Citrus Sinensis ID: 037967
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| 356572034 | 964 | PREDICTED: zinc-metallopeptidase, peroxi | 1.0 | 0.068 | 0.803 | 2e-24 | |
| 356504785 | 964 | PREDICTED: zinc-metallopeptidase, peroxi | 1.0 | 0.068 | 0.803 | 2e-24 | |
| 255582581 | 967 | Insulin-degrading enzyme, putative [Rici | 1.0 | 0.068 | 0.787 | 2e-24 | |
| 334186056 | 851 | insulysin [Arabidopsis thaliana] gi|3326 | 1.0 | 0.077 | 0.726 | 5e-23 | |
| 6706418 | 989 | protease-like protein [Arabidopsis thali | 1.0 | 0.066 | 0.726 | 5e-23 | |
| 449437948 | 952 | PREDICTED: LOW QUALITY PROTEIN: zinc-met | 1.0 | 0.069 | 0.75 | 1e-22 | |
| 449437946 | 929 | PREDICTED: LOW QUALITY PROTEIN: zinc-met | 1.0 | 0.071 | 0.75 | 1e-22 | |
| 297820544 | 980 | predicted protein [Arabidopsis lyrata su | 0.878 | 0.059 | 0.844 | 3e-22 | |
| 350535204 | 971 | insulin degrading enzyme [Solanum lycope | 1.0 | 0.067 | 0.728 | 3e-22 | |
| 297820540 | 892 | peptidase M16 family protein [Arabidopsi | 0.878 | 0.065 | 0.827 | 7e-22 |
| >gi|356572034|ref|XP_003554175.1| PREDICTED: zinc-metallopeptidase, peroxisomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 116 bits (290), Expect = 2e-24, Method: Composition-based stats.
Identities = 53/66 (80%), Positives = 58/66 (87%)
Query: 1 MAVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLE 60
MAVGK+DVEI+K R DKR YRR+VL+NSLQVLLISDPD DKCAASM+V VG F DP GLE
Sbjct: 1 MAVGKEDVEIVKARIDKRDYRRVVLRNSLQVLLISDPDTDKCAASMDVGVGYFSDPAGLE 60
Query: 61 GLAHFL 66
GLAHFL
Sbjct: 61 GLAHFL 66
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356504785|ref|XP_003521175.1| PREDICTED: zinc-metallopeptidase, peroxisomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255582581|ref|XP_002532073.1| Insulin-degrading enzyme, putative [Ricinus communis] gi|223528255|gb|EEF30307.1| Insulin-degrading enzyme, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|334186056|ref|NP_567049.3| insulysin [Arabidopsis thaliana] gi|332646137|gb|AEE79658.1| insulysin [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|6706418|emb|CAB66104.1| protease-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449437948|ref|XP_004136752.1| PREDICTED: LOW QUALITY PROTEIN: zinc-metallopeptidase, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449437946|ref|XP_004136751.1| PREDICTED: LOW QUALITY PROTEIN: zinc-metallopeptidase, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297820544|ref|XP_002878155.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323993|gb|EFH54414.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|350535204|ref|NP_001233926.1| insulin degrading enzyme [Solanum lycopersicum] gi|15485612|emb|CAC67408.1| insulin degrading enzyme [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|297820540|ref|XP_002878153.1| peptidase M16 family protein [Arabidopsis lyrata subsp. lyrata] gi|297323991|gb|EFH54412.1| peptidase M16 family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| TAIR|locus:2054346 | 970 | AT2G41790 [Arabidopsis thalian | 0.893 | 0.060 | 0.813 | 7.3e-20 | |
| SGD|S000004381 | 1027 | STE23 "Metalloprotease involve | 0.893 | 0.057 | 0.542 | 4.5e-11 | |
| TIGR_CMR|CPS_2134 | 968 | CPS_2134 "zinc metallopeptidas | 0.863 | 0.058 | 0.543 | 1.8e-10 | |
| UNIPROTKB|Q5T5N3 | 257 | IDE "Insulin-degrading enzyme" | 0.848 | 0.217 | 0.5 | 4.4e-10 | |
| MGI|MGI:96412 | 1019 | Ide "insulin degrading enzyme" | 0.969 | 0.062 | 0.453 | 6.7e-10 | |
| ASPGD|ASPL0000015933 | 1100 | AN8044 [Emericella nidulans (t | 0.833 | 0.05 | 0.545 | 7.4e-10 | |
| RGD|2861 | 1019 | Ide "insulin degrading enzyme" | 0.969 | 0.062 | 0.453 | 1.1e-09 | |
| UNIPROTKB|E1BW52 | 858 | Gga.21599 "Uncharacterized pro | 0.863 | 0.066 | 0.508 | 1.1e-09 | |
| UNIPROTKB|E1BTQ0 | 880 | Gga.21599 "Uncharacterized pro | 0.863 | 0.064 | 0.508 | 1.2e-09 | |
| UNIPROTKB|E1BW46 | 907 | Gga.21599 "Uncharacterized pro | 0.863 | 0.062 | 0.508 | 1.2e-09 |
| TAIR|locus:2054346 AT2G41790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 7.3e-20, P = 7.3e-20
Identities = 48/59 (81%), Positives = 53/59 (89%)
Query: 8 VEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL 66
VEI+KPRTD R+YR +VLKN LQVLLISDPD DKCAASM+VSVG+F DP GLEGLAHFL
Sbjct: 13 VEILKPRTDNREYRMIVLKNLLQVLLISDPDTDKCAASMSVSVGSFSDPQGLEGLAHFL 71
|
|
| SGD|S000004381 STE23 "Metalloprotease involved" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2134 CPS_2134 "zinc metallopeptidase, M16 family" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T5N3 IDE "Insulin-degrading enzyme" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96412 Ide "insulin degrading enzyme" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000015933 AN8044 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| RGD|2861 Ide "insulin degrading enzyme" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BW52 Gga.21599 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BTQ0 Gga.21599 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BW46 Gga.21599 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| Al_scaffold_0005_2665 | annotation not avaliable (980 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| COG1025 | 937 | COG1025, Ptr, Secreted/periplasmic Zn-dependent pe | 7e-19 | |
| PRK15101 | 961 | PRK15101, PRK15101, protease3; Provisional | 6e-12 | |
| TIGR02110 | 696 | TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis | 1e-09 | |
| pfam00675 | 149 | pfam00675, Peptidase_M16, Insulinase (Peptidase fa | 1e-04 | |
| COG0612 | 438 | COG0612, PqqL, Predicted Zn-dependent peptidases [ | 1e-04 |
| >gnl|CDD|223956 COG1025, Ptr, Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 77.8 bits (192), Expect = 7e-19
Identities = 31/57 (54%), Positives = 39/57 (68%)
Query: 10 IIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL 66
I KP D R+YR + L N L+ LL+SDP ADK +A++ V VG+F DP GLAHFL
Sbjct: 14 IHKPALDDRKYRAIKLPNGLRALLVSDPQADKSSAALVVPVGSFDDPEEYPGLAHFL 70
|
Length = 937 |
| >gnl|CDD|185056 PRK15101, PRK15101, protease3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233732 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis probable peptidase PqqF | Back alignment and domain information |
|---|
| >gnl|CDD|216056 pfam00675, Peptidase_M16, Insulinase (Peptidase family M16) | Back alignment and domain information |
|---|
| >gnl|CDD|223685 COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| PRK15101 | 961 | protease3; Provisional | 99.61 | |
| COG1025 | 937 | Ptr Secreted/periplasmic Zn-dependent peptidases, | 99.59 | |
| KOG0959 | 974 | consensus N-arginine dibasic convertase NRD1 and r | 99.59 | |
| TIGR02110 | 696 | PQQ_syn_pqqF coenzyme PQQ biosynthesis probable pe | 99.3 | |
| COG0612 | 438 | PqqL Predicted Zn-dependent peptidases [General fu | 99.13 | |
| KOG0960 | 467 | consensus Mitochondrial processing peptidase, beta | 98.87 | |
| PF00675 | 149 | Peptidase_M16: Insulinase (Peptidase family M16) T | 98.73 | |
| KOG2067 | 472 | consensus Mitochondrial processing peptidase, alph | 98.61 | |
| KOG2583 | 429 | consensus Ubiquinol cytochrome c reductase, subuni | 98.44 | |
| PTZ00432 | 1119 | falcilysin; Provisional | 97.21 | |
| PRK15101 | 961 | protease3; Provisional | 96.59 | |
| PF03410 | 590 | Peptidase_M44: Protein G1; InterPro: IPR005072 In | 85.91 |
| >PRK15101 protease3; Provisional | Back alignment and domain information |
|---|
Probab=99.61 E-value=7.2e-16 Score=113.73 Aligned_cols=60 Identities=43% Similarity=0.695 Sum_probs=57.2
Q ss_pred CcceeecCCCccceEEEEccCCCEEEEEEcCCCCeEEEEEEEcccCCCCCCCCCcceeeC
Q 037967 7 DVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL 66 (66)
Q Consensus 7 ~~~~~k~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~~~v~~Gs~~ep~~~~GlAHfl 66 (66)
...+.|+..|.+.|++.+|+|||+|++++++..+.+++++++++||++||++++||||||
T Consensus 31 ~~~~~k~~~d~~~~~~~~L~NGL~v~l~~~~~~~~~~~~l~v~~Gs~~ep~~~~GlAHfl 90 (961)
T PRK15101 31 QETIRKSEKDPRQYQAIRLDNGMTVLLVSDPQAVKSLAALALPVGSLEDPDAQQGLAHYL 90 (961)
T ss_pred cccCcCCCCCccceEEEEeCCCCEEEEEeCCCCcceeEEEEeCcCCCCCCCCCCchHHHH
Confidence 345899999999999999999999999999999999999999999999999999999996
|
|
| >COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0959 consensus N-arginine dibasic convertase NRD1 and related Zn2+-dependent endopeptidases, insulinase superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis probable peptidase PqqF | Back alignment and domain information |
|---|
| >COG0612 PqqL Predicted Zn-dependent peptidases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0960 consensus Mitochondrial processing peptidase, beta subunit, and related enzymes (insulinase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00675 Peptidase_M16: Insulinase (Peptidase family M16) This is family M16 in the peptidase classification | Back alignment and domain information |
|---|
| >KOG2067 consensus Mitochondrial processing peptidase, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2583 consensus Ubiquinol cytochrome c reductase, subunit QCR2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00432 falcilysin; Provisional | Back alignment and domain information |
|---|
| >PRK15101 protease3; Provisional | Back alignment and domain information |
|---|
| >PF03410 Peptidase_M44: Protein G1; InterPro: IPR005072 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 66 | ||||
| 3tuv_A | 1019 | Crystal Structure Of Insulysin With Bound Atp Lengt | 5e-12 | ||
| 3p7o_A | 1019 | Rat Insulin Degrading Enzyme (Insulysin) E111f Muta | 5e-12 | ||
| 3p7l_A | 978 | Rat Insulin Degrading Enzyme (Insulysin) Length = 9 | 5e-12 | ||
| 3qz2_A | 990 | The Structure Of Cysteine-Free Human Insulin Degrad | 7e-12 | ||
| 3hgz_A | 969 | Crystal Structure Of Human Insulin-Degrading Enzyme | 7e-12 | ||
| 3e4z_A | 990 | Crystal Structure Of Human Insulin Degrading Enzyme | 7e-12 | ||
| 3e4a_A | 1019 | Human Ide-Inhibitor Complex At 2.6 Angstrom Resolut | 7e-12 | ||
| 2wby_A | 990 | Crystal Structure Of Human Insulin-Degrading Enzyme | 7e-12 | ||
| 3cww_A | 990 | Crystal Structure Of Ide-Bradykinin Complex Length | 7e-12 | ||
| 2jg4_A | 990 | Substrate-Free Ide Structure In Its Closed Conforma | 2e-11 | ||
| 2g47_A | 990 | Crystal Structure Of Human Insulin-Degrading Enzyme | 2e-11 | ||
| 1q2l_A | 939 | Crystal Structure Of Pitrilysin Length = 939 | 4e-08 |
| >pdb|3TUV|A Chain A, Crystal Structure Of Insulysin With Bound Atp Length = 1019 | Back alignment and structure |
|
| >pdb|3P7O|A Chain A, Rat Insulin Degrading Enzyme (Insulysin) E111f Mutant With Two Bound Peptides Length = 1019 | Back alignment and structure |
| >pdb|3P7L|A Chain A, Rat Insulin Degrading Enzyme (Insulysin) Length = 978 | Back alignment and structure |
| >pdb|3QZ2|A Chain A, The Structure Of Cysteine-Free Human Insulin Degrading Enzyme Length = 990 | Back alignment and structure |
| >pdb|3HGZ|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amylin Length = 969 | Back alignment and structure |
| >pdb|3E4Z|A Chain A, Crystal Structure Of Human Insulin Degrading Enzyme In Complex With Insulin-Like Growth Factor Ii Length = 990 | Back alignment and structure |
| >pdb|3E4A|A Chain A, Human Ide-Inhibitor Complex At 2.6 Angstrom Resolution Length = 1019 | Back alignment and structure |
| >pdb|2WBY|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Insulin Length = 990 | Back alignment and structure |
| >pdb|3CWW|A Chain A, Crystal Structure Of Ide-Bradykinin Complex Length = 990 | Back alignment and structure |
| >pdb|2JG4|A Chain A, Substrate-Free Ide Structure In Its Closed Conformation Length = 990 | Back alignment and structure |
| >pdb|2G47|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amyloid-Beta (1-40) Length = 990 | Back alignment and structure |
| >pdb|1Q2L|A Chain A, Crystal Structure Of Pitrilysin Length = 939 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| 3cww_A | 990 | Insulysin, insulin-degrading enzyme, insulinase; A | 3e-26 | |
| 1q2l_A | 939 | Protease III; hydrolase; 2.20A {Escherichia coli s | 2e-25 | |
| 3amj_B | 424 | Zinc peptidase inactive subunit; alpha/beta, zinc | 5e-06 | |
| 3ami_A | 445 | Zinc peptidase; alpha/beta, zinc binding, hydrolas | 8e-06 | |
| 3eoq_A | 406 | Putative zinc protease; two similar domains of bet | 4e-05 | |
| 3go9_A | 492 | Insulinase family protease; IDP00573, structural g | 1e-04 | |
| 3hdi_A | 421 | Processing protease; CAGE structure, M16B peptidas | 3e-04 |
| >3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... Length = 990 | Back alignment and structure |
|---|
Score = 98.4 bits (244), Expect = 3e-26
Identities = 30/65 (46%), Positives = 43/65 (66%)
Query: 2 AVGKDDVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEG 61
A+ + I K DKR+YR L L N ++VLLISDP DK +A+++V +G+ DP + G
Sbjct: 17 AIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAG 76
Query: 62 LAHFL 66
L+HFL
Sbjct: 77 LSHFL 81
|
| >1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 Length = 939 | Back alignment and structure |
|---|
| >3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} Length = 424 | Back alignment and structure |
|---|
| >3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C Length = 445 | Back alignment and structure |
|---|
| >3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} Length = 406 | Back alignment and structure |
|---|
| >3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} Length = 492 | Back alignment and structure |
|---|
| >3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} Length = 421 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| 1q2l_A | 939 | Protease III; hydrolase; 2.20A {Escherichia coli s | 99.56 | |
| 3cww_A | 990 | Insulysin, insulin-degrading enzyme, insulinase; A | 99.54 | |
| 3eoq_A | 406 | Putative zinc protease; two similar domains of bet | 99.35 | |
| 3hdi_A | 421 | Processing protease; CAGE structure, M16B peptidas | 99.31 | |
| 3go9_A | 492 | Insulinase family protease; IDP00573, structural g | 99.24 | |
| 3ami_A | 445 | Zinc peptidase; alpha/beta, zinc binding, hydrolas | 99.22 | |
| 1hr6_A | 475 | Alpha-MPP, mitochondrial processing peptidase alph | 99.16 | |
| 3amj_B | 424 | Zinc peptidase inactive subunit; alpha/beta, zinc | 99.11 | |
| 1pp9_A | 446 | Ubiquinol-cytochrome C reductase complex core Pro | 99.1 | |
| 1hr6_B | 443 | Beta-MPP, mitochondrial processing peptidase beta | 99.1 | |
| 3gwb_A | 434 | Peptidase M16 inactive domain family protein; pept | 99.05 | |
| 3cx5_A | 431 | Cytochrome B-C1 complex subunit 1, mitochondrial; | 99.02 | |
| 1pp9_B | 439 | Ubiquinol-cytochrome C reductase complex core Pro | 99.01 | |
| 2fge_A | 995 | Atprep2;, zinc metalloprotease (insulinase family) | 98.75 | |
| 3d3y_A | 425 | Uncharacterized protein; APC29635, conserved prote | 98.4 | |
| 3s5m_A | 1193 | Falcilysin; M16 metalloprotease, peptidase, hydrol | 98.26 | |
| 3cx5_B | 352 | Cytochrome B-C1 complex subunit 2, mitochondrial; | 97.51 | |
| 1q2l_A | 939 | Protease III; hydrolase; 2.20A {Escherichia coli s | 94.81 | |
| 2fge_A | 995 | Atprep2;, zinc metalloprotease (insulinase family) | 94.29 | |
| 3cww_A | 990 | Insulysin, insulin-degrading enzyme, insulinase; A | 88.19 |
| >1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 | Back alignment and structure |
|---|
Probab=99.56 E-value=1.9e-15 Score=108.78 Aligned_cols=60 Identities=43% Similarity=0.696 Sum_probs=57.1
Q ss_pred CcceeecCCCccceEEEEccCCCEEEEEEcCCCCeEEEEEEEcccCCCCCCCCCcceeeC
Q 037967 7 DVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL 66 (66)
Q Consensus 7 ~~~~~k~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~~~v~~Gs~~ep~~~~GlAHfl 66 (66)
.+.++||+.|.+.|+..+|+|||+|++++++..+.+++++++++||++||++.+|+||||
T Consensus 8 ~~~~~~~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~l~v~~Gs~~e~~~~~GlAH~l 67 (939)
T 1q2l_A 8 QETIRKSDKDNRQYQAIRLDNGMVVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHYL 67 (939)
T ss_dssp CSCCCCCTTCCCEEEEEEETTSCEEEEEECTTCSSEEEEEEESCCGGGCCGGGTTHHHHH
T ss_pred cccCcCCCCCCcceEEEEecCCCEEEEEECCCCCceEEEEEeCccCCCCCCCCCchHHHH
Confidence 456899999999999999999999999999999999999999999999999999999985
|
| >3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... | Back alignment and structure |
|---|
| >3eoq_A Putative zinc protease; two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)- beta structure, hydrolase; 2.29A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hdi_A Processing protease; CAGE structure, M16B peptidase, metallopeptidase, peptidasome, protease, hydrolase; 2.70A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3go9_A Insulinase family protease; IDP00573, structural genomics, for structural genomics of infectious diseases, csgid, HYDR; HET: MSE; 1.62A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ami_A Zinc peptidase; alpha/beta, zinc binding, hydrolase; 2.40A {Sphingomonas} PDB: 3amj_C | Back alignment and structure |
|---|
| >1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A* | Back alignment and structure |
|---|
| >3amj_B Zinc peptidase inactive subunit; alpha/beta, zinc binding, hydrolase; 3.00A {Sphingomonas} | Back alignment and structure |
|---|
| >1pp9_A Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_A* 1be3_A* 1l0n_A* 1ntk_A* 1ntm_A* 1ntz_A* 1nu1_A* 1l0l_A* 1ppj_A* 1sqq_A* 1sqv_A* 1sqx_A* 2a06_A* 2fyu_A* 2ybb_A* 1sqb_A* 1sqp_A* 1qcr_A* 1bcc_A* 2bcc_A* ... | Back alignment and structure |
|---|
| >1hr6_B Beta-MPP, mitochondrial processing peptidase beta subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_B 1hr8_B* 1hr9_B* | Back alignment and structure |
|---|
| >3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2, structure initiative; 1.90A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3cx5_A Cytochrome B-C1 complex subunit 1, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1p84_A* 2ibz_A* 1kb9_A* 3cxh_A* 1ezv_A* 1kyo_A* | Back alignment and structure |
|---|
| >1pp9_B Ubiquinol-cytochrome C reductase complex core Pro mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 2ybb_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* ... | Back alignment and structure |
|---|
| >2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 | Back alignment and structure |
|---|
| >3d3y_A Uncharacterized protein; APC29635, conserved protein, enterococcus faecalis V583, STR genomics, PSI-2, protein structure initiative; 1.95A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3s5m_A Falcilysin; M16 metalloprotease, peptidase, hydrolase; 1.55A {Plasmodium falciparum} PDB: 3s5i_A 3s5k_A 3s5h_A | Back alignment and structure |
|---|
| >3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* | Back alignment and structure |
|---|
| >1q2l_A Protease III; hydrolase; 2.20A {Escherichia coli str} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 | Back alignment and structure |
|---|
| >2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1 | Back alignment and structure |
|---|
| >3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 3ofi_A 2wc0_A 3h44_A 3n56_A 3n57_A 2wby_A 3qz2_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A 2yb3_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 66 | ||||
| d1q2la4 | 240 | d.185.1.1 (A:24-263) Protease III {Escherichia col | 2e-15 | |
| d1hr6b1 | 222 | d.185.1.1 (B:24-245) Mitochondrial processing pept | 9e-11 | |
| d3cx5a1 | 213 | d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 | 2e-08 | |
| d1hr6a1 | 220 | d.185.1.1 (A:14-233) Mitochondrial processing pept | 4e-08 | |
| d1ppja1 | 232 | d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 | 2e-06 | |
| d1ppjb1 | 219 | d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 | 2e-06 | |
| d3cx5b1 | 202 | d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 | 1e-04 | |
| d2fgea4 | 257 | d.185.1.1 (A:15-271) Presequence protease 1, PREP1 | 6e-04 | |
| d3lkfa_ | 299 | f.6.1.1 (A:) Leukocidin F (HlgB) {Staphylococcus a | 0.003 |
| >d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LuxS/MPP-like metallohydrolase superfamily: LuxS/MPP-like metallohydrolase family: MPP-like domain: Protease III species: Escherichia coli [TaxId: 562]
Score = 65.2 bits (157), Expect = 2e-15
Identities = 25/56 (44%), Positives = 35/56 (62%)
Query: 10 IIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHF 65
I K D RQY+ + L N + VLL+SDP A K +++ V VG+ DP +GLAH+
Sbjct: 11 IRKSDKDNRQYQAIRLDNGMVVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHY 66
|
| >d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 | Back information, alignment and structure |
|---|
| >d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 220 | Back information, alignment and structure |
|---|
| >d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 232 | Back information, alignment and structure |
|---|
| >d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 219 | Back information, alignment and structure |
|---|
| >d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 202 | Back information, alignment and structure |
|---|
| >d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 257 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| d1q2la4 | 240 | Protease III {Escherichia coli [TaxId: 562]} | 99.65 | |
| d3cx5a1 | 213 | Cytochrome bc1 core subunit 1 {Baker's yeast (Sacc | 99.42 | |
| d1hr6b1 | 222 | Mitochondrial processing peptidase (MPP) beta chai | 99.41 | |
| d1ppjb1 | 219 | Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [T | 99.33 | |
| d1ppja1 | 232 | Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [T | 99.28 | |
| d1hr6a1 | 220 | Mitochondrial processing peptidase (MPP) alpha cha | 99.21 | |
| d2fgea4 | 257 | Presequence protease 1, PREP1 {Thale cress (Arabid | 98.32 | |
| d3cx5b1 | 202 | Cytochrome bc1 core subunit 2 {Baker's yeast (Sacc | 98.12 | |
| d1q2la1 | 229 | Protease III {Escherichia coli [TaxId: 562]} | 97.95 |
| >d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: LuxS/MPP-like metallohydrolase superfamily: LuxS/MPP-like metallohydrolase family: MPP-like domain: Protease III species: Escherichia coli [TaxId: 562]
Probab=99.65 E-value=5.5e-17 Score=100.79 Aligned_cols=60 Identities=43% Similarity=0.696 Sum_probs=56.5
Q ss_pred CcceeecCCCccceEEEEccCCCEEEEEEcCCCCeEEEEEEEcccCCCCCCCCCcceeeC
Q 037967 7 DVEIIKPRTDKRQYRRLVLKNSLQVLLISDPDADKCAASMNVSVGAFCDPVGLEGLAHFL 66 (66)
Q Consensus 7 ~~~~~k~~~d~~~~~~~~L~NGl~v~~~~~~~~~~~~~~~~v~~Gs~~ep~~~~GlAHfl 66 (66)
...+.|+..|.++|+.++|+|||+|++++++..+.+++++++++||++||++..|+|||+
T Consensus 8 ~~~~~k~~~d~~~~~~~~L~NGl~V~~~~~~~~~~v~~~l~~~~Gs~~e~~~~~Gla~ll 67 (240)
T d1q2la4 8 QETIRKSDKDNRQYQAIRLDNGMVVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHYL 67 (240)
T ss_dssp CSCCCCCTTCCCEEEEEEETTSCEEEEEECTTCSSEEEEEEESCCGGGCCGGGTTHHHHH
T ss_pred cccCCCCCCCCcceEEEEcCCCCEEEEEECCCCCEEEEEEEEeCCccccccchHHHHHHH
Confidence 356789999999999999999999999999999999999999999999999999999985
|
| >d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ppjb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hr6a1 d.185.1.1 (A:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fgea4 d.185.1.1 (A:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3cx5b1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q2la1 d.185.1.1 (A:504-732) Protease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|