Citrus Sinensis ID: 037967


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
MAVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL
ccccccccEEEcccccccccEEEEEccccEEEEEEccccccccEEEEEcccccccccccccccccc
cccEEcccEEEccccccccEEEEEEccccEEEEEEcccccHHHHEEEEEcccccccccccccHHcc
mavgkddveiikprtdkrqYRRLVLKNSLQVLlisdpdadkcaasmnvsvgafcdpvgleglahfl
mavgkddveiikprtdkrqyrrLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL
MAVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL
******************QYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLA***
**********IKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL
MAVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL
*AVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGL**FL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query66 2.2.26 [Sep-21-2011]
O22941 970 Zinc-metallopeptidase, pe no no 1.0 0.068 0.732 5e-23
Q06010 1027 A-factor-processing enzym yes no 0.893 0.057 0.542 1e-12
Q9JHR7 1019 Insulin-degrading enzyme yes no 0.969 0.062 0.453 4e-11
Q24K02 1019 Insulin-degrading enzyme yes no 0.848 0.054 0.5 6e-11
P35559 1019 Insulin-degrading enzyme yes no 0.969 0.062 0.453 7e-11
P14735 1019 Insulin-degrading enzyme yes no 0.848 0.054 0.5 3e-10
P22817 990 Insulin-degrading enzyme yes no 0.848 0.056 0.553 6e-10
Q54JQ2 962 Insulin-degrading enzyme yes no 0.939 0.064 0.387 1e-09
O14077 969 Putative zinc protease mu yes no 0.939 0.063 0.432 5e-09
Q8CVS2 962 Protease 3 OS=Escherichia yes no 0.863 0.059 0.456 5e-07
>sp|O22941|PXM16_ARATH Zinc-metallopeptidase, peroxisomal OS=Arabidopsis thaliana GN=PXM16 PE=2 SV=1 Back     alignment and function desciption
 Score =  106 bits (264), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 58/71 (81%), Gaps = 5/71 (7%)

Query: 1  MAVGKDD-----VEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCD 55
          MAV K +     VEI+KPRTD R+YR +VLKN LQVLLISDPD DKCAASM+VSVG+F D
Sbjct: 1  MAVEKSNTTVGGVEILKPRTDNREYRMIVLKNLLQVLLISDPDTDKCAASMSVSVGSFSD 60

Query: 56 PVGLEGLAHFL 66
          P GLEGLAHFL
Sbjct: 61 PQGLEGLAHFL 71




Peptidase that might be involved in pathogen or wound response. Not required for peroxisome biogenesis, indole-3-butyric acid (IBA) metabolism, fatty acid beta-oxidation or degradation of glyoxylate cycle enzymes during seedling development.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|Q06010|STE23_YEAST A-factor-processing enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE23 PE=1 SV=2 Back     alignment and function description
>sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=Ide PE=1 SV=1 Back     alignment and function description
>sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=IDE PE=2 SV=1 Back     alignment and function description
>sp|P35559|IDE_RAT Insulin-degrading enzyme OS=Rattus norvegicus GN=Ide PE=1 SV=1 Back     alignment and function description
>sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens GN=IDE PE=1 SV=4 Back     alignment and function description
>sp|P22817|IDE_DROME Insulin-degrading enzyme OS=Drosophila melanogaster GN=Ide PE=1 SV=4 Back     alignment and function description
>sp|Q54JQ2|IDE_DICDI Insulin-degrading enzyme homolog OS=Dictyostelium discoideum GN=DDB_G0287851 PE=3 SV=1 Back     alignment and function description
>sp|O14077|MU138_SCHPO Putative zinc protease mug138 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug138 PE=1 SV=1 Back     alignment and function description
>sp|Q8CVS2|PTRA_ECOL6 Protease 3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ptrA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
356572034 964 PREDICTED: zinc-metallopeptidase, peroxi 1.0 0.068 0.803 2e-24
356504785 964 PREDICTED: zinc-metallopeptidase, peroxi 1.0 0.068 0.803 2e-24
255582581 967 Insulin-degrading enzyme, putative [Rici 1.0 0.068 0.787 2e-24
334186056 851 insulysin [Arabidopsis thaliana] gi|3326 1.0 0.077 0.726 5e-23
6706418 989 protease-like protein [Arabidopsis thali 1.0 0.066 0.726 5e-23
449437948 952 PREDICTED: LOW QUALITY PROTEIN: zinc-met 1.0 0.069 0.75 1e-22
449437946 929 PREDICTED: LOW QUALITY PROTEIN: zinc-met 1.0 0.071 0.75 1e-22
297820544 980 predicted protein [Arabidopsis lyrata su 0.878 0.059 0.844 3e-22
350535204 971 insulin degrading enzyme [Solanum lycope 1.0 0.067 0.728 3e-22
297820540 892 peptidase M16 family protein [Arabidopsi 0.878 0.065 0.827 7e-22
>gi|356572034|ref|XP_003554175.1| PREDICTED: zinc-metallopeptidase, peroxisomal-like [Glycine max] Back     alignment and taxonomy information
 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 58/66 (87%)

