Citrus Sinensis ID: 037945


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MDSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDTEHDFDL
ccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHcccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccHcHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccccccc
mdslinpimdylvcplcgviskhcgyvcglTDSLNSLREAGRDLVNITRDVEARVDLAVEQrlrpthevnGWLESAKIMLREVDYILhrgdeeiqktclrktcfpgswssrdklgkEASEKIVAVEELIGrghfavvaekpprapveerpigktvglDSIISEVWRCIEDHNEKVIglygmggvgkTTLLKKLNNKfrdtehdfdl
MDSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLaveqrlrpthevngwlesaKIMLREVDYILHRGdeeiqktclrktcfpgswssrdklgkEASEKIVAVEeligrghfavvaekpprapveerpigktvgldSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKlnnkfrdtehdfdl
MDSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGkttllkklnnkFRDTEHDFDL
***LINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSS********SEKIVAVEELIGRGHFAVVAE**********PIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLN************
MDSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDT*HDFDL
MDSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFR********
*DSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDTE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDTEHDFDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q9LMP6 851 Probable disease resistan yes no 0.917 0.222 0.342 1e-23
Q9FG91 848 Probable disease resistan no no 0.907 0.220 0.356 2e-23
Q9FG90 862 Probable disease resistan no no 0.956 0.228 0.325 1e-22
Q9FLB4 874 Putative disease resistan no no 0.951 0.224 0.338 2e-21
Q9C8K0 854 Probable disease resistan no no 0.917 0.221 0.321 2e-21
Q8RXS5 888 Probable disease resistan no no 0.946 0.219 0.323 9e-21
O22727 967 Probable disease resistan no no 0.946 0.201 0.323 1e-20
P60839 884 Probable disease resistan no no 0.839 0.195 0.357 3e-20
P60838 894 Probable disease resistan no no 0.878 0.202 0.331 4e-20
O64973 889 Disease resistance protei no no 0.912 0.211 0.328 6e-20
>sp|Q9LMP6|DRL3_ARATH Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=3 SV=2 Back     alignment and function desciption
 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 102/190 (53%), Gaps = 1/190 (0%)

Query: 17  CGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESA 76
           CG +     Y+  +  +L +L+   ++L     D+  RV +  ++ L+   +V GWL   
Sbjct: 19  CGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRV 78

Query: 77  KIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAV 136
           K +  +V+ +L     + ++ CL   C     S R+  G    +K+  VE L+ +G F V
Sbjct: 79  KDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRN-YGINVLKKLKHVEGLLAKGVFEV 137

Query: 137 VAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNK 196
           VAEK P   VE++ I  TVGLD+++   W  +     + +GLYGMGGVGKTTLL  +NNK
Sbjct: 138 VAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNK 197

Query: 197 FRDTEHDFDL 206
           F +  + FDL
Sbjct: 198 FLEGMNGFDL 207




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG90|DRL33_ARATH Probable disease resistance protein At5g43740 OS=Arabidopsis thaliana GN=At5g43740 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8K0|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
359494501 781 PREDICTED: probable disease resistance p 0.970 0.256 0.490 8e-44
147815260 2471 hypothetical protein VITISV_010987 [Viti 0.970 0.080 0.490 1e-43
225442519 937 PREDICTED: disease resistance protein RF 0.970 0.213 0.465 9e-43
225442517 909 PREDICTED: probable disease resistance p 0.970 0.220 0.460 2e-42
147794278 955 hypothetical protein VITISV_031554 [Viti 0.970 0.209 0.470 2e-42
359482574 888 PREDICTED: probable disease resistance p 0.975 0.226 0.465 1e-41
225442539 882 PREDICTED: probable disease resistance p 0.966 0.225 0.470 1e-40
147838868 882 hypothetical protein VITISV_011431 [Viti 0.966 0.225 0.470 1e-40
147859094 881 hypothetical protein VITISV_018933 [Viti 0.941 0.220 0.475 2e-40
297743218 927 unnamed protein product [Vitis vinifera] 0.970 0.215 0.450 6e-40
>gi|359494501|ref|XP_002266171.2| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  182 bits (462), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 134/202 (66%), Gaps = 2/202 (0%)

Query: 5   INPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLR 64
           + PIMD +   L    SKH  YV  L ++L SLR    +L N+  DV+ RV+ A +++++
Sbjct: 4   VTPIMD-VATRLWSCASKHSSYVIDLQENLCSLRNEMEELKNVGEDVKRRVEDAEKRQMK 62

Query: 65  PTHEVNGWLESAKIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVA 124
             +EVNGWL S   + REV+ IL +GD+EIQK CLR  C      S  K+GK A EKI A
Sbjct: 63  RRNEVNGWLNSLTALEREVNEILEKGDQEIQKKCLRNCCTRNCRFSY-KIGKMAREKIPA 121

Query: 125 VEELIGRGHFAVVAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGV 184
           V EL  +GHF VVA+  P APV+E+P+ K+VGL+ +  E+WR +ED    +IGLYGMGGV
Sbjct: 122 VSELKNKGHFDVVADILPSAPVDEKPMEKSVGLNLMFGEIWRWLEDEKVGIIGLYGMGGV 181

Query: 185 GKTTLLKKLNNKFRDTEHDFDL 206
           GKTTL+KK+NN+F  T+  FD+
Sbjct: 182 GKTTLMKKINNEFLKTKLGFDV 203




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147815260|emb|CAN74430.1| hypothetical protein VITISV_010987 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442519|ref|XP_002278659.1| PREDICTED: disease resistance protein RFL1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442517|ref|XP_002278567.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147794278|emb|CAN69161.1| hypothetical protein VITISV_031554 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482574|ref|XP_003632788.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442539|ref|XP_002278938.1| PREDICTED: probable disease resistance protein At5g63020 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147838868|emb|CAN70333.1| hypothetical protein VITISV_011431 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147859094|emb|CAN80410.1| hypothetical protein VITISV_018933 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743218|emb|CBI36085.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2036214 851 AT1G15890 [Arabidopsis thalian 0.917 0.222 0.3 1.2e-18
TAIR|locus:2170892 848 AT5G43730 [Arabidopsis thalian 0.907 0.220 0.308 8.2e-18
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.946 0.219 0.287 1.1e-17
TAIR|locus:2170902 862 AT5G43740 [Arabidopsis thalian 0.912 0.218 0.289 1.6e-16
TAIR|locus:2153474 874 AT5G05400 [Arabidopsis thalian 0.951 0.224 0.297 1.7e-16
TAIR|locus:2034765 884 AT1G12290 [Arabidopsis thalian 0.864 0.201 0.309 4.5e-16
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.936 0.199 0.286 6.6e-16
TAIR|locus:2034770 894 SUMM2 "AT1G12280" [Arabidopsis 0.776 0.178 0.312 1.6e-15
TAIR|locus:2201986 885 RFL1 "AT1G12210" [Arabidopsis 0.868 0.202 0.320 3.2e-15
TAIR|locus:2132741 892 AT4G10780 [Arabidopsis thalian 0.864 0.199 0.302 8.8e-15
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 1.2e-18, P = 1.2e-18
 Identities = 57/190 (30%), Positives = 93/190 (48%)

Query:    17 CGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESA 76
             CG +     Y+  +  +L +L+   ++L     D+  RV +  ++ L+   +V GWL   
Sbjct:    19 CGCLFGDRNYILKMEANLEALQNTMQELEERRDDLLRRVVIEEDKGLQRLAQVQGWLSRV 78

Query:    77 KIMLREVDYILHRGDEEIQKTCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAV 136
             K +  +V+ +L     + ++ CL   C     S R+  G    +K+  VE L+ +G F V
Sbjct:    79 KDVCSQVNDLLKAKSIQTERLCLCGYCSKNFISGRN-YGINVLKKLKHVEGLLAKGVFEV 137

Query:   137 VAEKPPRAPVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGXXXXXXXXXXX 196
             VAEK P   VE++ I  TVGLD+++   W  +     + +GLYGMGGVG           
Sbjct:   138 VAEKIPAPKVEKKHIQTTVGLDAMVGRAWNSLMKDERRTLGLYGMGGVGKTTLLASINNK 197

Query:   197 FRDTEHDFDL 206
             F +  + FDL
Sbjct:   198 FLEGMNGFDL 207




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034334001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (2485 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
pfam00931 285 pfam00931, NB-ARC, NB-ARC domain 1e-06
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 47.3 bits (113), Expect = 1e-06
 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 172 NEKVIGLYGMGGVGKTTLLKKLNNKFRDTEHDFDL 206
           N  V+G+ GMGGVGKTTL K++ N        FD 
Sbjct: 18  NLGVVGIVGMGGVGKTTLAKQIYNDDS-VGGHFDS 51


Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.86
COG0488 530 Uup ATPase components of ABC transporters with dup 98.45
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.4
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 98.31
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 98.26
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.25
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.24
KOG0927 614 consensus Predicted transporter (ABC superfamily) 98.22
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.21
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 98.16
COG4559 259 ABC-type hemin transport system, ATPase component 98.15
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.14
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 98.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.12
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 98.11
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.11
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.11
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 98.11
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.11
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.11
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 98.07
COG4987 573 CydC ABC-type transport system involved in cytochr 98.06
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 98.05
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 98.04
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.03
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.02
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 98.02
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 98.02
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.0
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 98.0
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.0
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 98.0
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 98.0
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.0
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 97.99
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.99
PRK13536 340 nodulation factor exporter subunit NodI; Provision 97.99
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 97.99
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 97.99
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.99
COG4555 245 NatA ABC-type Na+ transport system, ATPase compone 97.99
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 97.98
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.98
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.98
COG0410 237 LivF ABC-type branched-chain amino acid transport 97.98
PRK13537 306 nodulation ABC transporter NodI; Provisional 97.98
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 97.98
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 97.98
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 97.98
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.98
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 97.98
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.97
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 97.97
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 97.96
COG1127 263 Ttg2A ABC-type transport system involved in resist 97.96
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.96
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 97.96
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 97.96
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 97.95
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.95
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 97.94
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 97.94
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 97.94
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.93
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 97.93
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 97.93
COG3638 258 ABC-type phosphate/phosphonate transport system, A 97.92
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.92
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 97.92
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.92
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.91
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 97.9
PRK10938 490 putative molybdenum transport ATP-binding protein 97.9
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.9
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 97.89
COG2884 223 FtsE Predicted ATPase involved in cell division [C 97.89
PRK11147 635 ABC transporter ATPase component; Reviewed 97.89
cd03223 166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.89
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.88
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 97.88
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 97.88
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 97.88
PRK10908 222 cell division protein FtsE; Provisional 97.87
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 97.87
cd03228 171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.87
cd03230 173 ABC_DR_subfamily_A This family of ATP-binding prot 97.87
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.87
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 97.87
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 97.87
cd03246 173 ABCC_Protease_Secretion This family represents the 97.86
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.86
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.86
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 97.86
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 97.86
PRK11147 635 ABC transporter ATPase component; Reviewed 97.86
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 97.86
cd03216 163 ABC_Carb_Monos_I This family represents the domain 97.86
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.85
COG0488 530 Uup ATPase components of ABC transporters with dup 97.85
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 97.85
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 97.85
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 97.85
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.84
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 97.84
cd03247 178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.84
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.84
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 97.84
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 97.84
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.84
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 97.84
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 97.84
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 97.84
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.84
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.83
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 97.83
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.82
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.82
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.82
PLN03073 718 ABC transporter F family; Provisional 97.82
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 97.82
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.82
PRK13342 413 recombination factor protein RarA; Reviewed 97.82
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.82
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.81
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.81
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.81
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.8
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 97.8
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.8
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 97.8
COG4619 223 ABC-type uncharacterized transport system, ATPase 97.8
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 97.79
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 97.79
COG4133 209 CcmA ABC-type transport system involved in cytochr 97.79
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 97.79
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 97.79
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.77
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 97.77
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.77
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.77
COG0411 250 LivG ABC-type branched-chain amino acid transport 97.77
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.77
PRK13546 264 teichoic acids export protein ATP-binding subunit; 97.77
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.76
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 97.76
PRK09984 262 phosphonate/organophosphate ester transporter subu 97.76
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.76
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 97.76
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 97.76
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 97.76
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.75
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 97.75
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 97.75
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.75
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.75
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 97.75
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 97.75
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 97.75
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 97.74
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 97.74
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 97.74
cd03234 226 ABCG_White The White subfamily represents ABC tran 97.74
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 97.74
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.74
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.73
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 97.73
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.73
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 97.73
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 97.73
PTZ00202 550 tuzin; Provisional 97.73
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.73
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 97.73
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 97.72
PRK13409 590 putative ATPase RIL; Provisional 97.72
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 97.72
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.72
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 97.72
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 97.72
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 97.72
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 97.71
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 97.71
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.71
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 97.7
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 97.7
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 97.7
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.7
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.7
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 97.69
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 97.69
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.69
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 97.69
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.69
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 97.69
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.69
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.68
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 97.68
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.68
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.68
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 97.68
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 97.68
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 97.67
PRK12402 337 replication factor C small subunit 2; Reviewed 97.67
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.67
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 97.67
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 97.67
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.67
COG4152 300 ABC-type uncharacterized transport system, ATPase 97.66
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 97.66
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 97.66
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 97.66
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 97.66
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.66
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 97.66
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 97.65
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 97.65
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.65
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.64
COG4586 325 ABC-type uncharacterized transport system, ATPase 97.64
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 97.63
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 97.63
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 97.63
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.62
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 97.62
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 97.62
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 97.62
PRK10522 547 multidrug transporter membrane component/ATP-bindi 97.62
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.62
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 97.61
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 97.61
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 97.61
PLN03025 319 replication factor C subunit; Provisional 97.61
PRK14236 272 phosphate transporter ATP-binding protein; Provisi 97.61
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 97.61
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 97.61
PRK09376 416 rho transcription termination factor Rho; Provisio 97.61
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.61
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 97.6
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 97.6
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 97.6
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 97.59
PRK00411 394 cdc6 cell division control protein 6; Reviewed 97.59
PRK14275 286 phosphate ABC transporter ATP-binding protein; Pro 97.59
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.58
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.58
COG4525 259 TauB ABC-type taurine transport system, ATPase com 97.58
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 97.58
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.58
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 97.57
PRK10938 490 putative molybdenum transport ATP-binding protein 97.57
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 97.56
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 97.55
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 97.55
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.55
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.55
PRK13409 590 putative ATPase RIL; Provisional 97.55
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.55
TIGR01842 544 type_I_sec_PrtD type I secretion system ABC transp 97.54
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.54
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 97.53
PRK04195 482 replication factor C large subunit; Provisional 97.53
COG1123 539 ATPase components of various ABC-type transport sy 97.53
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.53
PLN03073 718 ABC transporter F family; Provisional 97.52
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 97.52
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.52
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 97.52
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 97.51
PRK15455 644 PrkA family serine protein kinase; Provisional 97.51
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.5
COG4778 235 PhnL ABC-type phosphonate transport system, ATPase 97.5
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.5
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.49
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.49
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 97.49
COG4598 256 HisP ABC-type histidine transport system, ATPase c 97.48
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.48
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 97.48
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 97.47
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.47
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.47
CHL00095 821 clpC Clp protease ATP binding subunit 97.47
KOG2028 554 consensus ATPase related to the helicase subunit o 97.46
PHA02544 316 44 clamp loader, small subunit; Provisional 97.44
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.44
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 97.43
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.43
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.43
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 97.43
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.42
PRK11160 574 cysteine/glutathione ABC transporter membrane/ATP- 97.42
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 97.42
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 97.41
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 97.4
PRK14266 250 phosphate ABC transporter ATP-binding protein; Pro 97.4
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 97.39
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 97.39
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 97.38
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.38
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.38
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.37
PRK13341 725 recombination factor protein RarA/unknown domain f 97.37
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.37
PRK10865 857 protein disaggregation chaperone; Provisional 97.36
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.36
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 97.34
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 97.33
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 97.33
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 97.32
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 97.32
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 97.32
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.31
PRK13531 498 regulatory ATPase RavA; Provisional 97.3
KOG0056 790 consensus Heavy metal exporter HMT1, ABC superfami 97.3
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.3
TIGR01194 555 cyc_pep_trnsptr cyclic peptide transporter. This m 97.3
cd03279 213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 97.28
KOG0057 591 consensus Mitochondrial Fe/S cluster exporter, ABC 97.27
COG1101 263 PhnK ABC-type uncharacterized transport system, AT 97.27
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 97.26
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.26
PF1355562 AAA_29: P-loop containing region of AAA domain 97.25
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.25
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.24
COG3845 501 ABC-type uncharacterized transport systems, ATPase 97.23
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.23
COG4988 559 CydD ABC-type transport system involved in cytochr 97.23
PLN02796 347 D-glycerate 3-kinase 97.23
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 97.19
PRK10416 318 signal recognition particle-docking protein FtsY; 97.18
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.18
PRK08084 235 DNA replication initiation factor; Provisional 97.17
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 97.16
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 97.15
PLN03211 659 ABC transporter G-25; Provisional 97.15
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.14
PRK08727 233 hypothetical protein; Validated 97.14
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 97.13
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.13
TIGR00767 415 rho transcription termination factor Rho. Members 97.12
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 97.11
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 97.11
PRK01889 356 GTPase RsgA; Reviewed 97.11
TIGR02858 270 spore_III_AA stage III sporulation protein AA. Mem 97.09
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 97.09
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.09
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.05
PRK03992 389 proteasome-activating nucleotidase; Provisional 97.05
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.04
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 97.04
cd03280 200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.04
PLN02318 656 phosphoribulokinase/uridine kinase 97.03
PRK10536 262 hypothetical protein; Provisional 97.03
PRK09087 226 hypothetical protein; Validated 97.02
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.02
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 97.02
cd03243 202 ABC_MutS_homologs The MutS protein initiates DNA m 97.01
PRK08903 227 DnaA regulatory inactivator Hda; Validated 97.01
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.01
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.01
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.99
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.99
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.99
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 96.98
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.98
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.98
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.97
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.97
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 96.95
PRK00098 298 GTPase RsgA; Reviewed 96.95
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 96.94
PRK08099 399 bifunctional DNA-binding transcriptional repressor 96.94
COG4181 228 Predicted ABC-type transport system involved in ly 96.92
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 96.91
PLN03046 460 D-glycerate 3-kinase; Provisional 96.91
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 96.91
PRK06893 229 DNA replication initiation factor; Validated 96.9
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.9
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 96.9
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 96.88
CHL00181 287 cbbX CbbX; Provisional 96.88
PLN03232 1495 ABC transporter C family member; Provisional 96.87
PRK09183 259 transposase/IS protein; Provisional 96.87
PLN02165 334 adenylate isopentenyltransferase 96.86
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 96.86
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 96.86
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.86
PLN02348 395 phosphoribulokinase 96.85
KOG0927 614 consensus Predicted transporter (ABC superfamily) 96.85
PRK09435 332 membrane ATPase/protein kinase; Provisional 96.84
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.83
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.83
PRK06620 214 hypothetical protein; Validated 96.82
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.82
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.82
PRK05439 311 pantothenate kinase; Provisional 96.81
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.81
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 96.8
PLN02200 234 adenylate kinase family protein 96.79
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.79
PRK14974 336 cell division protein FtsY; Provisional 96.78
PLN03130 1622 ABC transporter C family member; Provisional 96.77
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 96.77
TIGR02788 308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 96.77
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 96.76
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 96.76
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 96.76
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 96.76
PRK10535 648 macrolide transporter ATP-binding /permease protei 96.76
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.75
TIGR00064 272 ftsY signal recognition particle-docking protein F 96.75
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.74
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 96.73
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.72
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 96.72
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.72
PRK09112 351 DNA polymerase III subunit delta'; Validated 96.71
KOG0062 582 consensus ATPase component of ABC transporters wit 96.71
PRK09862 506 putative ATP-dependent protease; Provisional 96.7
cd03281 213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.7
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.69
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.66
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 96.65
COG5265 497 ATM1 ABC-type transport system involved in Fe-S cl 96.63
PTZ00243 1560 ABC transporter; Provisional 96.62
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 96.62
TIGR02782 299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.62
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 96.62
COG4136 213 ABC-type uncharacterized transport system, ATPase 96.62
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.6
PF1324576 AAA_19: Part of AAA domain 96.6
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 96.59
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 96.59
PRK10646153 ADP-binding protein; Provisional 96.59
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 96.59
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 96.59
PRK06835 329 DNA replication protein DnaC; Validated 96.58
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.58
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 96.56
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 96.56
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.54
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 96.54
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 96.53
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 96.53
PLN03140 1470 ABC transporter G family member; Provisional 96.52
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.51
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 96.51
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 96.5
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 96.5
PHA02244 383 ATPase-like protein 96.5
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 96.49
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.49
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 96.48
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 96.48
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 96.48
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 96.48
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 96.47
PRK10865 857 protein disaggregation chaperone; Provisional 96.47
PRK04220 301 2-phosphoglycerate kinase; Provisional 96.47
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.47
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 96.47
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.46
COG0714 329 MoxR-like ATPases [General function prediction onl 96.46
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 96.46
PTZ00243 1560 ABC transporter; Provisional 96.46
PRK06851 367 hypothetical protein; Provisional 96.46
PLN03232 1495 ABC transporter C family member; Provisional 96.46
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.45
PLN03130 1622 ABC transporter C family member; Provisional 96.45
PRK14489 366 putative bifunctional molybdopterin-guanine dinucl 96.44
PRK06526 254 transposase; Provisional 96.44
cd01853 249 Toc34_like Toc34-like (Translocon at the Outer-env 96.44
COG4615 546 PvdE ABC-type siderophore export system, fused ATP 96.43
COG1123 539 ATPase components of various ABC-type transport sy 96.41
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 96.4
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.39
COG1137 243 YhbG ABC-type (unclassified) transport system, ATP 96.39
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.37
PRK12288 347 GTPase RsgA; Reviewed 96.37
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 96.37
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 96.36
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 96.35
PRK12289 352 GTPase RsgA; Reviewed 96.34
PRK07471 365 DNA polymerase III subunit delta'; Validated 96.32
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 96.32
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.31
PRK05642 234 DNA replication initiation factor; Validated 96.31
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 96.31
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 96.31
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 96.3
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 96.3
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.28
COG1419 407 FlhF Flagellar GTP-binding protein [Cell motility 96.27
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 96.26
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 96.26
PRK13851 344 type IV secretion system protein VirB11; Provision 96.25
PRK12377 248 putative replication protein; Provisional 96.22
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 96.21
COG4674 249 Uncharacterized ABC-type transport system, ATPase 96.21
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.2
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.85  E-value=1.3e-20  Score=168.64  Aligned_cols=192  Identities=30%  Similarity=0.463  Sum_probs=144.6

Q ss_pred             CCCccchhhhhhhhhHhhhhhhhccccccchHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCchhHHHHHHHHHHHH
Q 037945            1 MDSLINPIMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQRLRPTHEVNGWLESAKIML   80 (206)
Q Consensus         1 M~~~~s~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~ae~~~~~~~~~~~~wl~~l~~~~   80 (206)
                      |++++|..+..    +.+.+.+....+.+..+++..|++.|..|++++.++++.       +.. .....+|...+++..
T Consensus         1 ~~~~~s~~~~~----~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~-------~~~-~~~~~~~~e~~~~~~   68 (889)
T KOG4658|consen    1 MGACVSFGVEK----LDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAK-------RDD-LERRVNWEEDVGDLV   68 (889)
T ss_pred             CCeEEEEehhh----HHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhh-------cch-HHHHHHHHHHHHHHH
Confidence            56666654443    667888999999999999999999999999999996544       443 478999999999999


Q ss_pred             HHHHHHHhhhhHhhhh----------------hccCCccCCCCcccccchhHHHHHHHHHHHHHHhcCCcccccc-CCCC
Q 037945           81 REVDYILHRGDEEIQK----------------TCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAE-KPPR  143 (206)
Q Consensus        81 ~~~ed~ld~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~-~~~~  143 (206)
                      |+++|+++.+..+...                -|+.++| ..++...+.+++++...++.++....+..|..... ..+.
T Consensus        69 ~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~-~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~  147 (889)
T KOG4658|consen   69 YLAEDIIWLFLVEEIERKANDLLSTRSVERQRLCLCGFC-SKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPR  147 (889)
T ss_pred             HHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhH-hHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccch
Confidence            9999999998765322                1233444 34455557777888888888888776655544332 1122


Q ss_pred             CCccccCCCCc--cchHHHHHHHHHhhhcCCCeEEEEEcCCCCcHHHHHHHHHhhhc-CCCCCCcC
Q 037945          144 APVEERPIGKT--VGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFR-DTEHDFDL  206 (206)
Q Consensus       144 ~~~~~~~~~~~--~g~~~~~~~l~~~L~~~~~~vI~IvG~~G~GKTTLa~~i~~~~~-~~~~~Fd~  206 (206)
                      +.....+....  +|.+..++++++.|.+++..++||+||||+||||||+.|+|+.. +. ++||.
T Consensus       148 ~~~e~~~~~~~~~VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~-~~Fd~  212 (889)
T KOG4658|consen  148 EKVETRPIQSESDVGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVG-NHFDG  212 (889)
T ss_pred             hhcccCCCCccccccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhc-ccCce
Confidence            22222222222  99999999999999998879999999999999999999999988 65 99984



>PLN03210 Resistant to P Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 8e-08
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 6e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 55.6 bits (133), Expect = 2e-09
 Identities = 29/195 (14%), Positives = 63/195 (32%), Gaps = 63/195 (32%)

Query: 42  RDLV-----NITRDVEARVDLAVEQRLRPTHEVNGWLESAKIMLREVDYILHRGDEEIQK 96
           +D++         + + +    V+   +             +   E+D+I+   D     
Sbjct: 19  KDILSVFEDAFVDNFDCK---DVQDMPKSI-----------LSKEEIDHIIMSKDAVSGT 64

Query: 97  TCLRKTCFPGSWSSRDKLGKEASEKIVAVEELIGRGHFAVVAEKPPRAPVEERPIGKTVG 156
             L    F   W+   K  +E  +K   VEE++ R ++  +       P++      ++ 
Sbjct: 65  LRL----F---WTLLSK-QEEMVQK--FVEEVL-RINYKFLMS-----PIKTEQRQPSMM 108

Query: 157 LDSIISE---------------VWRCIEDHN-----------EKVIGLYGMGGVGKTTL- 189
               I +               V R ++ +             K + + G+ G GKT + 
Sbjct: 109 TRMYIEQRDRLYNDNQVFAKYNVSR-LQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVA 167

Query: 190 LKKLNNKFRDTEHDF 204
           L    +     + DF
Sbjct: 168 LDVCLSYKVQCKMDF 182


>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.6
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.66
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.65
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 98.62
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.32
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.27
2p65_A 187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.18
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.08
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.07
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.07
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.06
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 98.05
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 98.04
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 98.02
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 98.02
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.01
1b0u_A 262 Histidine permease; ABC transporter, transport pro 97.99
1g6h_A 257 High-affinity branched-chain amino acid transport 97.99
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 97.99
1sgw_A 214 Putative ABC transporter; structural genomics, P p 97.99
1ji0_A 240 ABC transporter; ATP binding protein, structural g 97.99
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.98
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 97.98
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 97.97
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 97.97
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 97.96
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 97.96
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 97.95
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 97.94
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 97.94
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 97.93
2fna_A 357 Conserved hypothetical protein; structural genomic 97.93
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 97.92
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.92
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.92
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 97.92
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 97.91
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.9
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.85
3ec2_A 180 DNA replication protein DNAC; helicase loader, rep 97.85
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.85
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.83
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.83
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.83
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.82
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.82
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.82
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 97.8
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 97.8
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.8
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 97.79
3pvs_A 447 Replication-associated recombination protein A; ma 97.78
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 97.78
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 97.77
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 97.77
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 97.77
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 97.77
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 97.76
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 97.76
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 97.76
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.76
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 97.76
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 97.75
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.75
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 97.74
2ghi_A 260 Transport protein; multidrug resistance protein, M 97.74
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.73
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 97.72
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.71
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 97.7
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.69
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.69
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.68
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.68
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.67
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 97.67
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.67
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.66
2og2_A 359 Putative signal recognition particle receptor; nuc 97.66
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.65
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.65
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.64
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.64
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 97.62
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 97.61
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.61
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.61
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.61
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.6
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 97.6
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.59
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.57
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.57
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.57
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.56
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.55
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.55
3bos_A 242 Putative DNA replication factor; P-loop containing 97.55
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.54
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 97.53
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.53
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.51
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 97.51
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.51
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.48
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.47
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.47
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.47
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 97.46
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.46
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.45
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.45
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 97.44
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.44
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.44
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 97.42
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.42
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.41
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.4
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.4
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.4
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.39
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.37
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.36
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.36
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.36
2r44_A 331 Uncharacterized protein; putative ATPase, structur 97.36
2hf9_A 226 Probable hydrogenase nickel incorporation protein 97.35
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 97.34
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 97.34
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 97.34
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.33
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 97.3
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.3
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 97.3
3co5_A143 Putative two-component system transcriptional RES 97.3
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 97.29
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 97.29
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 97.28
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.26
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.26
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.25
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.25
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.23
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.2
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 97.19
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.19
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.19
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.19
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.19
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 97.18
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 97.18
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 97.17
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.17
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 97.16
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 97.14
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 97.14
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 97.12
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.12
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 97.12
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.08
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 97.06
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.05
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.99
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.99
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.98
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.97
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 96.95
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.95
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.93
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 96.93
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.92
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 96.92
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.92
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 96.91
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.9
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 96.89
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 96.89
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.88
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.87
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.86
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.85
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.84
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 96.84
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 96.84
2ged_A 193 SR-beta, signal recognition particle receptor beta 96.82
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 96.81
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.81
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 96.8
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.79
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 96.77
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.76
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.72
2qgz_A 308 Helicase loader, putative primosome component; str 96.72
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 96.72
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.7
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 96.69
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.68
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.67
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 96.64
1tue_A 212 Replication protein E1; helicase, replication, E1E 96.62
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.6
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.54
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.52
3fwy_A 314 Light-independent protochlorophyllide reductase I 96.48
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.47
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.46
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.44
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.42
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.42
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 96.41
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 96.41
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 96.4
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 96.38
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 96.38
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.35
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 96.34
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 96.33
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 96.31
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.31
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.29
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 96.28
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.27
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.26
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.26
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 96.25
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 96.23
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.2
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.16
2r6a_A 454 DNAB helicase, replicative helicase; replication, 96.13
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 96.13
3ice_A 422 Transcription termination factor RHO; transcriptio 96.12
3end_A 307 Light-independent protochlorophyllide reductase ir 96.12
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 96.11
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.1
2xxa_A 433 Signal recognition particle protein; protein trans 96.09
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 96.05
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 96.04
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.03
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 95.01
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 96.02
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 95.97
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 95.96
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 95.96
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 95.95
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 95.94
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.91
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.91
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.87
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 95.86
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 95.84
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 95.83
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.83
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 95.82
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.8
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 95.78
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 95.78
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.78
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.74
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.71
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.68
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 95.66
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 95.59
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 95.42
2z43_A 324 DNA repair and recombination protein RADA; archaea 95.36
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 95.33
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.31
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 95.29
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 95.25
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.15
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 95.13
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 95.05
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.05
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 95.02
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 94.99
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 94.99
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.87
1u94_A 356 RECA protein, recombinase A; homologous recombinat 94.86
3l0o_A 427 Transcription termination factor RHO; helicase, RH 94.83
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 94.79
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.79
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 94.75
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 94.7
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 94.68
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 94.58
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 94.55
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 94.55
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 94.48
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 94.47
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 94.34
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 94.32
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 94.31
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 94.31
1xp8_A 366 RECA protein, recombinase A; recombination, radior 94.24
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 94.2
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 94.17
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 94.0
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 93.89
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 93.77
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 93.73
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 93.73
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 93.68
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 93.59
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 93.57
3io5_A 333 Recombination and repair protein; storage dimer, i 93.55
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 93.47
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 93.38
3cio_A 299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 93.3
3bfv_A 271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 93.28
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 93.22
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 93.19
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 93.16
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 93.05
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 93.05
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 92.89
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 92.88
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 92.41
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 92.39
3la6_A 286 Tyrosine-protein kinase WZC; P-loop protein, nucle 92.34
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 92.14
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 91.93
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 91.87
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 91.85
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 91.8
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 91.79
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 91.77
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 91.7
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 91.53
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 91.45
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 91.26
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 91.18
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 91.15
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 91.08
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 90.93
3ez9_A 403 Para; DNA binding, winged-HTH, partition, biosynth 90.75
1knx_A 312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 90.62
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 90.44
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 90.17
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 90.06
3czq_A 304 Putative polyphosphate kinase 2; structural genomi 90.02
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 89.93
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 89.83
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 89.64
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 89.62
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 89.57
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 89.32
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 89.27
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 89.22
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 88.99
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 88.94
3e2i_A 219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 88.35
1cip_A 353 Protein (guanine nucleotide-binding protein alpha- 88.23
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 88.09
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 87.5
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 87.35
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 86.88
2olr_A 540 Phosphoenolpyruvate carboxykinase; carbon dioxide, 86.63
1j3b_A 529 ATP-dependent phosphoenolpyruvate carboxykinase; a 86.62
1ytm_A 532 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 86.37
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 86.33
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 86.28
1ii2_A 524 Phosphoenolpyruvate carboxykinase; phosphate bindi 86.19
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 86.05
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 85.65
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 85.27
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 84.65
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 83.78
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 83.54
2j9r_A 214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 83.31
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 83.04
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 82.92
3b6e_A 216 Interferon-induced helicase C domain-containing P; 82.61
1g5t_A 196 COB(I)alamin adenosyltransferase; P-loop protein, 82.21
3f8t_A 506 Predicted ATPase involved in replication control, 80.73
2gxq_A 207 Heat resistant RNA dependent ATPase; RNA helicase, 80.24
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
Probab=99.60  E-value=1.6e-15  Score=103.86  Aligned_cols=82  Identities=7%  Similarity=0.098  Sum_probs=70.6

Q ss_pred             hhhhhhhhHhhhhhhhccccccchHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhC-CCCchhHHHHHHHHHHHHHHHHHH
Q 037945            8 IMDYLVCPLCGVISKHCGYVCGLTDSLNSLREAGRDLVNITRDVEARVDLAVEQR-LRPTHEVNGWLESAKIMLREVDYI   86 (206)
Q Consensus         8 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~ae~~~-~~~~~~~~~wl~~l~~~~~~~ed~   86 (206)
                      +++.+..||.+++.+++.++.+++++++.|+++|+.|+++|.+       |+.+. ...++.++.|+.++|+++||+||+
T Consensus         2 ~v~~ll~KL~~ll~~E~~l~~gv~~~i~~Lk~eL~~m~a~L~d-------a~~~~~~~~d~~vk~W~~~vrdlaYD~ED~   74 (115)
T 3qfl_A            2 AISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESMNAALIK-------IGEVPREQLDSQDKLWADEVRELSYVIEDV   74 (115)
T ss_dssp             TTCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HTTSCGGGCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHH-------HHHhccccCCHHHHHHHHHHHHHHHHHHHH
Confidence            3455666799999999999999999999999999999999999       54442 123589999999999999999999


Q ss_pred             HhhhhHhhhh
Q 037945           87 LHRGDEEIQK   96 (206)
Q Consensus        87 ld~~~~~~~~   96 (206)
                      ||+|.++...
T Consensus        75 iD~f~~~~~~   84 (115)
T 3qfl_A           75 VDKFLVQVDG   84 (115)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHhcc
Confidence            9999998754



>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Back     alignment and structure
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d2a5yb3 277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-05
d1khta_ 190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 41.7 bits (97), Expect = 2e-05
 Identities = 10/60 (16%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 145 PVEERPIGKTVGLDSIISEVWRCIEDHNEKVIGLYGMGGVGKTTLLKKLNNKFRDTEHDF 204
           P +     +   +D +I ++   + D +   + L+G  G GK+ +  +  +K        
Sbjct: 17  PKQMTCYIREYHVDRVIKKL-DEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGIN 75


>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.23
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 98.31
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 98.24
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 98.22
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 98.2
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 98.19
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.18
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 98.17
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 98.17
d1g2912 240 Maltose transport protein MalK, N-terminal domain 98.16
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 98.15
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.15
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 98.14
d1jbka_ 195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.14
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.11
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 98.08
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.06
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 98.04
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.04
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 98.01
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 97.99
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 97.99
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.96
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 97.96
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 97.93
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 97.9
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.89
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 97.83
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.81
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 97.74
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.72
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 97.69
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.67
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 97.61
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 97.49
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 97.44
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 97.41
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.17
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 97.17
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 97.07
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.9
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.89
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.83
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.74
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.74
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.64
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 96.59
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 96.58
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.45
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.38
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 96.31
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.16
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 96.14
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.0
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.84
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.75
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.59
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 95.51
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.51
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.41
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.35
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.24
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.19
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.74
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 94.4
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 94.34
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 94.16
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 93.77
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 93.63
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.49
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.55
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 92.5
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 92.47
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 91.32
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 90.68
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.57
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 90.53
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 89.79
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 85.84
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 85.67
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 85.54
d2eyqa3 233 Transcription-repair coupling factor, TRCF {Escher 84.29
d1o5za2 296 Folylpolyglutamate synthetase {Thermotoga maritima 81.14
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.23  E-value=6.7e-12  Score=96.93  Aligned_cols=54  Identities=15%  Similarity=0.180  Sum_probs=43.9

Q ss_pred             CCccchHHHHHHHHHhhhc---CCCeEEEEEcCCCCcHHHHHHHHHhhhcC-CCCCCc
Q 037945          152 GKTVGLDSIISEVWRCIED---HNEKVIGLYGMGGVGKTTLLKKLNNKFRD-TEHDFD  205 (206)
Q Consensus       152 ~~~~g~~~~~~~l~~~L~~---~~~~vI~IvG~~G~GKTTLa~~i~~~~~~-~~~~Fd  205 (206)
                      ..+|||+.++++|+.+|.+   .+..+|+|+||||+||||||+.+|++... ...+|+
T Consensus        20 ~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~   77 (277)
T d2a5yb3          20 MTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYD   77 (277)
T ss_dssp             CCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBS
T ss_pred             CceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCc
Confidence            3478999999999999864   56789999999999999999999987542 124554



>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure