 70
L +K E+ +PE A ++ +EC G PL + ++G ++ W+
Sbjct: 286 LGKEKGLEILS----LFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPN--RWE 339
Query: 71 RAINKMRTSASKF-----SGMKEEVFSRLKFSYDSLSTDELRSCLLYCYLYPEDYEIPKR 125
+ +++ K S E + + S + L +++ + +D ++P +
Sbjct: 340 YYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLRE-DIKDYYTDLSILQKDVKVPTK 398
Query: 126 ELIDYWISEGFVYDFDDGCDFIDDLLQACLLEEEGDDHV---KMHDMIREMSLWIAC 179
L W E D + + + LL + + +HD+ + C
Sbjct: 399 VLCILWDMETEE-----VEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNC 450
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 542 | |||
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.94 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.94 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.93 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.93 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.92 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.92 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.91 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.91 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.91 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.91 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.91 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.91 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.9 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.9 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.9 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.9 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.9 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.9 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.9 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.9 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.9 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.9 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.9 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.89 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.89 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.89 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.89 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.89 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.89 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.89 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.88 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.88 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.88 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.88 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.88 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.87 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.87 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.87 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.87 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.87 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.86 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.86 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.86 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.86 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.86 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.86 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.85 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.85 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.85 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.85 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.84 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.84 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.83 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.83 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.82 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.82 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.82 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.82 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.81 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.81 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.81 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.8 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.79 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.79 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.78 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.78 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.77 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.76 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.76 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.75 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.75 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.75 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.75 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.74 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.74 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.74 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.73 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.73 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.72 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.72 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.72 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.72 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.71 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.71 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.68 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.68 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.67 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.67 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.67 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.66 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.65 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.65 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.64 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.63 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.63 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.62 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.61 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.61 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.6 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.6 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.6 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.58 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.58 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.58 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.57 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.56 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.56 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.55 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.55 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.54 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.53 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.53 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.51 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.5 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.49 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.47 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.46 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.45 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.44 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.43 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.42 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.41 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.41 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.38 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.38 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.38 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.37 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.36 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.28 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.28 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.26 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.22 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.21 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.18 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.17 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.16 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.14 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.12 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.1 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.08 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.04 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.99 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.91 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.83 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.78 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.76 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.67 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.54 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.51 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.37 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.22 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.02 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.98 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.87 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.83 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.81 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.78 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.64 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.35 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.3 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.3 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 96.38 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 96.28 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.55 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.41 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.42 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 93.62 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 93.22 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.44 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 91.16 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 82.69 |
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
Probab=99.94 E-value=1.1e-25 Score=223.03 Aligned_cols=293 Identities=17% Similarity=0.209 Sum_probs=173.1
Q ss_pred cCcccccCCcccccccceEEEeecCCcCCCCCCCCCCCccEEEccCcccccccchhhccCCCccEEEecCCCCCCcCccc
Q 037847 192 AGVKLTEAPKVEEWEGAKRISLTANGIGSLSEIPTCPRLVTLLLDGNRIEEITDGFFQSLSTLRVLSLRGNFPPSTLPSG 271 (542)
Q Consensus 192 ~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~lp~~ 271 (542)
.+.....++.+..+.+++.|++.++.+..++.+..+++|++|++++|.+..++. +..+++|++|++++| .+..+|.
T Consensus 52 ~~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~L~~L~L~~n~i~~~~~--~~~l~~L~~L~l~~n-~i~~~~~- 127 (347)
T 4fmz_A 52 AGEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISA--LQNLTNLRELYLNED-NISDISP- 127 (347)
T ss_dssp CSSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG--GTTCTTCSEEECTTS-CCCCCGG-
T ss_pred eCCccccchhhhhcCCccEEEccCCccccchhhhcCCcCCEEEccCCcccCchH--HcCCCcCCEEECcCC-cccCchh-
Confidence 333444444444455555555555555555445555555555555555444322 455555555555555 3444443
Q ss_pred cCCCCCCCEEeccCCCCCcccHHhhcCCCCCEEeccCCcccCccchhhcCCCCCCcEEeccCccccccccCCCCccccCC
Q 037847 272 ISGLVSLHHLDLSSTDITGLPQELKALEKLRYLNLDYAFHLSIIPHQLISCFSKLEVLRLCGCGRFGVIKGKEGNVLCDG 351 (542)
Q Consensus 272 i~~l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~l~~~~~~~~lp~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~ 351 (542)
+..+++|++|++++|.....+..+..+++|++|++++| .+..++. +..+++|++|++++|.+.+
T Consensus 128 ~~~l~~L~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~-~~~~~~~--~~~l~~L~~L~l~~n~l~~------------- 191 (347)
T 4fmz_A 128 LANLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTES-KVKDVTP--IANLTDLYSLSLNYNQIED------------- 191 (347)
T ss_dssp GTTCTTCCEEECTTCTTCCCCGGGTTCTTCCEEECCSS-CCCCCGG--GGGCTTCSEEECTTSCCCC-------------
T ss_pred hccCCceeEEECCCCCCcccccchhhCCCCcEEEecCC-CcCCchh--hccCCCCCEEEccCCcccc-------------
Confidence 55555555555555522222223555555555555555 3333333 4455555555555554321
Q ss_pred CcchhHhhccccCCceeeeEecchHHHHHhhcCchhhccceeEEeccccCCCCCceecccccccccceeeecccCcccee
Q 037847 352 AEPLMKELLGLKHLNVLSWSFGSSLAVQKFLKYPKLVSITQSVWVECGTYTRPPFNVLHLAYMENLQELELESCNLEEMK 431 (542)
Q Consensus 352 ~~~~~~~l~~L~~L~~l~~~~~~~~~~~~l~~~~~~~~~l~~l~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~ 431 (542)
+..+..+++|+.++++.+....... ......++.+++.++..... ..+..+++|++|++++|.+..++
T Consensus 192 ----~~~~~~l~~L~~L~l~~n~l~~~~~----~~~~~~L~~L~l~~n~l~~~----~~~~~l~~L~~L~l~~n~l~~~~ 259 (347)
T 4fmz_A 192 ----ISPLASLTSLHYFTAYVNQITDITP----VANMTRLNSLKIGNNKITDL----SPLANLSQLTWLEIGTNQISDIN 259 (347)
T ss_dssp ----CGGGGGCTTCCEEECCSSCCCCCGG----GGGCTTCCEEECCSSCCCCC----GGGTTCTTCCEEECCSSCCCCCG
T ss_pred ----cccccCCCccceeecccCCCCCCch----hhcCCcCCEEEccCCccCCC----cchhcCCCCCEEECCCCccCCCh
Confidence 1125666777777776554332211 22335567777776653221 22667788888888888776631
Q ss_pred eccchhhcccccccccccCEEEEccCCCCCcchhhhccCcceEEEeccchhhhcccccccccccccCCcCCCCCccceee
Q 037847 432 IDSTEEVKKLFRNGFRNLNTVVLRSCRGKDLTWLVFVQNLKQLNMQGFTMEEIISVEKLSDISEVIGSEHNFFPRLEYLT 511 (542)
Q Consensus 432 ~~~~~~~~~~~~~~l~~L~~L~L~~c~~~~~~~l~~l~~L~~L~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~ 511 (542)
. ...+++|+.|++++|.+..++.+..+++|++|++++|.+.+... .....+++|+.|+
T Consensus 260 --~--------~~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~L~~n~l~~~~~------------~~l~~l~~L~~L~ 317 (347)
T 4fmz_A 260 --A--------VKDLTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGNEDM------------EVIGGLTNLTTLF 317 (347)
T ss_dssp --G--------GTTCTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCGGGH------------HHHHTCTTCSEEE
T ss_pred --h--------HhcCCCcCEEEccCCccCCChhhcCCCCCCEEECcCCcCCCcCh------------hHhhccccCCEEE
Confidence 1 13478899999999988555778888999999999988776543 2456789999999
Q ss_pred cccCCcccccCCCCCCCCCcceEeeccCC
Q 037847 512 MWRGTNLKSVYPNPQPFPKLKKIQAFHCR 540 (542)
Q Consensus 512 l~~c~~l~~~~~~~~~~p~L~~L~i~~C~ 540 (542)
+.+|+ +..++. ...+++|++|++++|+
T Consensus 318 L~~n~-l~~~~~-~~~l~~L~~L~l~~N~ 344 (347)
T 4fmz_A 318 LSQNH-ITDIRP-LASLSKMDSADFANQV 344 (347)
T ss_dssp CCSSS-CCCCGG-GGGCTTCSEESSSCC-
T ss_pred ccCCc-cccccC-hhhhhccceeehhhhc
Confidence 99986 666544 6679999999999985
|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 542 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 3e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-09 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-05 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-05 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-06 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-06 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 2e-05 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 2e-05 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 4e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 5e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.003 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.002 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.003 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.003 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.003 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 59.1 bits (142), Expect = 3e-10
Identities = 18/109 (16%), Positives = 38/109 (34%), Gaps = 10/109 (9%)
Query: 2 DAEKLEVYSLAHDKAWELFQEMVERSTLDSHTSIPELAETLARECGGLPLALKIVGRAMK 61
E +EV SL D+ ++ + + ++ G P L + ++ +
Sbjct: 176 TCEFIEVTSLEIDECYDFLEAYGMPMPVGEK--EEDVLNKTIELSSGNPATLMMFFKSCE 233
Query: 62 SQRKVGDWKRAINKMRTSASKFSGMKEEVFSRLKFSYDSLSTDELRSCL 110
+ + NK+ + V +SY SL+ L+ C+
Sbjct: 234 P-KTFEKMAQLNNKLESR------GLVGVECITPYSYKSLAM-ALQRCV 274
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 542 | |||
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.85 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.83 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.82 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.76 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.74 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.73 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.7 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.68 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.68 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.66 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.65 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.65 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.64 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.63 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.59 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.58 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.54 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.49 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.47 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.44 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.44 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.42 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.38 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.36 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.36 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.33 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.17 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.09 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.04 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.98 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.94 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.89 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.87 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.87 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.64 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.72 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.72 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.65 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.38 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.94 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.06 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 85.73 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Probab=99.85 E-value=1.6e-20 Score=186.07 Aligned_cols=278 Identities=17% Similarity=0.232 Sum_probs=171.8
Q ss_pred cccccceEEEeecCCcCCCCCCCCCCCccEEEccCcccccccchhhccCCCccEEEecCCCCCCcCccccCCCCCCCEEe
Q 037847 203 EEWEGAKRISLTANGIGSLSEIPTCPRLVTLLLDGNRIEEITDGFFQSLSTLRVLSLRGNFPPSTLPSGISGLVSLHHLD 282 (542)
Q Consensus 203 ~~~~~l~~l~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~lp~~i~~l~~L~~L~ 282 (542)
..+.+++.|++.++.++.+..+..+++|++|++++|.++.+++ ++.+++|++|++++| .+..++ .++.+.+|++|+
T Consensus 41 ~~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n-~i~~i~-~l~~l~~L~~L~ 116 (384)
T d2omza2 41 TDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNN-QIADIT-PLANLTNLTGLT 116 (384)
T ss_dssp HHHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSS-CCCCCG-GGTTCTTCCEEE
T ss_pred HHhCCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc--ccCCccccccccccc-cccccc-cccccccccccc
Confidence 3445677777777777777667777777777777777776654 677777777777777 455555 367777777777
Q ss_pred ccCCCCCccc----------------------------------------------------------------HHhhcC
Q 037847 283 LSSTDITGLP----------------------------------------------------------------QELKAL 298 (542)
Q Consensus 283 l~~~~i~~lp----------------------------------------------------------------~~i~~l 298 (542)
++++.++.++ .....+
T Consensus 117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l 196 (384)
T d2omza2 117 LFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL 196 (384)
T ss_dssp CCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGC
T ss_pred cccccccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccc
Confidence 7766554432 123334
Q ss_pred CCCCEEeccCCcccCccchhhcCCCCCCcEEeccCccccccccCCCCccccCCCcchhHhhccccCCceeeeEecchHHH
Q 037847 299 EKLRYLNLDYAFHLSIIPHQLISCFSKLEVLRLCGCGRFGVIKGKEGNVLCDGAEPLMKELLGLKHLNVLSWSFGSSLAV 378 (542)
Q Consensus 299 ~~L~~L~l~~~~~~~~lp~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~ 378 (542)
++++.+++++| .+..++. .+..++|++|++.+|.+. .+..+..+++|+.+++..+.....
T Consensus 197 ~~~~~l~l~~n-~i~~~~~--~~~~~~L~~L~l~~n~l~-----------------~~~~l~~l~~L~~L~l~~n~l~~~ 256 (384)
T d2omza2 197 TNLESLIATNN-QISDITP--LGILTNLDELSLNGNQLK-----------------DIGTLASLTNLTDLDLANNQISNL 256 (384)
T ss_dssp TTCSEEECCSS-CCCCCGG--GGGCTTCCEEECCSSCCC-----------------CCGGGGGCTTCSEEECCSSCCCCC
T ss_pred cccceeeccCC-ccCCCCc--ccccCCCCEEECCCCCCC-----------------CcchhhcccccchhccccCccCCC
Confidence 44555555554 2333332 233445555555555432 112345556666666554432221
Q ss_pred HHhhcCchhhccceeEEeccccCCCCCceecccccccccceeeecccCccceeeccchhhcccccccccccCEEEEccCC
Q 037847 379 QKFLKYPKLVSITQSVWVECGTYTRPPFNVLHLAYMENLQELELESCNLEEMKIDSTEEVKKLFRNGFRNLNTVVLRSCR 458 (542)
Q Consensus 379 ~~l~~~~~~~~~l~~l~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~c~ 458 (542)
..+. ..+.++.+.+...... ....+..++.++.+.+..|.+..+. ....+++++.|++++|.
T Consensus 257 ~~~~----~~~~L~~L~l~~~~l~----~~~~~~~~~~l~~l~~~~n~l~~~~----------~~~~~~~l~~L~ls~n~ 318 (384)
T d2omza2 257 APLS----GLTKLTELKLGANQIS----NISPLAGLTALTNLELNENQLEDIS----------PISNLKNLTYLTLYFNN 318 (384)
T ss_dssp GGGT----TCTTCSEEECCSSCCC----CCGGGTTCTTCSEEECCSSCCSCCG----------GGGGCTTCSEEECCSSC
T ss_pred Cccc----ccccCCEeeccCcccC----CCCcccccccccccccccccccccc----------ccchhcccCeEECCCCC
Confidence 1111 1233455555443311 1223445566666666666554421 12447899999999998
Q ss_pred CCCcchhhhccCcceEEEeccchhhhcccccccccccccCCcCCCCCccceeecccCCcccccCCCCCCCCCcceEeecc
Q 037847 459 GKDLTWLVFVQNLKQLNMQGFTMEEIISVEKLSDISEVIGSEHNFFPRLEYLTMWRGTNLKSVYPNPQPFPKLKKIQAFH 538 (542)
Q Consensus 459 ~~~~~~l~~l~~L~~L~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~p~L~~L~i~~ 538 (542)
+..++.+..+++|++|++++|.+++++ ....+++|++|++.++ .++.++. ...+++|+.|+|++
T Consensus 319 l~~l~~l~~l~~L~~L~L~~n~l~~l~--------------~l~~l~~L~~L~l~~N-~l~~l~~-l~~l~~L~~L~L~~ 382 (384)
T d2omza2 319 ISDISPVSSLTKLQRLFFANNKVSDVS--------------SLANLTNINWLSAGHN-QISDLTP-LANLTRITQLGLND 382 (384)
T ss_dssp CSCCGGGGGCTTCCEEECCSSCCCCCG--------------GGGGCTTCCEEECCSS-CCCBCGG-GTTCTTCSEEECCC
T ss_pred CCCCcccccCCCCCEEECCCCCCCCCh--------------hHcCCCCCCEEECCCC-cCCCChh-hccCCCCCEeeCCC
Confidence 865667889999999999999888763 3456899999999886 5777653 56789999999875
|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|