Query: 1  MAVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLE 60
          MAVGK+DVEI+K R DKR YRR+VL+NSLQVLLISDPD DKCAASM+V VG F DP GLE
Sbjct: 1  MAVGKEDVEIVKARIDKRDYRRVVLRNSLQVLLISDPDTDKCAASMDVGVGYFSDPAGLE 60

Query: 61 GLAHFL 66
          GLAHFL
Sbjct: 61 GLAHFL 66




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356504785|ref|XP_003521175.1| PREDICTED: zinc-metallopeptidase, peroxisomal-like [Glycine max] Back     alignment and taxonomy information
>gi|255582581|ref|XP_002532073.1| Insulin-degrading enzyme, putative [Ricinus communis] gi|223528255|gb|EEF30307.1| Insulin-degrading enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|334186056|ref|NP_567049.3| insulysin [Arabidopsis thaliana] gi|332646137|gb|AEE79658.1| insulysin [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6706418|emb|CAB66104.1| protease-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449437948|ref|XP_004136752.1| PREDICTED: LOW QUALITY PROTEIN: zinc-metallopeptidase, peroxisomal-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437946|ref|XP_004136751.1| PREDICTED: LOW QUALITY PROTEIN: zinc-metallopeptidase, peroxisomal-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297820544|ref|XP_002878155.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323993|gb|EFH54414.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|350535204|ref|NP_001233926.1| insulin degrading enzyme [Solanum lycopersicum] gi|15485612|emb|CAC67408.1| insulin degrading enzyme [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|297820540|ref|XP_002878153.1| peptidase M16 family protein [Arabidopsis lyrata subsp. lyrata] gi|297323991|gb|EFH54412.1| peptidase M16 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
TAIR|locus:2054346 970 AT2G41790 [Arabidopsis thalian 0.893 0.060 0.813 7.3e-20
SGD|S000004381 1027 STE23 "Metalloprotease involve 0.893 0.057 0.542 4.5e-11
TIGR_CMR|CPS_2134 968 CPS_2134 "zinc metallopeptidas 0.863 0.058 0.543 1.8e-10
UNIPROTKB|Q5T5N3 257 IDE "Insulin-degrading enzyme" 0.848 0.217 0.5 4.4e-10
MGI|MGI:96412 1019 Ide "insulin degrading enzyme" 0.969 0.062 0.453 6.7e-10
ASPGD|ASPL0000015933 1100 AN8044 [Emericella nidulans (t 0.833 0.05 0.545 7.4e-10
RGD|2861 1019 Ide "insulin degrading enzyme" 0.969 0.062 0.453 1.1e-09
UNIPROTKB|E1BW52 858 Gga.21599 "Uncharacterized pro 0.863 0.066 0.508 1.1e-09
UNIPROTKB|E1BTQ0 880 Gga.21599 "Uncharacterized pro 0.863 0.064 0.508 1.2e-09
UNIPROTKB|E1BW46 907 Gga.21599 "Uncharacterized pro 0.863 0.062 0.508 1.2e-09
TAIR|locus:2054346 AT2G41790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 7.3e-20, P = 7.3e-20
 Identities = 48/59 (81%), Positives = 53/59 (89%)

Query:     8 VEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL 66
             VEI+KPRTD R+YR +VLKN LQVLLISDPD DKCAASM+VSVG+F DP GLEGLAHFL
Sbjct:    13 VEILKPRTDNREYRMIVLKNLLQVLLISDPDTDKCAASMSVSVGSFSDPQGLEGLAHFL 71




GO:0003824 "catalytic activity" evidence=IEA
GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
SGD|S000004381 STE23 "Metalloprotease involved" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2134 CPS_2134 "zinc metallopeptidase, M16 family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T5N3 IDE "Insulin-degrading enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:96412 Ide "insulin degrading enzyme" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000015933 AN8044 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
RGD|2861 Ide "insulin degrading enzyme" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW52 Gga.21599 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTQ0 Gga.21599 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW46 Gga.21599 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
Al_scaffold_0005_2665
annotation not avaliable (980 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
COG1025 937 COG1025, Ptr, Secreted/periplasmic Zn-dependent pe 7e-19
PRK15101 961 PRK15101, PRK15101, protease3; Provisional 6e-12
TIGR02110 696 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis 1e-09
pfam00675 149 pfam00675, Peptidase_M16, Insulinase (Peptidase fa 1e-04
COG0612 438 COG0612, PqqL, Predicted Zn-dependent peptidases [ 1e-04
>gnl|CDD|223956 COG1025, Ptr, Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score = 77.8 bits (192), Expect = 7e-19
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 10 IIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL 66
          I KP  D R+YR + L N L+ LL+SDP ADK +A++ V VG+F DP    GLAHFL
Sbjct: 14 IHKPALDDRKYRAIKLPNGLRALLVSDPQADKSSAALVVPVGSFDDPEEYPGLAHFL 70


Length = 937

>gnl|CDD|185056 PRK15101, PRK15101, protease3; Provisional Back     alignment and domain information
>gnl|CDD|233732 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis probable peptidase PqqF Back     alignment and domain information
>gnl|CDD|216056 pfam00675, Peptidase_M16, Insulinase (Peptidase family M16) Back     alignment and domain information
>gnl|CDD|223685 COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 66
PRK15101 961 protease3; Provisional 99.61
COG1025 937 Ptr Secreted/periplasmic Zn-dependent peptidases, 99.59
KOG0959 974 consensus N-arginine dibasic convertase NRD1 and r 99.59
TIGR02110 696 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable pe 99.3
COG0612 438 PqqL Predicted Zn-dependent peptidases [General fu 99.13
KOG0960 467 consensus Mitochondrial processing peptidase, beta 98.87
PF00675 149 Peptidase_M16: Insulinase (Peptidase family M16) T 98.73
KOG2067 472 consensus Mitochondrial processing peptidase, alph 98.61
KOG2583 429 consensus Ubiquinol cytochrome c reductase, subuni 98.44
PTZ00432 1119 falcilysin; Provisional 97.21
PRK15101 961 protease3; Provisional 96.59
PF03410 590 Peptidase_M44: Protein G1; InterPro: IPR005072 In 85.91
>PRK15101 protease3; Provisional Back     alignment and domain information
Probab=99.61  E-value=7.2e-16  Score=113.73  Aligned_cols=60  Identities=43%  Similarity=0.695  Sum_probs=57.2

Q ss_pred             CcceeecCCCccceEEEEccCCCEEEEEEcCCCCeEEEEEEEcccCCCCCCCCCcceeeC
Q 037967            7 DVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL   66 (66)
Q Consensus         7 ~~~~~k~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~~~v~~Gs~~ep~~~~GlAHfl   66 (66)
                      ...+.|+..|.+.|++.+|+|||+|++++++..+.+++++++++||++||++++||||||
T Consensus        31 ~~~~~k~~~d~~~~~~~~L~NGL~v~l~~~~~~~~~~~~l~v~~Gs~~ep~~~~GlAHfl   90 (961)
T PRK15101         31 QETIRKSEKDPRQYQAIRLDNGMTVLLVSDPQAVKSLAALALPVGSLEDPDAQQGLAHYL   90 (961)
T ss_pred             cccCcCCCCCccceEEEEeCCCCEEEEEeCCCCcceeEEEEeCcCCCCCCCCCCchHHHH
Confidence            345899999999999999999999999999999999999999999999999999999996



>COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0959 consensus N-arginine dibasic convertase NRD1 and related Zn2+-dependent endopeptidases, insulinase superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable peptidase PqqF Back     alignment and domain information
>COG0612 PqqL Predicted Zn-dependent peptidases [General function prediction only] Back     alignment and domain information
>KOG0960 consensus Mitochondrial processing peptidase, beta subunit, and related enzymes (insulinase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00675 Peptidase_M16: Insulinase (Peptidase family M16) This is family M16 in the peptidase classification Back     alignment and domain information
>KOG2067 consensus Mitochondrial processing peptidase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2583 consensus Ubiquinol cytochrome c reductase, subunit QCR2 [Energy production and conversion] Back     alignment and domain information
>PTZ00432 falcilysin; Provisional Back     alignment and domain information
>PRK15101 protease3; Provisional Back     alignment and domain information
>PF03410 Peptidase_M44: Protein G1; InterPro: IPR005072 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
3tuv_A 1019 Crystal Structure Of Insulysin With Bound Atp Lengt 5e-12
3p7o_A 1019 Rat Insulin Degrading Enzyme (Insulysin) E111f Muta 5e-12
3p7l_A 978 Rat Insulin Degrading Enzyme (Insulysin) Length = 9 5e-12
3qz2_A 990 The Structure Of Cysteine-Free Human Insulin Degrad 7e-12
3hgz_A 969 Crystal Structure Of Human Insulin-Degrading Enzyme 7e-12
3e4z_A 990 Crystal Structure Of Human Insulin Degrading Enzyme 7e-12
3e4a_A 1019 Human Ide-Inhibitor Complex At 2.6 Angstrom Resolut 7e-12
2wby_A 990 Crystal Structure Of Human Insulin-Degrading Enzyme 7e-12
3cww_A 990 Crystal Structure Of Ide-Bradykinin Complex Length 7e-12
2jg4_A 990 Substrate-Free Ide Structure In Its Closed Conforma 2e-11
2g47_A 990 Crystal Structure Of Human Insulin-Degrading Enzyme 2e-11
1q2l_A 939 Crystal Structure Of Pitrilysin Length = 939 4e-08
>pdb|3TUV|A Chain A, Crystal Structure Of Insulysin With Bound Atp Length = 1019 Back     alignment and structure

Iteration: 1

Score = 65.9 bits (159), Expect = 5e-12, Method: Composition-based stats. Identities = 29/64 (45%), Positives = 44/64 (68%) Query: 2 AVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEG 61 A+ + + I+K DKR+YR L L N ++VLLISDP DK +A+++V +G+ DP + G Sbjct: 46 AIQRIEDHIVKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIPG 105 Query: 62 LAHF 65 L+HF Sbjct: 106 LSHF 109
>pdb|3P7O|A Chain A, Rat Insulin Degrading Enzyme (Insulysin) E111f Mutant With Two Bound Peptides Length = 1019 Back     alignment and structure
>pdb|3P7L|A Chain A, Rat Insulin Degrading Enzyme (Insulysin) Length = 978 Back     alignment and structure
>pdb|3QZ2|A Chain A, The Structure Of Cysteine-Free Human Insulin Degrading Enzyme Length = 990 Back     alignment and structure
>pdb|3HGZ|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amylin Length = 969 Back     alignment and structure
>pdb|3E4Z|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme In Complex With Insulin-Like Growth Factor Ii Length = 990 Back     alignment and structure
>pdb|3E4A|A Chain A, Human Ide-Inhibitor Complex At 2.6 Angstrom Resolution Length = 1019 Back     alignment and structure
>pdb|2WBY|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Insulin Length = 990 Back     alignment and structure
>pdb|3CWW|A Chain A, Crystal Structure Of Ide-Bradykinin Complex Length = 990 Back     alignment and structure
>pdb|2JG4|A Chain A, Substrate-Free Ide Structure In Its Closed Conformation Length = 990 Back     alignment and structure
>pdb|2G47|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amyloid-Beta (1-40) Length = 990 Back     alignment and structure
>pdb|1Q2L|A Chain A, Crystal Structure Of Pitrilysin Length = 939 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 3e-26
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 2e-25
3amj_B 424 Zinc peptidase inactive subunit; alpha/beta, zinc 5e-06
3ami_A 445 Zinc peptidase; alpha/beta, zinc binding, hydrolas 8e-06
3eoq_A 406 Putative zinc protease; two similar domains of bet 4e-05
3go9_A 492 Insulinase family protease; IDP00573, structural g 1e-04
3hdi_A 421 Processing protease; CAGE structure, M16B peptidas 3e-04
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Length = 990 Back     alignment and structure
 Score = 98.4 bits (244), Expect = 3e-26
 Identities = 30/65 (46%), Positives = 43/65 (66%)

Query: 2  AVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEG 61
          A+ +    I K   DKR+YR L L N ++VLLISDP  DK +A+++V +G+  DP  + G
Sbjct: 17 AIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAG 76

Query: 62 LAHFL 66
          L+HFL
Sbjct: 77 LSHFL 81


>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 939 Back     alignment and structure
>3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Length = 424 Back     alignment and structure
>3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Length = 445 Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Length = 406 Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} Length = 492 Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 99.56
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 99.54
3eoq_A 406 Putative zinc protease; two similar domains of bet 99.35
3hdi_A 421 Processing protease; CAGE structure, M16B peptidas 99.31
3go9_A 492 Insulinase family protease; IDP00573, structural g 99.24
3ami_A 445 Zinc peptidase; alpha/beta, zinc binding, hydrolas 99.22
1hr6_A 475 Alpha-MPP, mitochondrial processing peptidase alph 99.16
3amj_B 424 Zinc peptidase inactive subunit; alpha/beta, zinc 99.11
1pp9_A 446 Ubiquinol-cytochrome C reductase complex core Pro 99.1
1hr6_B 443 Beta-MPP, mitochondrial processing peptidase beta 99.1
3gwb_A 434 Peptidase M16 inactive domain family protein; pept 99.05
3cx5_A 431 Cytochrome B-C1 complex subunit 1, mitochondrial; 99.02
1pp9_B 439 Ubiquinol-cytochrome C reductase complex core Pro 99.01
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family) 98.75
3d3y_A 425 Uncharacterized protein; APC29635, conserved prote 98.4
3s5m_A 1193 Falcilysin; M16 metalloprotease, peptidase, hydrol 98.26
3cx5_B 352 Cytochrome B-C1 complex subunit 2, mitochondrial; 97.51
1q2l_A 939 Protease III; hydrolase; 2.20A {Escherichia coli s 94.81
2fge_A 995 Atprep2;, zinc metalloprotease (insulinase family) 94.29
3cww_A 990 Insulysin, insulin-degrading enzyme, insulinase; A 88.19
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
Probab=99.56  E-value=1.9e-15  Score=108.78  Aligned_cols=60  Identities=43%  Similarity=0.696  Sum_probs=57.1

Q ss_pred             CcceeecCCCccceEEEEccCCCEEEEEEcCCCCeEEEEEEEcccCCCCCCCCCcceeeC
Q 037967            7 DVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL   66 (66)
Q Consensus         7 ~~~~~k~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~~~v~~Gs~~ep~~~~GlAHfl   66 (66)
                      .+.++||+.|.+.|+..+|+|||+|++++++..+.+++++++++||++||++.+|+||||
T Consensus         8 ~~~~~~~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~l~v~~Gs~~e~~~~~GlAH~l   67 (939)
T 1q2l_A            8 QETIRKSDKDNRQYQAIRLDNGMVVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHYL   67 (939)
T ss_dssp             CSCCCCCTTCCCEEEEEEETTSCEEEEEECTTCSSEEEEEEESCCGGGCCGGGTTHHHHH
T ss_pred             cccCcCCCCCCcceEEEEecCCCEEEEEECCCCCceEEEEEeCccCCCCCCCCCchHHHH
Confidence            456899999999999999999999999999999999999999999999999999999985



>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Back     alignment and structure
>3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Back     alignment and structure
>3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Back     alignment and structure
>3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} Back     alignment and structure
>3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Back     alignment and structure
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* Back     alignment and structure
>3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Back     alignment and structure
>1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... Back     alignment and structure
>1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* Back     alignment and structure
>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2, structure initiative; 1.90A {Pseudomonas fluorescens} Back     alignment and structure
>3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* Back     alignment and structure
>1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3d3y_A Uncharacterized protein; APC29635, conserved protein, enterococcus faecalis V583, STR genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis} Back     alignment and structure
>3s5m_A Falcilysin; M16 metalloprotease, peptidase, hydrolase; 1.55A {Plasmodium falciparum} PDB: 3s5i_A 3s5k_A 3s5h_A Back     alignment and structure
>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Back     alignment and structure
>1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Back     alignment and structure
>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 66
d1q2la4 240 d.185.1.1 (A:24-263) Protease III {Escherichia col 2e-15
d1hr6b1 222 d.185.1.1 (B:24-245) Mitochondrial processing pept 9e-11
d3cx5a1 213 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 2e-08
d1hr6a1 220 d.185.1.1 (A:14-233) Mitochondrial processing pept 4e-08
d1ppja1 232 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 2e-06
d1ppjb1 219 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 2e-06
d3cx5b1 202 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 1e-04
d2fgea4 257 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 6e-04
d3lkfa_ 299 f.6.1.1 (A:) Leukocidin F (HlgB) {Staphylococcus a 0.003
>d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: LuxS/MPP-like metallohydrolase
superfamily: LuxS/MPP-like metallohydrolase
family: MPP-like
domain: Protease III
species: Escherichia coli [TaxId: 562]
 Score = 65.2 bits (157), Expect = 2e-15
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 10 IIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHF 65
          I K   D RQY+ + L N + VLL+SDP A K  +++ V VG+  DP   +GLAH+
Sbjct: 11 IRKSDKDNRQYQAIRLDNGMVVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHY 66


>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 220 Back     information, alignment and structure
>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 219 Back     information, alignment and structure
>d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 202 Back     information, alignment and structure
>d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
d1q2la4 240 Protease III {Escherichia coli [TaxId: 562]} 99.65
d3cx5a1 213 Cytochrome bc1 core subunit 1 {Baker's yeast (Sacc 99.42
d1hr6b1 222 Mitochondrial processing peptidase (MPP) beta chai 99.41
d1ppjb1 219 Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [T 99.33
d1ppja1 232 Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [T 99.28
d1hr6a1 220 Mitochondrial processing peptidase (MPP) alpha cha 99.21
d2fgea4 257 Presequence protease 1, PREP1 {Thale cress (Arabid 98.32
d3cx5b1 202 Cytochrome bc1 core subunit 2 {Baker's yeast (Sacc 98.12
d1q2la1 229 Protease III {Escherichia coli [TaxId: 562]} 97.95
>d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: LuxS/MPP-like metallohydrolase
superfamily: LuxS/MPP-like metallohydrolase
family: MPP-like
domain: Protease III
species: Escherichia coli [TaxId: 562]
Probab=99.65  E-value=5.5e-17  Score=100.79  Aligned_cols=60  Identities=43%  Similarity=0.696  Sum_probs=56.5

Q ss_pred             CcceeecCCCccceEEEEccCCCEEEEEEcCCCCeEEEEEEEcccCCCCCCCCCcceeeC
Q 037967            7 DVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL   66 (66)
Q Consensus         7 ~~~~~k~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~~~v~~Gs~~ep~~~~GlAHfl   66 (66)
                      ...+.|+..|.++|+.++|+|||+|++++++..+.+++++++++||++||++..|+|||+
T Consensus         8 ~~~~~k~~~d~~~~~~~~L~NGl~V~~~~~~~~~~v~~~l~~~~Gs~~e~~~~~Gla~ll   67 (240)
T d1q2la4           8 QETIRKSDKDNRQYQAIRLDNGMVVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHYL   67 (240)
T ss_dssp             CSCCCCCTTCCCEEEEEEETTSCEEEEEECTTCSSEEEEEEESCCGGGCCGGGTTHHHHH
T ss_pred             cccCCCCCCCCcceEEEEcCCCCEEEEEECCCCCEEEEEEEEeCCccccccchHHHHHHH
Confidence            356789999999999999999999999999999999999999999999999999999985



>d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q2la1 d.185.1.1 (A:504-732) Protease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure