Citrus Sinensis ID: 037941


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MHDVVHDIAVSTARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVSSVEGAA
ccHHHHHHHHHHHHcccEEEEEEccccHHHHHHccccccEEEEcccccccccccccccccccEEEEccccccccccHHHHcccccccEEEcccccccccccccccHHHHHHcccccEEEccccccccccHHHHccccccEEcccccccccccccccccccccccEEEcccccccEEEcccccccHHHHcccccccEEEEEEEccccccccccccccccccEEccccccccccccccccEEEccccccccHHHHHHHcccccEEEEccccccccccccccccccccccEEEcccccccccccccccccc
ccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHEEEEEEccccHHHccccccccccEEEEEEccccccccccHHHHHcccEEEEEccccccccccHHHccHHHHHHHHHcEEEEcccccHHHccHHHHHHHHcEEEcccccccccEccccHHHHHHHHHEEEEccccccccccccccHHHHHHHHHHcccEEEEEEccHHHccHHHHHHHHHEEEEEEcccccccccccHcccEEEEEcccHHHHHHHHHHHHHHHEEEEcccccccHEEHccccccccccEEEEEEccHHHHHHcccHHccc
MHDVVHDIAVStardkhmfNIQIISDLREVFEDLmqkdpiaishpcrdiqelpeklecpklklFFLFSEKLslvipdlffegvpslqvlslngfhfpslpstlgdvatVGVLKKLVIFSFRNSHIEQLPEEIGQLTRlklldlstcsklksirpnvisnlprleelymgnsfthwevegqnnaslAELNQLSRLTTLEMLILDAQVMPRELFSlglernkiflgdvwswtgkyetsrtLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLheldgegfprlKHLLVQNASEILYIVSSVEGAA
MHDVVHDIAvstardkhmfnIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLstcsklksirpnvisnlpRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIflgdvwswtgkyetsrtlklkldnRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVSSVEGAA
MHDVVHDIAVSTARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQelpeklecpklklfflfseklslVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVSSVEGAA
****VHDIAVSTARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVS******
MHDVVHDIAVSTARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVSSV****
MHDVVHDIAVSTARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVSSVEGAA
*HDVVHDIAVSTARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVSS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDVVHDIAVSTARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVSSVEGAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q9T048 985 Disease resistance protei yes no 0.944 0.295 0.25 1e-16
Q42484 909 Disease resistance protei no no 0.675 0.228 0.308 1e-13
O81825 919 Probable disease resistan no no 0.655 0.219 0.237 2e-06
Q14160 1630 Protein scribble homolog yes no 0.470 0.088 0.292 3e-05
Q9C8T9 898 Putative disease resistan no no 0.646 0.221 0.256 6e-05
Q01513 2145 Adenylate cyclase OS=Podo yes no 0.327 0.047 0.333 0.0001
Q9SYQ8 980 Receptor protein kinase C no no 0.347 0.109 0.316 0.0002
Q01631 2300 Adenylate cyclase OS=Neur N/A no 0.262 0.035 0.359 0.0003
O82484 892 Putative disease resistan no no 0.522 0.180 0.297 0.0004
O02833 605 Insulin-like growth facto N/A no 0.337 0.171 0.336 0.0005
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 147/324 (45%), Gaps = 33/324 (10%)

Query: 1   MHDVVHDIAV---STARDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLE 57
           MHDVV D A+   S+++D     +   + L+++ +D +      +S     ++ LP+ +E
Sbjct: 462 MHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVE 521

Query: 58  --CPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPST------------- 102
             C K  +  L    L   +P  F +  P+L++L+L+G    S PS              
Sbjct: 522 EFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFL 581

Query: 103 -----LGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVI 157
                L  + ++  L KL +     +HI + P  + +L R + LDLS    L+SI   V+
Sbjct: 582 RDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVV 641

Query: 158 SNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMP-----RELF 212
           S L  LE L M +S   W V+G+     A + ++  L  L++L +     P     R  +
Sbjct: 642 SRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTW 701

Query: 213 SLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHLDKLNGLQ 272
              L++ ++ +G  +    +++  R   L + +    +  I  LL  T  L L+   G++
Sbjct: 702 IKRLKKFQLVVGSRYILRTRHDKRR---LTISHLNVSQVSIGWLLAYTTSLALNHCQGIE 758

Query: 273 NVLHEL--DGEGFPRLKHLLVQNA 294
            ++ +L  D +GF  LK L ++N 
Sbjct: 759 AMMKKLVSDNKGFKNLKSLTIENV 782




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 Back     alignment and function description
>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 Back     alignment and function description
>sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=3 SV=2 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
255563252 1603 Disease resistance protein RPS5, putativ 0.977 0.187 0.509 1e-76
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.983 0.123 0.486 1e-73
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.980 0.229 0.467 2e-71
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.980 0.318 0.476 4e-70
255574526 1232 Disease resistance protein RFL1, putativ 0.996 0.249 0.458 4e-68
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.987 0.179 0.484 3e-67
359488101 1677 PREDICTED: disease resistance protein At 0.987 0.181 0.480 5e-66
359488025 1781 PREDICTED: uncharacterized protein LOC10 0.987 0.170 0.470 1e-65
359488103 1530 PREDICTED: disease resistance protein At 0.980 0.197 0.455 1e-63
359488108 1436 PREDICTED: disease resistance protein At 0.987 0.211 0.461 3e-63
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  292 bits (747), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 219/322 (68%), Gaps = 21/322 (6%)

Query: 1   MHDVVHDIAVSTA-RDKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECP 59
           +HDVV D+A+S A R +H+F ++  + L+E     + K    IS P  DI  LPE LECP
Sbjct: 466 IHDVVRDVAISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECP 525

Query: 60  KLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPSLPSTLG--------------- 104
           +L+LF LF++ +SL +PDL FE   +L+VL+  G HF SLP +LG               
Sbjct: 526 ELELFLLFTQDISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCAL 585

Query: 105 -DVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRL 163
            DVA +G L  L I SF++S I +LP EI QLT+LK LDLS C KLK I   +IS L +L
Sbjct: 586 RDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQL 645

Query: 164 EELYMGNSFTHWEVEG---QNNASLAELNQLSRLTTLEMLILDAQVMPRELFSLGLERNK 220
           EELYM NSF  W+V+G   Q NASLAEL  L  LTTLE+ +LDA+++P++LF   LER +
Sbjct: 646 EELYMNNSFDLWDVQGINNQRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFR 705

Query: 221 IFLGDVWSWTGKYETSRTLKLKLD-NRMYLEHGIKMLLRRTEDLHLDKLNGLQNVLHELD 279
           IF+GDVWS TG Y TSRTLKLKL+ + ++LEHG+ +LL  TEDL+L ++ G+++VL++LD
Sbjct: 706 IFIGDVWSGTGDYGTSRTLKLKLNTSSIHLEHGLSILLEVTEDLYLAEVKGIKSVLYDLD 765

Query: 280 GEGFPRLKHLLVQNASEILYIV 301
            +GF +LKHL VQN  EI YI+
Sbjct: 766 SQGFTQLKHLDVQNDPEIQYII 787




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.672 0.210 0.264 5e-10
TAIR|locus:2005517 909 RPS2 "RESISTANT TO P. SYRINGAE 0.435 0.147 0.321 9.5e-08
DICTYBASE|DDB_G0284461 623 DDB_G0284461 "leucine-rich rep 0.525 0.260 0.329 8.2e-06
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.662 0.183 0.271 8.1e-05
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.279 0.100 0.333 0.0001
TAIR|locus:2086979 890 RLP42 "receptor like protein 4 0.655 0.226 0.267 0.00013
TAIR|locus:2163593 1167 AT5G45520 "AT5G45520" [Arabido 0.577 0.152 0.280 0.00024
TAIR|locus:2117617549 PIRL4 "plant intracellular ras 0.607 0.340 0.290 0.00043
ZFIN|ZDB-GENE-060526-97 721 lrsam1 "leucine rich repeat an 0.474 0.202 0.304 0.00049
TAIR|locus:2167948 966 ERL1 "ERECTA-like 1" [Arabidop 0.318 0.101 0.321 0.0007
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 172 (65.6 bits), Expect = 5.0e-10, P = 5.0e-10
 Identities = 58/219 (26%), Positives = 101/219 (46%)

Query:    84 PSLQVLSLNGFHFPSLPST--LGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLL 141
             PS  +L L   H   L     L  + ++  L KL +     +HI + P  + +L R + L
Sbjct:   566 PSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHL 625

Query:   142 DLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLI 201
             DLS    L+SI   V+S L  LE L M +S   W V+G+     A + ++  L  L++L 
Sbjct:   626 DLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLS 685

Query:   202 LDAQVMP-----RELFSLGLERNKIFLGDVWSWTGKYETSRTLKLKLDNRMYLEHGIKML 256
             +     P     R  +   L++ ++ +G  +    +++  R   L + +    +  I  L
Sbjct:   686 IRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRR---LTISHLNVSQVSIGWL 742

Query:   257 LRRTEDLHLDKLNGLQNVLHEL--DGEGFPRLKHLLVQN 293
             L  T  L L+   G++ ++ +L  D +GF  LK L ++N
Sbjct:   743 LAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIEN 781




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284461 DDB_G0284461 "leucine-rich repeat-containing protein (LRR)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163593 AT5G45520 "AT5G45520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-97 lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.03110007
cc-nbs-lrr resistance protein (1315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 37.1 bits (87), Expect = 5e-04
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 112 LKKLVIFSFRNSHIEQLPEEI-GQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGN 170
           LK L +    N+ +  +P+     L  LK+LDLS  + L SI P   S LP L  L +  
Sbjct: 2   LKSLDL---SNNRLTVIPDGAFKGLPNLKVLDLS-GNNLTSISPEAFSGLPSLRSLDLSG 57


Length = 60

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.78
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.76
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.62
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.54
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.51
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.37
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.37
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.29
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.13
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
PLN03150623 hypothetical protein; Provisional 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
PLN03150623 hypothetical protein; Provisional 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.53
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.42
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.38
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.19
PRK15386 426 type III secretion protein GogB; Provisional 98.17
KOG4341483 consensus F-box protein containing LRR [General fu 98.07
PRK15386 426 type III secretion protein GogB; Provisional 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.97
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.89
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.88
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.82
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.78
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.37
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.89
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.81
KOG4341483 consensus F-box protein containing LRR [General fu 96.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.35
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.45
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.05
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.87
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.83
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.93
smart0037026 LRR Leucine-rich repeats, outliers. 92.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.89
smart0037026 LRR Leucine-rich repeats, outliers. 91.89
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.04
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.83
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.97
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.87  E-value=1.4e-22  Score=194.52  Aligned_cols=287  Identities=24%  Similarity=0.282  Sum_probs=213.5

Q ss_pred             ChhHHHHHHHHhhh-----ccccceeecccchhhHhhhhcCCCCeeEEeecCCCCCCCCcCCCCCccEEEecCCCC-cCC
Q 037941            1 MHDVVHDIAVSTAR-----DKHMFNIQIISDLREVFEDLMQKDPIAISHPCRDIQELPEKLECPKLKLFFLFSEKL-SLV   74 (308)
Q Consensus         1 mhd~v~d~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~-~~~   74 (308)
                      |||+|||||.++|+     +++ ..+..+.+..++|+...+...|+..+.++.+..++....+++|++|.+.+|.. ...
T Consensus       483 mHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~  561 (889)
T KOG4658|consen  483 MHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLE  561 (889)
T ss_pred             eeHHHHHHHHHHhccccccccc-eEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhh
Confidence            89999999999998     666 55776778888888888899999999999999988888888999999999872 447


Q ss_pred             CCchhhcCCCCccEEEccCC-CCCCCCCCCCCcccccccccccEEeecCCcCcccchhhhCcCCCCEEecCCCCCCCccC
Q 037941           75 IPDLFFEGVPSLQVLSLNGF-HFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIR  153 (308)
Q Consensus        75 ~~~~~~~~l~~L~~L~l~~~-~~~~lp~~~~~~~~l~~l~~L~~L~l~~~~i~~l~~~~~~l~~L~~L~l~~~~~~~~~~  153 (308)
                      ++..+|..|+.|++||+++| .+.++|..      ++.+.+||||+++++.+.++|..++++.+|.+|++..+..+..+|
T Consensus       562 is~~ff~~m~~LrVLDLs~~~~l~~LP~~------I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~  635 (889)
T KOG4658|consen  562 ISGEFFRSLPLLRVLDLSGNSSLSKLPSS------IGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIP  635 (889)
T ss_pred             cCHHHHhhCcceEEEECCCCCccCcCChH------HhhhhhhhcccccCCCccccchHHHHHHhhheecccccccccccc
Confidence            77888899999999999987 45699999      999999999999999999999999999999999999988666665


Q ss_pred             cchhcCCCCCceEEccCCcccccccCCcccchhhhhcCCCCCEEEeeeccCccccch-hhccCCcee----EeeccC---
Q 037941          154 PNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEMLILDAQVMPRE-LFSLGLERN----KIFLGD---  225 (308)
Q Consensus       154 ~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~p~~-~~~~~L~~l----~i~~~~---  225 (308)
                      . ....+.+|++|.+......     .......++..+.+|+.+.+..... .+-.. .....|.++    .+....   
T Consensus       636 ~-i~~~L~~Lr~L~l~~s~~~-----~~~~~l~el~~Le~L~~ls~~~~s~-~~~e~l~~~~~L~~~~~~l~~~~~~~~~  708 (889)
T KOG4658|consen  636 G-ILLELQSLRVLRLPRSALS-----NDKLLLKELENLEHLENLSITISSV-LLLEDLLGMTRLRSLLQSLSIEGCSKRT  708 (889)
T ss_pred             c-hhhhcccccEEEeeccccc-----cchhhHHhhhcccchhhheeecchh-HhHhhhhhhHHHHHHhHhhhhcccccce
Confidence            4 3667999999999876522     2233456777888888888755443 11111 111222221    111111   


Q ss_pred             cccccCCCCcCceEEEeecCchhh-----hhhHHH-HhcccceeecCCccchhhhhhccCCCCCCcccEEeccccccccc
Q 037941          226 VWSWTGKYETSRTLKLKLDNRMYL-----EHGIKM-LLRRTEDLHLDKLNGLQNVLHELDGEGFPRLKHLLVQNASEILY  299 (308)
Q Consensus       226 ~~~~~~~~~~L~~L~L~~~~~~~~-----~~~~~~-~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~  299 (308)
                      .......+++|+.|.+..+.....     ...... .|+++..+.+.+|...+...|..   -.|+|+.|.+..|+.++.
T Consensus       709 ~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~---f~~~L~~l~l~~~~~~e~  785 (889)
T KOG4658|consen  709 LISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLL---FAPHLTSLSLVSCRLLED  785 (889)
T ss_pred             eecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhh---ccCcccEEEEeccccccc
Confidence            122355677888888777654321     111111 26788888888888888766542   247899999999988888


Q ss_pred             cccCc
Q 037941          300 IVSSV  304 (308)
Q Consensus       300 i~~~~  304 (308)
                      +++..
T Consensus       786 ~i~~~  790 (889)
T KOG4658|consen  786 IIPKL  790 (889)
T ss_pred             CCCHH
Confidence            87643



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 71.1 bits (175), Expect = 3e-14
 Identities = 38/165 (23%), Positives = 69/165 (41%), Gaps = 28/165 (16%)

Query: 49  IQELPEKL-ECPKLKLFFLFSEKLSLVIPDLF--------FEGVPSLQVLSLNGFHFPSL 99
           ++ LP  +    +L+   + +      +P+           +G+ +LQ L L      SL
Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSL 198

Query: 100 PSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISN 159
           P+++ +      L+ L     RNS +  L   I  L +L+ LDL  C+ L++  P +   
Sbjct: 199 PASIAN------LQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNY-PPIFGG 251

Query: 160 LPRLEELYMGNSFTHWEVEGQNNASLAEL-NQLSRLTTLEMLILD 203
              L+ L +           ++ ++L  L   + RLT LE L L 
Sbjct: 252 RAPLKRLIL-----------KDCSNLLTLPLDIHRLTQLEKLDLR 285


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.66
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.52
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.51
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.1
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.06
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.03
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.02
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.96
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.86
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.16
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.93
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.55
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.12
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.5
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.64
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
Probab=99.92  E-value=1.4e-24  Score=197.39  Aligned_cols=148  Identities=21%  Similarity=0.236  Sum_probs=117.7

Q ss_pred             eecccchhhHhhhhcCCCCeeEEeecCCCCCC-CCcC-CCCCccEEEecCCCCcCCCCchhhcCCCCccEEEccCCCCCC
Q 037941           21 IQIISDLREVFEDLMQKDPIAISHPCRDIQEL-PEKL-ECPKLKLFFLFSEKLSLVIPDLFFEGVPSLQVLSLNGFHFPS   98 (308)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~-~~~~-~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~   98 (308)
                      .+.+.++..+|.  ..+++++|++++|.+..+ |..+ .+++|++|++++|.+.+.++...+.++++|++|++++|.+..
T Consensus        16 ~c~~~~l~~lp~--l~~~l~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~~~~~i~~~~~~~l~~L~~L~Ls~n~l~~   93 (455)
T 3v47_A           16 ICINRGLHQVPE--LPAHVNYVDLSLNSIAELNETSFSRLQDLQFLKVEQQTPGLVIRNNTFRGLSSLIILKLDYNQFLQ   93 (455)
T ss_dssp             ECCSSCCSSCCC--CCTTCCEEECCSSCCCEECTTTTSSCTTCCEEECCCCSTTCEECTTTTTTCTTCCEEECTTCTTCE
T ss_pred             CcCCCCcccCCC--CCCccCEEEecCCccCcCChhHhccCccccEEECcCCcccceECcccccccccCCEEeCCCCccCc
Confidence            455778888886  578999999999999776 4445 999999999999998777777667899999999999999996


Q ss_pred             C-CCCCCCcccccccccccEEeecCCcCcc-cchh--hhCcCCCCEEecCCCCCCCccCcchhcCCCCCceEEccCCccc
Q 037941           99 L-PSTLGDVATVGVLKKLVIFSFRNSHIEQ-LPEE--IGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTH  174 (308)
Q Consensus        99 l-p~~~~~~~~l~~l~~L~~L~l~~~~i~~-l~~~--~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~  174 (308)
                      + |..      ++.+++|++|++++|.++. ++..  +..+++|+.|++++|......|...+..+++|++|++++|.+.
T Consensus        94 ~~~~~------~~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~  167 (455)
T 3v47_A           94 LETGA------FNGLANLEVLTLTQCNLDGAVLSGNFFKPLTSLEMLVLRDNNIKKIQPASFFLNMRRFHVLDLTFNKVK  167 (455)
T ss_dssp             ECTTT------TTTCTTCCEEECTTSCCBTHHHHSSTTTTCTTCCEEECCSSBCCSCCCCGGGGGCTTCCEEECTTCCBS
T ss_pred             cChhh------ccCcccCCEEeCCCCCCCccccCcccccCcccCCEEECCCCccCccCcccccCCCCcccEEeCCCCccc
Confidence            6 555      7888888888888888873 4444  7788888888888887333335544677888888888888766


Q ss_pred             cc
Q 037941          175 WE  176 (308)
Q Consensus       175 ~~  176 (308)
                      +.
T Consensus       168 ~~  169 (455)
T 3v47_A          168 SI  169 (455)
T ss_dssp             CC
T ss_pred             cc
Confidence            43



>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (98), Expect = 3e-05
 Identities = 25/113 (22%), Positives = 43/113 (38%), Gaps = 13/113 (11%)

Query: 87  QVLSLNGFHFPSLPSTLGDVATVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTC 146
           Q L L G +    P   G + + GV+     F    S ++Q   E     R++ +DLS  
Sbjct: 3   QTLDLTGKNL--HPDVTGRLLSQGVI----AFRCPRSFMDQPLAEHFSPFRVQHMDLSNS 56

Query: 147 SKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAELNQLSRLTTLEM 199
               S    ++S   +L+ L         E    ++  +  L + S L  L +
Sbjct: 57  VIEVSTLHGILSQCSKLQNL-------SLEGLRLSDPIVNTLAKNSNLVRLNL 102


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.02
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.91
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.87
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.84  E-value=1.8e-19  Score=157.59  Aligned_cols=175  Identities=19%  Similarity=0.216  Sum_probs=121.2

Q ss_pred             cccccccccEEeecCCcCcccchhhhCcCCCCEEecCCCCCCCccCcchhcCCCCCceEEccCCcccccccCCcccchhh
Q 037941          108 TVGVLKKLVIFSFRNSHIEQLPEEIGQLTRLKLLDLSTCSKLKSIRPNVISNLPRLEELYMGNSFTHWEVEGQNNASLAE  187 (308)
Q Consensus       108 ~l~~l~~L~~L~l~~~~i~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~  187 (308)
                      ....+++++++++++|.++.++. ...+++|+.|++++|. ++.++.  +..+++|+.+++++|.+.+         ...
T Consensus       192 ~~~~l~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~-l~~~~~--l~~l~~L~~L~l~~n~l~~---------~~~  258 (384)
T d2omza2         192 VLAKLTNLESLIATNNQISDITP-LGILTNLDELSLNGNQ-LKDIGT--LASLTNLTDLDLANNQISN---------LAP  258 (384)
T ss_dssp             GGGGCTTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSC-CCCCGG--GGGCTTCSEEECCSSCCCC---------CGG
T ss_pred             ccccccccceeeccCCccCCCCc-ccccCCCCEEECCCCC-CCCcch--hhcccccchhccccCccCC---------CCc
Confidence            34556777788888887776655 5677889999999987 666664  7888999999999998772         234


Q ss_pred             hhcCCCCCEEEeeeccCccccchhhccCCceeEeeccCccc--ccCCCCcCceEEEeecCchhhhhhHHHHhcccceeec
Q 037941          188 LNQLSRLTTLEMLILDAQVMPRELFSLGLERNKIFLGDVWS--WTGKYETSRTLKLKLDNRMYLEHGIKMLLRRTEDLHL  265 (308)
Q Consensus       188 l~~l~~L~~L~l~~~~~~~~p~~~~~~~L~~l~i~~~~~~~--~~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~L~~L~l  265 (308)
                      +..+++|+.|+++++.+..++.......++.+....+.+..  ....+++++.|+++.|..... ..+.. +++|++|++
T Consensus       259 ~~~~~~L~~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l~~l-~~l~~-l~~L~~L~L  336 (384)
T d2omza2         259 LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDI-SPVSS-LTKLQRLFF  336 (384)
T ss_dssp             GTTCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSCCSCC-GGGGG-CTTCCEEEC
T ss_pred             ccccccCCEeeccCcccCCCCccccccccccccccccccccccccchhcccCeEECCCCCCCCC-ccccc-CCCCCEEEC
Confidence            67788899999988888777765555666666665544332  255667777777777655442 23333 477888888


Q ss_pred             CCccchhhhhhccCCCCCCcccEEecccccccccccc
Q 037941          266 DKLNGLQNVLHELDGEGFPRLKHLLVQNASEILYIVS  302 (308)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~  302 (308)
                      +++ .++.+. .+  +.+++|++|++++| +++.++.
T Consensus       337 ~~n-~l~~l~-~l--~~l~~L~~L~l~~N-~l~~l~~  368 (384)
T d2omza2         337 ANN-KVSDVS-SL--ANLTNINWLSAGHN-QISDLTP  368 (384)
T ss_dssp             CSS-CCCCCG-GG--GGCTTCCEEECCSS-CCCBCGG
T ss_pred             CCC-CCCCCh-hH--cCCCCCCEEECCCC-cCCCChh
Confidence            774 555543 23  45777888888776 5666654



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure