Citrus Sinensis ID: 037919

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MASATFFFVGFLVLAGEAIALQRKDDLSEMEMDEDELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLCT
ccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEccccccccEEEEEEEEccccccccccccccEEccHHccccccccEEEccccccccccccccccccccccccEEccccccccEEEccHHHHccccccEEEccccccEEcccHHHcccccccEEEccccEEEEcccHHccccccccEEEcccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccHHHcccccccEEEcccccccccccccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccccccccccccccEEEccccccEEEcccccHHHHHcccEEcccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccccccccccHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccEEEccHHHHccccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccEEEccccHHHHHcccccEEEEEcccccccccccccHHHHHHHccEEEccccccccc
MASATFFFVGFLVLAGEAIALQrkddlsememDEDELLGLFEVMSSliedpgwgrahpepctetpwpgveceigeddpsifhvtkvhigpdiitptckiSANISDALlklpylktlsifncfvsspvtlsptlFGALSSLEHLalysnptlsgeipssLAEIADLRVLSLSQnnlqgnipkelgrlvnleqldlsynnlsgeipdeigGMISLTVLDlswnglqgqvppslgtlqllqkidlgsnklvgsippaigKLSRLVLLDLsqncingpipetlsgLQQLQYLIVyhnpinsriplflgtlqnltsisvsecgltgpipnffssLNTLTALsldnnnlsgtvppslgslpnsmlDQLNLSHnqlsgelqfpEEFIERLGERLdvrgndklct
MASATFFFVGFLVLAGEAIALQRKDDLSEMEMDEDELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLgerldvrgndklct
MASATFFFVGFLVLAGEAIALQRKddlsememdedellglFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLCT
****TFFFVGFLVLAGEAIALQR************ELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLD**********************************************************
**SATFFFVGFLVLAGEAIALQ*************ELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLCT
MASATFFFVGFLVLAGEAIALQRKDDLSEMEMDEDELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLCT
**SATFFFVGFLVLAGEAIALQRKDDLSEMEMDEDELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLCT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASATFFFVGFLVLAGEAIALQRKDDLSEMEMDEDELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query397 2.2.26 [Sep-21-2011]
Q5PP26424 Piriformospora indica-ins no no 0.916 0.858 0.350 3e-51
Q9SSD1496 Protein TOO MANY MOUTHS O no no 0.931 0.745 0.354 7e-50
C0LGQ5 1249 LRR receptor-like serine/ no no 0.808 0.257 0.355 4e-40
Q00874372 DNA-damage-repair/tolerat no no 0.612 0.653 0.388 3e-38
O82318 960 Probably inactive leucine no no 0.695 0.287 0.368 1e-37
O49318 1124 Probable leucine-rich rep no no 0.654 0.231 0.361 3e-37
C0LGV1 1135 LRR receptor-like serine/ no no 0.629 0.220 0.395 1e-36
Q9LHP4 1141 Receptor-like protein kin no no 0.604 0.210 0.407 2e-36
Q9SHI2 1101 Leucine-rich repeat recep no no 0.604 0.217 0.403 5e-36
Q9LP24 1120 Probable leucine-rich rep no no 0.642 0.227 0.382 8e-36
>sp|Q5PP26|PII2_ARATH Piriformospora indica-insensitive protein 2 OS=Arabidopsis thaliana GN=PII-2 PE=2 SV=1 Back     alignment and function desciption
 Score =  202 bits (514), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 202/379 (53%), Gaps = 15/379 (3%)

Query: 26  DLSEMEMDEDELLGLFEVMSSLIEDPGWGRA-HPEPCTETPWPGVECEIGEDDPSIFHVT 84
           D  E  MD+ E   L+  +   + D   G A +P+PC  TP  GV C+I  D   +++VT
Sbjct: 30  DSEEAPMDKREREALYSAIQGFVGDSWNGSALYPDPCGWTPIQGVSCDIYND---LWYVT 86

Query: 85  KVHIGPDIITPT---CKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSS-L 140
            + +G  +I      C  S  I   L +L +L++LS FNCF+S  V     L+   +S L
Sbjct: 87  DLSLG--LIYENSLPCSSSLQIRPELFELKHLRSLSFFNCFISPMVIAKEELWTNFASNL 144

Query: 141 EHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLS 200
           E L   SNP L GE+P ++  +  L+ L + +N   G +P  +  L  L++L  + N+ +
Sbjct: 145 ESLEFRSNPGLIGELPETIGNLTKLKSLVVLENGFSGELPASICNLKRLKRLVFAGNSFA 204

Query: 201 GEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSR 260
           G IP+   G+  L +LDLS N   G +P S G L  L K+DL +N L G++P  +G L  
Sbjct: 205 GMIPNCFKGLKELLILDLSRNSFSGTLPTSFGDLVSLLKLDLSNNLLEGNLPQELGFLKN 264

Query: 261 LVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSR--IPLFLGTLQNLTSISVSECG 318
           L LLDL  N  +G + + +  +Q L  L++ +NP+     +    G + NL  + +S+ G
Sbjct: 265 LTLLDLRNNRFSGGLSKNIENIQSLTELVLSNNPMGEEDMVGTNWGKMSNLVVLDLSKMG 324

Query: 319 LTGPIPNFFSSLNTLTALSLDNNNLSGTVP-PSLGSLPNSMLDQLNLSHNQLSGELQFPE 377
           L G IP   ++L  L  L L+NNNL+G VP   L +LP   L  L ++ N L+GEL+F  
Sbjct: 325 LRGEIPTSLTNLKRLRFLGLNNNNLTGFVPSKKLEALP--CLGALYINGNNLTGELRFST 382

Query: 378 EFIERLGERLDVRGNDKLC 396
           +F E++G R     N  LC
Sbjct: 383 KFYEKMGRRFKASKNPNLC 401
Required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SSD1|TMM_ARATH Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
255557253420 serine-threonine protein kinase, plant-t 0.916 0.866 0.711 1e-143
147823121474 hypothetical protein VITISV_001504 [Viti 0.886 0.742 0.688 1e-138
359483635442 PREDICTED: piriformospora indica-insensi 0.886 0.796 0.688 1e-138
356546504473 PREDICTED: leucine-rich repeat receptor- 0.916 0.769 0.673 1e-132
356557805428 PREDICTED: piriformospora indica-insensi 0.916 0.850 0.670 1e-131
297740742 1323 unnamed protein product [Vitis vinifera] 0.836 0.250 0.654 1e-130
449507392466 PREDICTED: receptor-like protein 12-like 0.929 0.791 0.639 1e-128
449463924443 PREDICTED: receptor-like protein 12-like 0.911 0.817 0.649 1e-126
356528210441 PREDICTED: piriformospora indica-insensi 0.886 0.798 0.660 1e-121
357447253 527 Receptor-like protein kinase [Medicago t 0.919 0.692 0.631 1e-119
>gi|255557253|ref|XP_002519657.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223541074|gb|EEF42630.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  515 bits (1326), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 262/368 (71%), Positives = 309/368 (83%), Gaps = 4/368 (1%)

Query: 30  MEMDEDELLGLFEVMSSLIEDPGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIG 89
           M M+E+ELLGL+++M +L++D  W +AHP+PCT+TPWPGV+CEI   D +IFHVTK+HIG
Sbjct: 1   MAMEEEELLGLYDLMGALLDDFDWAQAHPQPCTDTPWPGVQCEIA--DGAIFHVTKIHIG 58

Query: 90  PDIITPTCKISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNP 149
           PDI+ P CK SA +S +L KLPYLK LSIFNCFV+SPV LS   FG LSSLEHLAL SNP
Sbjct: 59  PDIVNPPCKTSAQLSSSLHKLPYLKFLSIFNCFVTSPVILSHVAFGTLSSLEHLALDSNP 118

Query: 150 TLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGG 209
           TL+G+IPSSL ++  LRVLSLSQNNLQGN+P ELG LVNL+QLDLSYNNLSGEIP++I G
Sbjct: 119 TLTGKIPSSLGQVTSLRVLSLSQNNLQGNVPGELGGLVNLQQLDLSYNNLSGEIPEKIAG 178

Query: 210 MISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQN 269
           + SLT+LDLSWN L+GQVP SLG LQLLQK+DL SNKL+G IPP +G L RLVLLDLS N
Sbjct: 179 LKSLTILDLSWNNLEGQVPCSLGQLQLLQKVDLSSNKLLGRIPPDLGMLKRLVLLDLSHN 238

Query: 270 CINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSS 329
            +NGP+P TLSGL+QLQYLIV +NPINS IPLF+G+L+ LTSIS+S CGLTG IPN  SS
Sbjct: 239 FMNGPMPVTLSGLKQLQYLIVDYNPINSGIPLFVGSLERLTSISLSGCGLTGLIPNSLSS 298

Query: 330 LNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDV 389
           L  LTALSLDNN+L GTVP + GSLPN  LD LN+S+NQLSGEL  PEEFI RLG+RLD+
Sbjct: 299 LKNLTALSLDNNSLIGTVPSNFGSLPN--LDLLNVSNNQLSGELLLPEEFINRLGKRLDI 356

Query: 390 RGNDKLCT 397
           RGN+ LCT
Sbjct: 357 RGNNGLCT 364

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147823121|emb|CAN73142.1| hypothetical protein VITISV_001504 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483635|ref|XP_002271345.2| PREDICTED: piriformospora indica-insensitive protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546504|ref|XP_003541666.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Glycine max] Back     alignment and taxonomy information
>gi|356557805|ref|XP_003547201.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|297740742|emb|CBI30924.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449507392|ref|XP_004163018.1| PREDICTED: receptor-like protein 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449463924|ref|XP_004149680.1| PREDICTED: receptor-like protein 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356528210|ref|XP_003532698.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357447253|ref|XP_003593902.1| Receptor-like protein kinase [Medicago truncatula] gi|355482950|gb|AES64153.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
TAIR|locus:2052367462 RLP29 "receptor like protein 2 0.884 0.759 0.418 2e-72
TAIR|locus:2016319496 TMM "TOO MANY MOUTHS" [Arabido 0.866 0.693 0.368 1.2e-51
TAIR|locus:2031880424 AT1G13230 [Arabidopsis thalian 0.881 0.825 0.349 5.1e-51
TAIR|locus:2102330475 AT3G25670 [Arabidopsis thalian 0.879 0.734 0.349 9.5e-50
TAIR|locus:2012433432 AT1G68780 [Arabidopsis thalian 0.841 0.773 0.365 1.8e-48
TAIR|locus:2139880450 RIC7 "ROP-interactive CRIB mot 0.881 0.777 0.343 1.2e-47
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.843 0.268 0.349 2.9e-41
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.727 0.254 0.368 3.6e-40
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.692 0.245 0.381 4.5e-40
TAIR|locus:2091260372 DRT100 "DNA-DAMAGE REPAIR/TOLE 0.612 0.653 0.388 8.7e-40
TAIR|locus:2052367 RLP29 "receptor like protein 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 732 (262.7 bits), Expect = 2.0e-72, P = 2.0e-72
 Identities = 150/358 (41%), Positives = 219/358 (61%)

Query:    41 FEVMSSLIEDPGWGRAHPEPCTE-TPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKI 99
             F++M S+  D  W ++HP PC   + WPG+EC+ G D  S  HV+++  G     P+CK 
Sbjct:    44 FKIMESMSSDQQWRQSHPNPCAPGSSWPGIECKTGPDHLS--HVSRLDFG-SAPNPSCKS 100

Query:   100 SANISDALLKLPYLKTLSIFNCFVSSPVTLS-PTLFGALSSLEHLALYSNPTLSGEIPSS 158
             SA+   ++  LP+L+++  FNCF   P T+  P      SSL+ L+L SNP+LSG+IP  
Sbjct:   101 SASFPSSIFTLPFLQSVFFFNCFTHFPTTIMFPIKLIPNSSLQQLSLRSNPSLSGQIPPR 160

Query:   159 LAEIADLRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDL 218
             ++ +  L++L+LSQN L G+IP  +  L +L  LDLSYN L+G+IP ++G + +L  LDL
Sbjct:   161 ISSLKSLQILTLSQNRLTGDIPPAIFSLKSLVHLDLSYNKLTGKIPLQLGNLNNLVGLDL 220

Query:   219 SWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPET 278
             S+N L G +PP++  L +LQK+DL SN L G IP  + KL  L  + LS N + G  P+ 
Sbjct:   221 SYNSLTGTIPPTISQLGMLQKLDLSSNSLFGRIPEGVEKLRSLSFMALSNNKLKGAFPKG 280

Query:   279 LSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSL 338
             +S LQ LQY I+ +NP+   +P+ LG L  L  + +   G +G IP  ++ L  L++LSL
Sbjct:   281 ISNLQSLQYFIMDNNPMFVALPVELGFLPKLQELQLENSGYSGVIPESYTKLTNLSSLSL 340

Query:   339 DNNNLSGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLC 396
              NN L+G +P    SLP+     LNLS N L G + F   F+ RLG+ LD+ GN  LC
Sbjct:   341 ANNRLTGEIPSGFESLPHVF--HLNLSRNLLIGVVPFDSSFLRRLGKNLDLSGNRGLC 396
GO:0005886 "plasma membrane" evidence=ISM
GO:0031225 "anchored to membrane" evidence=TAS
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2016319 TMM "TOO MANY MOUTHS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031880 AT1G13230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102330 AT3G25670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012433 AT1G68780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139880 RIC7 "ROP-interactive CRIB motif-containing protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091260 DRT100 "DNA-DAMAGE REPAIR/TOLERATION 100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028322001
SubName- Full=Chromosome chr10 scaffold_43, whole genome shotgun sequence; (508 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00021954001
SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (356 aa)
  •     0.445
GSVIVG00031535001
SubName- Full=Chromosome chr12 scaffold_57, whole genome shotgun sequence; (188 aa)
  •     0.438
GSVIVG00010929001
SubName- Full=Chromosome undetermined scaffold_295, whole genome shotgun sequence; (243 aa)
  •     0.409

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-51
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-24
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  184 bits (469), Expect = 2e-51
 Identities = 118/292 (40%), Positives = 162/292 (55%), Gaps = 28/292 (9%)

Query: 110 LPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLS 169
           +P L+TL + N  +S  +   P   G+ SSL+ L L  N  L G+IP+SL  +  L  L+
Sbjct: 139 IPNLETLDLSNNMLSGEI---PNDIGSFSSLKVLDLGGN-VLVGKIPNSLTNLTSLEFLT 194

Query: 170 LSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPP 229
           L+ N L G IP+ELG++ +L+ + L YNNLSGEIP EIGG+ SL  LDL +N L G +P 
Sbjct: 195 LASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPS 254

Query: 230 SLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLI 289
           SLG L+ LQ + L  NKL G IPP+I  L +L+ LDLS N ++G IPE +  LQ L+ L 
Sbjct: 255 SLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILH 314

Query: 290 VYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPP 349
           ++ N    +IP+ L +L  L  + +     +G IP      N LT L L  NNL+G +P 
Sbjct: 315 LFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPE 374

Query: 350 SL-----------------GSLPNSM-----LDQLNLSHNQLSGELQFPEEF 379
            L                 G +P S+     L ++ L  N  SGEL  P EF
Sbjct: 375 GLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGEL--PSEF 424

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 397
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.86
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PLN03150623 hypothetical protein; Provisional 99.61
PLN03150623 hypothetical protein; Provisional 99.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.25
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.62
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.56
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.39
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.16
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.94
PRK15386 426 type III secretion protein GogB; Provisional 97.93
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
PRK15386 426 type III secretion protein GogB; Provisional 97.83
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.54
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.38
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.23
KOG4341483 consensus F-box protein containing LRR [General fu 97.18
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.93
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.83
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.81
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.45
KOG4308 478 consensus LRR-containing protein [Function unknown 95.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.38
KOG4308478 consensus LRR-containing protein [Function unknown 95.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.14
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.12
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.6
smart0037026 LRR Leucine-rich repeats, outliers. 89.01
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.01
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.76
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.7e-43  Score=370.84  Aligned_cols=337  Identities=37%  Similarity=0.621  Sum_probs=241.1

Q ss_pred             CHHHHHHHHHHHHhCCCC----CCCCCCCCCCCCCCCccceEcCCCCCCCCcccEEEEEcCCCCCCCCcccccccccccc
Q 037919           33 DEDELLGLFEVMSSLIED----PGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDALL  108 (397)
Q Consensus        33 ~~~~~~~l~~~~~~~~~~----~~w~~~~~~~c~~~~w~gv~C~~~~~~~~~~~v~~l~l~~~~~~~~~~~~~~~~~~l~  108 (397)
                      +++|+.||++||+++.++    .+|... .++|.   |.||+|+..      ++|++|++++      +.++|.+++.+.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~-~~~c~---w~gv~c~~~------~~v~~L~L~~------~~i~~~~~~~~~   90 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSS-ADVCL---WQGITCNNS------SRVVSIDLSG------KNISGKISSAIF   90 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCC-CCCCc---CcceecCCC------CcEEEEEecC------CCccccCChHHh
Confidence            457899999999998643    358643 47787   999999753      5899999997      677888888999


Q ss_pred             CCCCCCEEEcCCCCCCCCCccChhhhCCCCCCCEEeCcCCCCCcccCchhhcCCCCCCEEEcccccCCCCCchhhcCCCC
Q 037919          109 KLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLVN  188 (397)
Q Consensus       109 ~l~~L~~L~ls~~~~~~~~~~~~~~~~~l~~L~~L~l~~n~~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~  188 (397)
                      .+++|++|++++|.+.+  .+|.+.+..+++|++|++++| .+++.+|.  +.+++|++|++++|.+.+.+|..+.++++
T Consensus        91 ~l~~L~~L~Ls~n~~~~--~ip~~~~~~l~~L~~L~Ls~n-~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~  165 (968)
T PLN00113         91 RLPYIQTINLSNNQLSG--PIPDDIFTTSSSLRYLNLSNN-NFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSS  165 (968)
T ss_pred             CCCCCCEEECCCCccCC--cCChHHhccCCCCCEEECcCC-ccccccCc--cccCCCCEEECcCCcccccCChHHhcCCC
Confidence            99999999999998876  678777778888888888888 67666664  44667777777777776666777777777


Q ss_pred             CCEEeeecCCCCCccChhccCCCCCCEEEccCCCCCCCCCccccCCccCceeeccCCcCCCCCccccCCCCCCcEEEccc
Q 037919          189 LEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQ  268 (397)
Q Consensus       189 L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~  268 (397)
                      |++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..++.+++|++|++++|.+.+.+|..++.+++|++|++++
T Consensus       166 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~  245 (968)
T PLN00113        166 LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVY  245 (968)
T ss_pred             CCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcC
Confidence            77777777777666676677777777777777777666666677777777777777776666666666677777777777


Q ss_pred             CCCCCCCcccCCCCCCCCeeeccCCcCCCCCccccCCCCCCCEEEcccccCCcCChhhccCCCCCCEEeCCCCcCCcCCC
Q 037919          269 NCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVP  348 (397)
Q Consensus       269 n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~l~~~~p  348 (397)
                      |.+.+.+|..+.++++|++|++++|.+.+..|..+..+++|++|++++|.+++.+|..+..+++|+.|++++|.+++.+|
T Consensus       246 n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~  325 (968)
T PLN00113        246 NNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIP  325 (968)
T ss_pred             ceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCC
Confidence            76666666666666667777776666666666666666666666666666666666666666666666666666666666


Q ss_pred             ccccCCCcCCCCEEEccCCcCccccCCChHHHhhccceEeccCCc
Q 037919          349 PSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGND  393 (397)
Q Consensus       349 ~~~~~l~~~~L~~L~l~~N~l~g~~p~~~~~~~~l~~~l~l~~N~  393 (397)
                      ..+..+++  |+.|++++|+++|.+|..+...+.+ +.|++++|+
T Consensus       326 ~~~~~l~~--L~~L~L~~n~l~~~~p~~l~~~~~L-~~L~Ls~n~  367 (968)
T PLN00113        326 VALTSLPR--LQVLQLWSNKFSGEIPKNLGKHNNL-TVLDLSTNN  367 (968)
T ss_pred             hhHhcCCC--CCEEECcCCCCcCcCChHHhCCCCC-cEEECCCCe
Confidence            66666666  6666666666666666555444444 556665554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-25
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-07
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 8e-25
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 9e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-22
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 7e-10
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-09
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 4e-09
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 4e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 4e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 9e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 1e-05
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 4e-05
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 5e-05
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 8e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 8e-05
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-04
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-04
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 1e-04
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 1e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 3e-04
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 4e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 5e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 5e-04
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (277), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 149/305 (48%), Gaps = 37/305 (12%)
Query: 98  KISANISDALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPS 157
           K+S + S A+     LK L+I +     P+   P     L SL++L+L  N   +GEIP 
Sbjct: 231 KLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP-----LKSLQYLSLAEN-KFTGEIPD 284
Query: 158 SLAEIAD-LRVLSLSQNNLQGNIPKELG-------------------------RLVNLEQ 191
            L+   D L  L LS N+  G +P   G                         ++  L+ 
Sbjct: 285 FLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKV 344
Query: 192 LDLSYNNLSGEIPDEIGGM-ISLTVLDLSWNGLQGQVPPSL--GTLQLLQKIDLGSNKLV 248
           LDLS+N  SGE+P+ +  +  SL  LDLS N   G + P+L       LQ++ L +N   
Sbjct: 345 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT 404
Query: 249 GSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQN 308
           G IPP +   S LV L LS N ++G IP +L  L +L+ L ++ N +   IP  L  ++ 
Sbjct: 405 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 464
Query: 309 LTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLNLSHNQ 368
           L ++ +    LTG IP+  S+   L  +SL NN L+G +P  +G L N  L  L LS+N 
Sbjct: 465 LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLEN--LAILKLSNNS 522
Query: 369 LSGEL 373
            SG +
Sbjct: 523 FSGNI 527
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-69
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-67
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-51
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-50
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-49
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-49
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-45
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-43
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-38
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-37
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-43
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-35
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-27
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-35
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-33
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-34
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-31
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-31
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-27
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-32
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-30
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-26
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-22
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-30
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-30
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-27
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-18
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-10
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  225 bits (577), Expect = 2e-71
 Identities = 75/293 (25%), Positives = 116/293 (39%), Gaps = 32/293 (10%)

Query: 105 DALLKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIAD 164
           D   +   +  L +    +  P  +  +L   L  L  L +     L G IP ++A++  
Sbjct: 44  DTDTQTYRVNNLDLSGLNLPKPYPIPSSL-ANLPYLNFLYIGGINNLVGPIPPAIAKLTQ 102

Query: 165 LRVLSLSQNNLQGNIPKELGRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQ 224
           L  L ++  N+ G IP  L ++  L  LD SYN LSG +P  I  + +L  +    N + 
Sbjct: 103 LHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRIS 162

Query: 225 GQVPPSLGTLQ-LLQKIDLGSNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQ 283
           G +P S G+   L   + +  N+L G IPP    L+ L  +DLS+N + G         +
Sbjct: 163 GAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDK 221

Query: 284 QLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNL 343
             Q + +  N                         L   +         L  L L NN +
Sbjct: 222 NTQKIHLAKN------------------------SLAFDLGK-VGLSKNLNGLDLRNNRI 256

Query: 344 SGTVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLC 396
            GT+P  L  L    L  LN+S N L GE+  P+    +  +      N  LC
Sbjct: 257 YGTLPQGLTQLKF--LHSLNVSFNNLCGEI--PQGGNLQRFDVSAYANNKCLC 305
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.03
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.89
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.54
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.52
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.68
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=6.9e-44  Score=331.20  Aligned_cols=300  Identities=27%  Similarity=0.505  Sum_probs=183.0

Q ss_pred             CCCHHHHHHHHHHHHhCCCC---CCCCCCCCCCCCCCCccceEcCCCCCCCCcccEEEEEcCCCCCCCCccccccccccc
Q 037919           31 EMDEDELLGLFEVMSSLIED---PGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDAL  107 (397)
Q Consensus        31 ~~~~~~~~~l~~~~~~~~~~---~~w~~~~~~~c~~~~w~gv~C~~~~~~~~~~~v~~l~l~~~~~~~~~~~~~~~~~~l  107 (397)
                      .|+++|++||++||+++.++   .+|... .++|. +.|.||+|+...   ..++|+.+++++      +.+.|      
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~~l~~W~~~-~~~C~-~~w~gv~C~~~~---~~~~l~~L~L~~------~~l~~------   64 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT-TDCCN-RTWLGVLCDTDT---QTYRVNNLDLSG------LNLPK------   64 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT-SCTTT-TCSTTEEECCSS---SCCCEEEEEEEC------CCCSS------
T ss_pred             CCCHHHHHHHHHHHHhcCCcccccCCCCC-CCCCc-CCCcceEeCCCC---CCceEEEEECCC------CCccC------
Confidence            58899999999999999754   378653 36774 359999997531   124666666654      22222      


Q ss_pred             cCCCCCCEEEcCCCCCCCCCccChhhhCCCCCCCEEeCcC-CCCCcccCchhhcCCCCCCEEEcccccCCCCCchhhcCC
Q 037919          108 LKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYS-NPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRL  186 (397)
Q Consensus       108 ~~l~~L~~L~ls~~~~~~~~~~~~~~~~~l~~L~~L~l~~-n~~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l  186 (397)
                                        ...+| ..+.++++|++|++++ | .+.+.+|..++++++|++|++++|.+++.+|..+.++
T Consensus        65 ------------------~~~~~-~~l~~l~~L~~L~L~~~n-~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l  124 (313)
T 1ogq_A           65 ------------------PYPIP-SSLANLPYLNFLYIGGIN-NLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQI  124 (313)
T ss_dssp             ------------------CEECC-GGGGGCTTCSEEEEEEET-TEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGC
T ss_pred             ------------------CcccC-hhHhCCCCCCeeeCCCCC-cccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCC
Confidence                              00111 1234444455555543 4 4455555555555555555555555544445555555


Q ss_pred             CCCCEEeeecCCCCCccChhccCCCCCCEEEccCCCCCCCCCccccCCccCceeeccCCcCCCCCccccCCCC-CCcEEE
Q 037919          187 VNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLGSNKLVGSIPPAIGKLS-RLVLLD  265 (397)
Q Consensus       187 ~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~-~L~~L~  265 (397)
                      ++|++|++++|.+.+.+|                        ..+..+++|++|++++|.+++.+|..+..++ +|++|+
T Consensus       125 ~~L~~L~Ls~N~l~~~~p------------------------~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~  180 (313)
T 1ogq_A          125 KTLVTLDFSYNALSGTLP------------------------PSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMT  180 (313)
T ss_dssp             TTCCEEECCSSEEESCCC------------------------GGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEE
T ss_pred             CCCCEEeCCCCccCCcCC------------------------hHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEE
Confidence            555555555555544444                        4444455555555555555444555555554 555555


Q ss_pred             cccCCCCCCCcccCCCCCCCCeeeccCCcCCCCCccccCCCCCCCEEEcccccCCcCChhhccCCCCCCEEeCCCCcCCc
Q 037919          266 LSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSG  345 (397)
Q Consensus       266 l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~l~~  345 (397)
                      +++|.+++.+|..+..++ |++|++++|.+++..|..+..+++|++|++++|++++.+|. +..+++|++|++++|++++
T Consensus       181 L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~~  258 (313)
T 1ogq_A          181 ISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYG  258 (313)
T ss_dssp             CCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG-CCCCTTCCEEECCSSCCEE
T ss_pred             CcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecCc-ccccCCCCEEECcCCcccC
Confidence            555555555555555554 66666666666666666666667777777777777655554 6667777777777777777


Q ss_pred             CCCccccCCCcCCCCEEEccCCcCccccCCChHHHhhccceEeccCCcCCCC
Q 037919          346 TVPPSLGSLPNSMLDQLNLSHNQLSGELQFPEEFIERLGERLDVRGNDKLCT  397 (397)
Q Consensus       346 ~~p~~~~~l~~~~L~~L~l~~N~l~g~~p~~~~~~~~l~~~l~l~~N~~~C~  397 (397)
                      .+|..+..+++  |++|++++|+++|.+|.. ..++.+ +.+++++|+++|+
T Consensus       259 ~~p~~l~~l~~--L~~L~Ls~N~l~~~ip~~-~~l~~L-~~l~l~~N~~lc~  306 (313)
T 1ogq_A          259 TLPQGLTQLKF--LHSLNVSFNNLCGEIPQG-GNLQRF-DVSAYANNKCLCG  306 (313)
T ss_dssp             CCCGGGGGCTT--CCEEECCSSEEEEECCCS-TTGGGS-CGGGTCSSSEEES
T ss_pred             cCChHHhcCcC--CCEEECcCCcccccCCCC-cccccc-ChHHhcCCCCccC
Confidence            77777777777  777777777777777765 445566 6777777777764
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 397
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-08
d1h6ua2 227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-07
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1h6ta2 210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 87.7 bits (216), Expect = 8e-20
 Identities = 60/209 (28%), Positives = 97/209 (46%), Gaps = 19/209 (9%)

Query: 184 GRLVNLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLLQKIDLG 243
            +L NLE L  + N +S   P  I  + +L  L L+ N L+     +L +L  L  +DL 
Sbjct: 194 AKLTNLESLIATNNQISDITPLGI--LTNLDELSLNGNQLKD--IGTLASLTNLTDLDLA 249

Query: 244 SNKLVGSIPPAIGKLSRLVLLDLSQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFL 303
           +N++    P  +  L++L  L L  N I+   P  L+GL  L  L +  N +    P+  
Sbjct: 250 NNQISNLAP--LSGLTKLTELKLGANQISNISP--LAGLTALTNLELNENQLEDISPIS- 304

Query: 304 GTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGTVPPSLGSLPNSMLDQLN 363
             L+NLT +++    ++   P   SSL  L  L   NN +S     SL +L N  ++ L+
Sbjct: 305 -NLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTN--INWLS 357

Query: 364 LSHNQLSGELQFPEEFIERLGERLDVRGN 392
             HNQ+S     P   + R+  +L +   
Sbjct: 358 AGHNQISDLT--PLANLTRI-TQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.01
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.31
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=5.8e-42  Score=316.14  Aligned_cols=297  Identities=25%  Similarity=0.475  Sum_probs=171.5

Q ss_pred             CCCHHHHHHHHHHHHhCCCC---CCCCCCCCCCCCCCCccceEcCCCCCCCCcccEEEEEcCCCCCCCCccccccccccc
Q 037919           31 EMDEDELLGLFEVMSSLIED---PGWGRAHPEPCTETPWPGVECEIGEDDPSIFHVTKVHIGPDIITPTCKISANISDAL  107 (397)
Q Consensus        31 ~~~~~~~~~l~~~~~~~~~~---~~w~~~~~~~c~~~~w~gv~C~~~~~~~~~~~v~~l~l~~~~~~~~~~~~~~~~~~l  107 (397)
                      -|+++|++||++||+++.++   .+|... .|+|. ..|.||+|+..   ..+.||++|+|++      +.+.|..    
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~-~d~C~-~~w~gv~C~~~---~~~~~v~~L~L~~------~~l~g~~----   66 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT-TDCCN-RTWLGVLCDTD---TQTYRVNNLDLSG------LNLPKPY----   66 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT-SCTTT-TCSTTEEECCS---SSCCCEEEEEEEC------CCCSSCE----
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCCC-CCCCC-CcCCCeEEeCC---CCcEEEEEEECCC------CCCCCCC----
Confidence            38899999999999999876   378754 48884 34999999864   2356899999886      3333311    


Q ss_pred             cCCCCCCEEEcCCCCCCCCCccChhhhCCCCCCCEEeCcCCCCCcccCchhhcCCCCCCEEEcccccCCCCCchhhcCCC
Q 037919          108 LKLPYLKTLSIFNCFVSSPVTLSPTLFGALSSLEHLALYSNPTLSGEIPSSLAEIADLRVLSLSQNNLQGNIPKELGRLV  187 (397)
Q Consensus       108 ~~l~~L~~L~ls~~~~~~~~~~~~~~~~~l~~L~~L~l~~n~~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~  187 (397)
                                          .+|+. ++++++|++|+|+++..++|.+|..++++++|++|++++|++.+..+..+..++
T Consensus        67 --------------------~lp~~-l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~  125 (313)
T d1ogqa_          67 --------------------PIPSS-LANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK  125 (313)
T ss_dssp             --------------------ECCGG-GGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCT
T ss_pred             --------------------CCChH-HhcCccccccccccccccccccccccccccccchhhhccccccccccccccchh
Confidence                                12221 344444444444431155566666677777777777777777666666666666


Q ss_pred             CCCEEeeecCCCCCccChhccCCCCCCEEEccCCCCCCCCCccccCCccC-ceeeccCCcCCCCCccccCCCCCCcEEEc
Q 037919          188 NLEQLDLSYNNLSGEIPDEIGGMISLTVLDLSWNGLQGQVPPSLGTLQLL-QKIDLGSNKLVGSIPPAIGKLSRLVLLDL  266 (397)
Q Consensus       188 ~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L-~~L~l~~n~l~~~~~~~l~~l~~L~~L~l  266 (397)
                      +|++++++.|.+.+.+|..+.++++++++++++|.+.+.+|..+..+.++ +.+++++|++++..+..+..+..+ .+++
T Consensus       126 ~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l  204 (313)
T d1ogqa_         126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDL  204 (313)
T ss_dssp             TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEEC
T ss_pred             hhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-cccc
Confidence            67777777666666666666666666666666666666666655555544 555555555555555444444322 3555


Q ss_pred             ccCCCCCCCcccCCCCCCCCeeeccCCcCCCCCccccCCCCCCCEEEcccccCCcCChhhccCCCCCCEEeCCCCcCCcC
Q 037919          267 SQNCINGPIPETLSGLQQLQYLIVYHNPINSRIPLFLGTLQNLTSISVSECGLTGPIPNFFSSLNTLTALSLDNNNLSGT  346 (397)
Q Consensus       267 ~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~l~~~  346 (397)
                      ..+...+.+|..+..+++++.+++++|.+.+.++ .+..+++|+.|++++|+++|.+|..++++++|++|+|++|+++|.
T Consensus       205 ~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~  283 (313)
T d1ogqa_         205 SRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE  283 (313)
T ss_dssp             CSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEE
T ss_pred             cccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccccc
Confidence            5555444444444445555555555554444332 234444444444444444444444444444444444444444444


Q ss_pred             CCccccCCCcCCCCEEEccCCc
Q 037919          347 VPPSLGSLPNSMLDQLNLSHNQ  368 (397)
Q Consensus       347 ~p~~~~~l~~~~L~~L~l~~N~  368 (397)
                      +|+ ++++++  |+.+++++|+
T Consensus       284 iP~-~~~L~~--L~~l~l~~N~  302 (313)
T d1ogqa_         284 IPQ-GGNLQR--FDVSAYANNK  302 (313)
T ss_dssp             CCC-STTGGG--SCGGGTCSSS
T ss_pred             CCC-cccCCC--CCHHHhCCCc
Confidence            442 233444  4444444443
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure