Citrus Sinensis ID: 037969


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
ARALRNKSLHEWKNALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTRLEELYM
ccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEcHHHHHHHHHHHHcccEEEEEccccccccccccccccEEEEEEEccccccccccccccccEEEEEccccccccccccHHHcccccccEEEccccccccccHHHcccccccEEccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccccEEcc
ccHHccccHHHHHHHHHHHHcccccccccccccccHHHEEcHcccccHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHEEEEEEcccccccccccccccccEEEEEEccccccccccHHHHHHccccEEEEccccccccccccHHHHHHHHEEEcccccccccccHHHHHHcEEEEcccccHHHccHHHHHHHccEEEEcccccccccccccHHHHHHHccEEcc
ARALRNKSLHEWKNALRelqtpsvvnfegvpaetySSIELSFKYLKGEQLKKIFLLCSLignsfwftDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSclllegdsseqfsmhDVVYDVVVSIACRDQHVFLVRNEvvwewpdedalkkCSAISLLNSSIHEVSEEFECLQLEFLHisqntfvevnipdnifkgmKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSdivrlpgelgqltklrlldltdclqlkfivpnvlssFTRLEELYM
aralrnkslhewknalrelqtpsvvnfEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLqlkfivpnvlssftrleelym
ARALRNKSLHEWKNALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGElgqltklrlldltdclqlkFIVPNVLSSFTRLEELYM
*************NALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTRL*****
**A*RNKSLHEWKNALRELQTPS*****GVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTRLEELYM
ARALRNKSLHEWKNALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTRLEELYM
*****NKSLHEWKNALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTRLEELYM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARALRNKSLHEWKNALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVVYDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTRLEELYM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query300 2.2.26 [Sep-21-2011]
O81825 919 Probable disease resistan yes no 0.98 0.319 0.277 7e-21
Q9T048 985 Disease resistance protei no no 0.98 0.298 0.288 4e-20
Q42484 909 Disease resistance protei no no 0.803 0.265 0.293 4e-15
Q9FLB4 874 Putative disease resistan no no 0.806 0.276 0.289 2e-14
O64973 889 Disease resistance protei no no 0.866 0.292 0.296 2e-14
Q9SH22 884 Probable disease resistan no no 0.966 0.328 0.261 2e-14
Q9SI85 893 Probable disease resistan no no 0.96 0.322 0.258 2e-12
Q9C8K0 854 Probable disease resistan no no 0.783 0.275 0.280 4e-12
Q8RXS5 888 Probable disease resistan no no 0.87 0.293 0.297 7e-12
Q8L3R3 885 Disease resistance protei no no 0.73 0.247 0.282 2e-11
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  101 bits (251), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 86/310 (27%), Positives = 150/310 (48%), Gaps = 16/310 (5%)

Query: 1   ARALRNKSLHE-WKNALRELQ--TPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLC 57
            R LR K   E WK+ L  L+   PS+   E +    + +++LS+ +L+ + +K  FL C
Sbjct: 316 GRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKI----FGTLKLSYDFLQ-DNMKSCFLFC 370

Query: 58  SLIGN--SFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFS 115
           +L     S   ++L  Y +  G+  G +   D  N+   LV  L+DSCLL +GDS +   
Sbjct: 371 ALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVK 430

Query: 116 MHDVVYDVVV---SIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEE-F 171
           MHDVV D  +   S      H  ++    + E+P +  +     +SL+ + +  +     
Sbjct: 431 MHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVI 490

Query: 172 ECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLD 231
           E ++   L +  N+ V+  +P+   +    LR++DL+ +R+ +LP S   L +L++L L 
Sbjct: 491 EGVETLVLLLQGNSHVK-EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLR 549

Query: 232 Q-SMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLS 290
               L ++  +  L  L+ L    S I  LP  L  L+ LR + +++  QL+ I    + 
Sbjct: 550 NCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTIL 609

Query: 291 SFTRLEELYM 300
             + LE L M
Sbjct: 610 QLSSLEVLDM 619




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q9C8K0|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.986 0.258 0.518 4e-73
255563252 1603 Disease resistance protein RPS5, putativ 0.983 0.184 0.478 4e-69
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.98 0.223 0.460 9e-67
147777048 1460 hypothetical protein VITISV_009359 [Viti 1.0 0.205 0.450 3e-65
359488027 1520 PREDICTED: disease resistance protein At 1.0 0.197 0.443 5e-65
296087872 1152 unnamed protein product [Vitis vinifera] 1.0 0.260 0.443 5e-65
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.96 0.214 0.461 7e-65
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.963 0.215 0.475 8e-64
147865073 1694 hypothetical protein VITISV_021876 [Viti 1.0 0.177 0.447 4e-63
255574526 1232 Disease resistance protein RFL1, putativ 0.983 0.239 0.453 3e-62
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 156/301 (51%), Positives = 210/301 (69%), Gaps = 5/301 (1%)

Query: 1   ARALRNKSLHEWKNALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLI 60
           ARAL+NK+L +WKNALREL+ PS  NF GV  + Y++IELS+ +L+ ++LK  FLLCS +
Sbjct: 355 ARALKNKNLSQWKNALRELKRPSPRNFAGVQEDVYAAIELSYNHLESKELKSTFLLCSRM 414

Query: 61  GNSFWFTDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSMHDVV 120
           G +    DL KY MGLG+F G   + +A++++++LVH+L+ S LLLE  S  QFSMHD V
Sbjct: 415 GYNASTRDLLKYGMGLGLFSGFVTVEEAQDRVHSLVHKLKASGLLLENHSDWQFSMHDAV 474

Query: 121 YDVVVSIACRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLH 180
            DV +SIA RD HVF+  +EV  +W  ++ LKK   I L  SS  E+  E E  QL+FLH
Sbjct: 475 RDVAISIAFRDCHVFVGGDEVEPKWSAKNMLKKYKEIWL--SSNIELLREMEYPQLKFLH 532

Query: 181 I-SQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGDIA 239
           + S++  +E  I  NI +GM  L+V+ LT + L SLPS +  L NL+TLCL QS LG+IA
Sbjct: 533 VRSEDPSLE--ISSNICRGMHKLKVLVLTNISLVSLPSPLHFLKNLRTLCLHQSSLGEIA 590

Query: 240 IIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTRLEELY 299
            IG+LK LEILSF  S+I  LP ++GQLTKLR+LDL+DC +L  I PN+ S+ + LEEL 
Sbjct: 591 DIGELKKLEILSFAKSNIKHLPRQIGQLTKLRMLDLSDCFELDVIPPNIFSNLSMLEELC 650

Query: 300 M 300
           M
Sbjct: 651 M 651




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147777048|emb|CAN65562.1| hypothetical protein VITISV_009359 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.846 0.276 0.270 4.1e-20
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.85 0.258 0.270 8.8e-19
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.806 0.272 0.299 2.4e-17
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.82 0.277 0.302 7.4e-16
TAIR|locus:2197739 762 AT1G61300 [Arabidopsis thalian 0.816 0.321 0.295 6.1e-15
TAIR|locus:2005517 909 RPS2 "RESISTANT TO P. SYRINGAE 0.783 0.258 0.277 7.9e-15
TAIR|locus:2034765 884 AT1G12290 [Arabidopsis thalian 0.813 0.276 0.298 5.4e-14
TAIR|locus:2031356 884 AT1G63360 [Arabidopsis thalian 0.83 0.281 0.271 5.4e-14
TAIR|locus:2201986 885 RFL1 "AT1G12210" [Arabidopsis 0.736 0.249 0.293 1.2e-13
TAIR|locus:2008440 899 AT1G61180 [Arabidopsis thalian 0.786 0.262 0.299 9.5e-13
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 250 (93.1 bits), Expect = 4.1e-20, P = 4.1e-20
 Identities = 73/270 (27%), Positives = 134/270 (49%)

Query:     2 RALRNKSLHE-WKNALRELQ--TPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCS 58
             R LR K   E WK+ L  L+   PS+   E +    + +++LS+ +L+ + +K  FL C+
Sbjct:   317 RTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKI----FGTLKLSYDFLQ-DNMKSCFLFCA 371

Query:    59 LIGNSFWF--TDLFKYSMGLGIFQGVNRMVDARNKLYALVHELRDSCLLLEGDSSEQFSM 116
             L    +    ++L  Y +  G+  G +   D  N+   LV  L+DSCLL +GDS +   M
Sbjct:   372 LFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKM 431

Query:   117 HDVVYDVVV-SIACRDQ--HVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEE-FE 172
             HDVV D  +  ++ + +  H  ++    + E+P +  +     +SL+ + +  +     E
Sbjct:   432 HDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIE 491

Query:   173 CLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGLLANLQTLCLDQ 232
              ++   L +  N+ V+  +P+   +    LR++DL+ +R+ +LP S   L +L++L L  
Sbjct:   492 GVETLVLLLQGNSHVK-EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRN 550

Query:   233 -SMLGDIAIIGKLKNLEILSFLNSDIVRLP 261
                L ++  +  L  L+ L    S I  LP
Sbjct:   551 CKKLRNLPSLESLVKLQFLDLHESAIRELP 580




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00050016
cc-nbs-lrr resistance protein (1144 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 47.3 bits (112), Expect = 5e-06
 Identities = 41/144 (28%), Positives = 64/144 (44%), Gaps = 4/144 (2%)

Query: 158 SLLNSSIHEVSEEFECLQLEFLHISQNTFVEVN-IPDNIFKGMKTLRVIDLTRMRLFSLP 216
           SL  +     S   E L+L  L         +  IP  I      L+ +DL+  ++ SLP
Sbjct: 97  SLDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLP 156

Query: 217 SSIGLLANLQTLCLDQSMLGDI-AIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDL 275
           S +  L NL+ L L  + L D+  ++  L NL  L    + I  LP E+  L+ L  LDL
Sbjct: 157 SPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDL 216

Query: 276 TDCLQLKFIVPNVLSSFTRLEELY 299
           ++   ++    + LS+   L  L 
Sbjct: 217 SNNSIIEL--LSSLSNLKNLSGLE 238


Length = 394

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 300
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.6
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.6
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.55
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.53
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.39
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.39
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.36
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.28
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.26
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.22
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.21
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.13
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.12
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.1
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.08
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.07
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.0
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
PLN03150623 hypothetical protein; Provisional 98.89
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.87
PLN03150 623 hypothetical protein; Provisional 98.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.78
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.45
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.44
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.4
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.38
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.38
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.34
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.24
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.19
PRK15386 426 type III secretion protein GogB; Provisional 98.15
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.02
PRK15386 426 type III secretion protein GogB; Provisional 97.96
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.47
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.46
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.42
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.38
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.37
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.22
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.72
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.7
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.62
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.54
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.94
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.31
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.26
KOG0473 326 consensus Leucine-rich repeat protein [Function un 95.19
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.99
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.23
smart0037026 LRR Leucine-rich repeats, outliers. 94.23
KOG1947 482 consensus Leucine rich repeat proteins, some prote 93.69
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.5
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.47
smart0037026 LRR Leucine-rich repeats, outliers. 93.2
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.2
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.65
KOG4341483 consensus F-box protein containing LRR [General fu 90.9
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.2
KOG1947 482 consensus Leucine rich repeat proteins, some prote 85.21
KOG4341483 consensus F-box protein containing LRR [General fu 81.67
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.2e-44  Score=340.60  Aligned_cols=275  Identities=28%  Similarity=0.454  Sum_probs=240.9

Q ss_pred             CcccCCC-ChhHHHHHHHHhcCCCCCCCCCCCcccccceeeccccCCchhHHHHHHHhhhcCCCCCHH--HHHhhhhhcc
Q 037969            1 ARALRNK-SLHEWKNALRELQTPSVVNFEGVPAETYSSIELSFKYLKGEQLKKIFLLCSLIGNSFWFT--DLFKYSMGLG   77 (300)
Q Consensus         1 g~~L~~k-~~~~W~~~l~~l~~~~~~~~~~~~~~i~~~l~lsy~~L~~~~lk~cfl~~a~fp~~~~~~--~Li~~w~aeg   77 (300)
                      |+.|+.| +.++|+++.+.+......+.+++++.|.++|++|||+||++ +|.||+|||.||+||.|.  +|+..|||||
T Consensus       363 G~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEG  441 (889)
T KOG4658|consen  363 GGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEG  441 (889)
T ss_pred             HHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhcc
Confidence            6789999 99999999999988766666777888999999999999977 999999999999999999  9999999999


Q ss_pred             cccCchhHHHHHHHHHHHHHHHHHhcccccCC---CCCcEEechhHHHHHHHHhh-----cCCcEEEEeccccccCCCcc
Q 037969           78 IFQGVNRMVDARNKLYALVHELRDSCLLLEGD---SSEQFSMHDVVYDVVVSIAC-----RDQHVFLVRNEVVWEWPDED  149 (300)
Q Consensus        78 ~i~~~~~~e~~~~~~~~~~~~L~~~~~~~~~~---~~~~~~~hdl~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~  149 (300)
                      |+++....+.+++.+++++.+|++++++....   ...+|+|||+++++|..++.     +++ .....+.+..+.|...
T Consensus       442 fi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~  520 (889)
T KOG4658|consen  442 FIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVK  520 (889)
T ss_pred             CcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccc-eEEECCcCcccccccc
Confidence            99985556668999999999999999998765   44779999999999999998     566 3333334555567667


Q ss_pred             ccCCccEEEeecCCCcccCccccCCCccEEecccCc--cccccCchhHHhcCCcccEEEeeCC-cCCcCCcccccCCCCc
Q 037969          150 ALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNT--FVEVNIPDNIFKGMKTLRVIDLTRM-RLFSLPSSIGLLANLQ  226 (300)
Q Consensus       150 ~~~~l~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~--~~~~~l~~~~~~~l~~L~~L~l~~~-~~~~lp~~i~~l~~L~  226 (300)
                      .....|++++.++.+..++....+++|++|-+.+|.  +  ..++..+|..++.|++|||++| .+.++|+.|+.|.+||
T Consensus       521 ~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l--~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~Lr  598 (889)
T KOG4658|consen  521 SWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWL--LEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLR  598 (889)
T ss_pred             chhheeEEEEeccchhhccCCCCCCccceEEEeecchhh--hhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhh
Confidence            778899999999999888888888899999999986  5  7788888899999999999976 5678999999999999


Q ss_pred             EEEccCCCCCC-cccccCCCCcCEEEccCC-CCCCCchhhcCCCCCCEEeccCCC
Q 037969          227 TLCLDQSMLGD-IAIIGKLKNLEILSFLNS-DIVRLPGELGQLTKLRLLDLTDCL  279 (300)
Q Consensus       227 ~L~l~~~~l~~-p~~~~~l~~L~~L~l~~~-~l~~lp~~~~~l~~L~~L~l~~~~  279 (300)
                      ||+++++.++. |.++++|+.|.+|++..+ .+..+|.....|++|++|.+....
T Consensus       599 yL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~  653 (889)
T KOG4658|consen  599 YLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA  653 (889)
T ss_pred             cccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc
Confidence            99999999999 999999999999999998 556667667779999999997764



>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-12
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-12
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 8e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-09
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-08
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 5e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 8e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 8e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 6e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 9e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 78.1 bits (193), Expect = 1e-16
 Identities = 32/156 (20%), Positives = 69/156 (44%), Gaps = 10/156 (6%)

Query: 151 LKKCSAISLLNSSI---HEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDL 207
           ++ C  ++ L   +       E    + L+ L +         +P +I   ++ L+ + +
Sbjct: 157 IRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRS--LPASIAN-LQNLKSLKI 213

Query: 208 TRMRLFSLPSSIGLLANLQTLCL-DQSMLGDI-AIIGKLKNLEILSFLN-SDIVRLPGEL 264
               L +L  +I  L  L+ L L   + L +   I G    L+ L   + S+++ LP ++
Sbjct: 214 RNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDI 273

Query: 265 GQLTKLRLLDLTDCLQLKFIVPNVLSSFTRLEELYM 300
            +LT+L  LDL  C+ L  + P++++       + +
Sbjct: 274 HRLTQLEKLDLRGCVNLSRL-PSLIAQLPANCIILV 308


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.69
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.69
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.68
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.68
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.68
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.67
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.67
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.67
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.67
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.67
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.67
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.67
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.67
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.66
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.66
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.66
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.65
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.64
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.64
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.64
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.64
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.64
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.63
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.63
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.63
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.62
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.62
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.62
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.62
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 99.62
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.62
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.61
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.6
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.6
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.6
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.59
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.58
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.58
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.58
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.58
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.58
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.58
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.56
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.55
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.53
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.53
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.52
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.51
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.49
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.48
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.46
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.46
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.46
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.38
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.3
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.14
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.0
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.99
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.98
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.91
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.83
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.81
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.78
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.67
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.38
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.2
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.18
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.79
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.15
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.06
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 96.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.82
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.82  E-value=4.2e-19  Score=153.17  Aligned_cols=164  Identities=24%  Similarity=0.352  Sum_probs=124.0

Q ss_pred             EEEeccccccCCC-ccccCCccEEEeecCCCcccCccc-cCCCccEEecccCccccccCchhH--------HhcCCcccE
Q 037969          135 FLVRNEVVWEWPD-EDALKKCSAISLLNSSIHEVSEEF-ECLQLEFLHISQNTFVEVNIPDNI--------FKGMKTLRV  204 (300)
Q Consensus       135 ~~~~~~~~~~~~~-~~~~~~l~~L~l~~~~~~~~~~~~-~~~~L~~L~l~~~~~~~~~l~~~~--------~~~l~~L~~  204 (300)
                      ..+.++.+..+|. ...+++++.|++++|.+..+|..+ .+++|++|++++|... +.+|..+        +.++++|++
T Consensus       109 L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~n~~~-~~~p~~~~~~~~~~~~~~l~~L~~  187 (328)
T 4fcg_A          109 MTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPEL-TELPEPLASTDASGEHQGLVNLQS  187 (328)
T ss_dssp             EEEESSCCCCCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEEEEETTC-CCCCSCSEEEC-CCCEEESTTCCE
T ss_pred             EECCCCCccchhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEECCCCCCc-cccChhHhhccchhhhccCCCCCE
Confidence            4445555555554 356777888888888777777655 7778888888776552 5666654        124788888


Q ss_pred             EEeeCCcCCcCCcccccCCCCcEEEccCCCCCC-cccccCCCCcCEEEccCCCCC-CCchhhcCCCCCCEEeccCCCCcc
Q 037969          205 IDLTRMRLFSLPSSIGLLANLQTLCLDQSMLGD-IAIIGKLKNLEILSFLNSDIV-RLPGELGQLTKLRLLDLTDCLQLK  282 (300)
Q Consensus       205 L~l~~~~~~~lp~~i~~l~~L~~L~l~~~~l~~-p~~~~~l~~L~~L~l~~~~l~-~lp~~~~~l~~L~~L~l~~~~~l~  282 (300)
                      |++++|.++.+|..++.+++|++|++++|.+.. |+.++.+++|++|++++|++. .+|..++.+++|++|++++|...+
T Consensus       188 L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~  267 (328)
T 4fcg_A          188 LRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLL  267 (328)
T ss_dssp             EEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCC
T ss_pred             EECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchh
Confidence            888888888888888888888888888888887 777888888888888887544 777788888888888888888788


Q ss_pred             ccchhhhcCCCCCCeeeC
Q 037969          283 FIVPNVLSSFTRLEELYM  300 (300)
Q Consensus       283 ~lp~~~l~~L~~L~~L~l  300 (300)
                      .+|.. ++.+++|++|++
T Consensus       268 ~~p~~-~~~l~~L~~L~L  284 (328)
T 4fcg_A          268 TLPLD-IHRLTQLEKLDL  284 (328)
T ss_dssp             BCCTT-GGGCTTCCEEEC
T ss_pred             hcchh-hhcCCCCCEEeC
Confidence            88876 788888888875



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 300
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 50.4 bits (119), Expect = 9e-08
 Identities = 35/193 (18%), Positives = 69/193 (35%), Gaps = 29/193 (15%)

Query: 129 CRDQHVFLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVE 188
             +    +  N  + +      L     +SL  + + ++        L  L ++ N    
Sbjct: 196 LTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISN 255

Query: 189 VNIPDNIFKGMKTLRVIDLTRMRLFSLPSSIGL---------------------LANLQT 227
           +  P     G+  L  + L   ++ ++    GL                     L NL  
Sbjct: 256 L-AP---LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTY 311

Query: 228 LCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPN 287
           L L  + + DI+ +  L  L+ L F N+ +  +   L  LT +  L      Q+  + P 
Sbjct: 312 LTLYFNNISDISPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHN-QISDLTP- 368

Query: 288 VLSSFTRLEELYM 300
            L++ TR+ +L +
Sbjct: 369 -LANLTRITQLGL 380


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.61
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.54
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.5
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.41
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.18
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.03
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.96
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.86
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.16
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.97
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.34
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.86
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.58
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin B
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.75  E-value=3.3e-17  Score=130.33  Aligned_cols=157  Identities=20%  Similarity=0.322  Sum_probs=137.4

Q ss_pred             EEEeccccccCCCccccCCccEEEeecCCCcccCccccCCCccEEecccCccccccCchhHHhcCCcccEEEeeCCcCCc
Q 037969          135 FLVRNEVVWEWPDEDALKKCSAISLLNSSIHEVSEEFECLQLEFLHISQNTFVEVNIPDNIFKGMKTLRVIDLTRMRLFS  214 (300)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~l~~~~~~~l~~L~~L~l~~~~~~~  214 (300)
                      ....+..+..++....+++++.|++++|.+..++....+++|+.|++.+|.+  ..+|.  +..+++|+.|+++++.+..
T Consensus        51 L~l~~~~i~~l~~l~~l~~L~~L~L~~n~i~~l~~~~~l~~L~~L~l~~n~i--~~l~~--l~~l~~L~~L~l~~~~~~~  126 (210)
T d1h6ta2          51 IIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKV--KDLSS--LKDLKKLKSLSLEHNGISD  126 (210)
T ss_dssp             EECTTSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCC--CCGGG--GTTCTTCCEEECTTSCCCC
T ss_pred             EECcCCCCCCchhHhhCCCCCEEeCCCccccCccccccCccccccccccccc--ccccc--ccccccccccccccccccc
Confidence            4455566666666678899999999999998888777999999999999998  77875  5889999999999999887


Q ss_pred             CCcccccCCCCcEEEccCCCCCCcccccCCCCcCEEEccCCCCCCCchhhcCCCCCCEEeccCCCCccccchhhhcCCCC
Q 037969          215 LPSSIGLLANLQTLCLDQSMLGDIAIIGKLKNLEILSFLNSDIVRLPGELGQLTKLRLLDLTDCLQLKFIVPNVLSSFTR  294 (300)
Q Consensus       215 lp~~i~~l~~L~~L~l~~~~l~~p~~~~~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~l~~~~~l~~lp~~~l~~L~~  294 (300)
                      ++ .+..++.++.++++++.+..+..+..+++|+++++++|.++.++. ++++++|+.|++++|. ++.+|.  +..+++
T Consensus       127 ~~-~l~~l~~l~~l~~~~n~l~~~~~~~~l~~L~~l~l~~n~l~~i~~-l~~l~~L~~L~Ls~N~-i~~l~~--l~~l~~  201 (210)
T d1h6ta2         127 IN-GLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVP-LAGLTKLQNLYLSKNH-ISDLRA--LAGLKN  201 (210)
T ss_dssp             CG-GGGGCTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCCCGG-GTTCTTCCEEECCSSC-CCBCGG--GTTCTT
T ss_pred             cc-ccccccccccccccccccccccccccccccccccccccccccccc-ccCCCCCCEEECCCCC-CCCChh--hcCCCC
Confidence            75 478899999999999999887778899999999999999998874 8999999999999998 788875  899999


Q ss_pred             CCeeeC
Q 037969          295 LEELYM  300 (300)
Q Consensus       295 L~~L~l  300 (300)
                      |++|+|
T Consensus       202 L~~L~L  207 (210)
T d1h6ta2         202 LDVLEL  207 (210)
T ss_dssp             CSEEEE
T ss_pred             CCEEEc
Confidence            999975



>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure