Citrus Sinensis ID: 038034


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--
MSQFCVLIVIFFCFFFHVKAQETSNSEPDSLHPLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDPHHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLTEEPNLEIFVQREQSHQGSSRFNLRSSFRKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADVVIKNRWSDVNSSDLLSLNSEMLSVMSINRFLPSNSKSGRFDNVFSVNDNMVKIKEDIERKRLYESRFSGIEKSHSVSGSSISSSYYNDENSSKLLNGTEKRSMSEITNFARFREFNISKKIRETSAGDESRKEERLRRVWLPMVQRTVQWFSGRERNFQELEHKRQDLNV
cccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccccccccccHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHHccccccccccccccccccEEEEccHHHHccccccccccccccHHHHHHHHccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHcccccccccccccccccc
cccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHccEEEEEcccccccccEEEEEEccccccccEEEcccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEcccccccccccccccccccEEEEcccccccccccccHHHHHHHcHHHHHHcccccccccccccccccccEEEcccccccHHHHHHHHHcccccccEcccccccccccccccccccccHHHcccccccccHHEEEccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccc
MSQFCVLIVIFFCFFFHVkaqetsnsepdslhplhpnIAVVIGVLSIAFSLLFLVLAYAKFCqsnhsnfadgdphhrNLQELVRsrsrfsgidkavieslplfrfaslrgskeGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQwleghascplcrykfdgrdrgsfsysnslrflripsnlteepnleIFVQREqshqgssrfnlRSSFRKIELNKKQEELLIEggnrsygdqKLLHKFKHKIIVADVVIKnrwsdvnssdLLSLNSEMLSVMSInrflpsnsksgrfdnvfsvNDNMVKIKEDIERKRLYESRFsgiekshsvsgssisssyyndensskllngtekrsMSEITNFARFREFNISkkiretsagdesrkeeRLRRVWLPMVQRTVQWFSGRERNFQELEHKRQDLNV
MSQFCVLIVIFFCFFFHVKAQETSNSEPDSLHPLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDPHHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLTEEPNLEIFVQreqshqgssrfnlrssfrKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADVVIKNRWSDVNSSDLLSLNSEMLSVMSINRFlpsnsksgrfdnvfsvndnmvkikedierKRLYESrfsgiekshsvsgssisssyyndensskllngtekrsmseitnfarfrefniskkiretsagdesrkeerlrrvwlpmvqrtvqwfsgrernfqelehkrqdlnv
MSQfcvliviffcfffHVKAQETSNSEPDSLHPLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDPHHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLTEEPNLEIFVQREQSHQGSSRFNLRSSFRKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADVVIKNRWsdvnssdllslnsemlsVMSINRFLPSNSKSGRFDNVFSVNDNMVKIKEDIERKRLYESRFsgiekshsvsgssisssyyndensskLLNGTEKRSMSEITNFARFREFNISKKIRETSAGDESRKEERLRRVWLPMVQRTVQWFSGRERNFQELEHKRQDLNV
***FCVLIVIFFCFFFHVKA************PLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNF*****************SRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLT****LEIF******************************LLIEGGNRSYGDQKLLHKFKHKIIVADVVIKNRWSDVNSSDLLSLNSEMLSVMSINRFL********FDNVFSVNDNMVKIK*******************************************************ARF***********************LRRVWLPMVQRTVQWFSG*****************
*SQFCVLIVIFFCF***********************IAVVIGVLSIAFSLLFLVLAYAKFCQSNHSN***************************VIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKF**************************************************************************************************************************************************************************************************************************************LPMVQRTVQWFSGR****************
MSQFCVLIVIFFCFFFHVKAQ*********LHPLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDPHHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLTEEPNLEIFVQ**********FNLRSSFRKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADVVIKNRWSDVNSSDLLSLNSEMLSVMSINRFLPSNSKSGRFDNVFSVNDNMVKIKEDIERKRLYESRFSG*************SSYYNDENSSKLLNGTEKRSMSEITNFARFREFNISKKIR***********ERLRRVWLPMVQRTVQWFSGRERNFQEL*********
*SQFCVLIVIFFCFFFHVKAQ*********LHPLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSN************************SGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFD*************************************************************************QKLLHKFKHKIIVADVVIKNRWSDVNSSDLLSLNSEMLSVMSINRFLP***KS****NVFSVNDNMVKIKEDIERKRLYE*********************************************ARFR********************ERLRRVWLPMVQRTVQWFSGRE***************
iiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQFCVLIVIFFCFFFHVKAQETSNSEPDSLHPLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDPHHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLTEEPNLEIFVQREQSHQGSSRFNLRSSFRKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADVVIKNRWSDVNSSDLLSLNSEMLSVMSINRFLPSNSKSGRFDNVFSVNDNMVKIKEDIERKRLYESRFSGIEKSHSVSGSSISSSYYNDENSSKLLNGTEKRSMSEITNFARFREFNISKKIRETSAGDESRKEERLRRVWLPMVQRTVQWFSGRERNFQELEHKRQDLNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query422 2.2.26 [Sep-21-2011]
Q9SL78390 Putative RING-H2 finger p yes no 0.808 0.874 0.432 2e-74
Q5XF85432 E3 ubiquitin-protein liga no no 0.905 0.884 0.403 3e-70
Q5EAE9407 RING-H2 finger protein AT no no 0.651 0.675 0.358 8e-35
Q8GW38369 RING-H2 finger protein AT no no 0.293 0.336 0.414 3e-22
Q8W571323 RING-H2 finger protein AT no no 0.336 0.439 0.402 8e-22
Q84W40404 RING-H2 finger protein AT no no 0.291 0.304 0.401 2e-21
Q9C7I1327 RING-H2 finger protein AT no no 0.381 0.492 0.335 4e-20
Q8RXX9398 E3 ubiquitin-protein liga no no 0.355 0.376 0.329 7e-20
Q9LF64362 RING-H2 finger protein AT no no 0.452 0.527 0.288 1e-19
O64763378 E3 ubiquitin-protein liga no no 0.281 0.314 0.375 2e-19
>sp|Q9SL78|ATL12_ARATH Putative RING-H2 finger protein ATL12 OS=Arabidopsis thaliana GN=ATL12 PE=3 SV=1 Back     alignment and function desciption
 Score =  280 bits (715), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 234/398 (58%), Gaps = 57/398 (14%)

Query: 36  PNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDP----HHRNLQELVRSRSRFSG 91
           P++A++ GV SI F+L F++L YAK   ++  +  D D     H R  Q L    SRFSG
Sbjct: 39  PSLAIITGVFSIVFTLTFVLLVYAKCFHNDLRSETDSDGERIRHDRLWQGLFNRSSRFSG 98

Query: 92  IDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEG 151
           +DK  IESLP FRF++L+G K+GLEC+V LSKFED EILRLLPKCRHAFH+ CIDQWLE 
Sbjct: 99  LDKKAIESLPFFRFSALKGLKQGLECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWLEQ 158

Query: 152 HASCPLCRYKFDGRDRGSF--SYSNSLRFLRIPSNLTEEPNLEIFVQREQ-SHQGSSRFN 208
           HA+CPLCR + +  D  S   + S SLR L       E+  LEI+++RE+ ++ GSSRF 
Sbjct: 159 HATCPLCRNRVNIEDDLSVLGNSSTSLRILNQSETREEDSRLEIYIEREEGTNDGSSRF- 217

Query: 209 LRSSFRKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADVVIKNRWSDVNSSDLLS 268
             SSFRKI    K+  LL   GN +  ++KL+HKF H+I+V+D V KNRWS++ SSDL  
Sbjct: 218 --SSFRKI---LKKSLLLEREGNENIDEKKLMHKFNHRIVVSDAVFKNRWSNITSSDLTF 272

Query: 269 LNSEMLSVMSINRFLPSNSKSGRFDNVFSVNDNMVKIKEDIERKRLYESRFSGIEKSHSV 328
           L SEML+ +S          S RF +V  V+   ++ KED+E KR+              
Sbjct: 273 LTSEMLNSVS----------SDRFSSVDRVHRGNLRDKEDMEMKRM-------------- 308

Query: 329 SGSSISSSYYNDENSSKLLNGTEKRSMSEITNFARFREFNISKKIRETSAGDE----SRK 384
                       ++SS       +R++SEIT  +R +    S +    S        +  
Sbjct: 309 --------LIKHKDSS-------RRTVSEITTVSREKAVGGSYRGSTASTSQNYAVTATT 353

Query: 385 EERLRRVWLPMVQRTVQWFSGRERNFQELEHKRQDLNV 422
           EER RR+WLP+ +RT QWF  RE++  +L   RQ+LNV
Sbjct: 354 EERRRRLWLPIARRTAQWFVNREKS-NDLNTTRQNLNV 390





Arabidopsis thaliana (taxid: 3702)
>sp|Q5XF85|ATL42_ARATH E3 ubiquitin-protein ligase ATL42 OS=Arabidopsis thaliana GN=ATL42 PE=1 SV=2 Back     alignment and function description
>sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 Back     alignment and function description
>sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 Back     alignment and function description
>sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 Back     alignment and function description
>sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 Back     alignment and function description
>sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 Back     alignment and function description
>sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 Back     alignment and function description
>sp|O64763|ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana GN=ATL9 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
224089028412 predicted protein [Populus trichocarpa] 0.947 0.970 0.549 1e-120
255550976407 ring finger protein, putative [Ricinus c 0.917 0.950 0.573 1e-115
359476036413 PREDICTED: E3 ubiquitin-protein ligase A 0.969 0.990 0.523 1e-113
147765316 915 hypothetical protein VITISV_020095 [Viti 0.969 0.446 0.518 1e-110
225445146423 PREDICTED: E3 ubiquitin-protein ligase A 0.954 0.952 0.514 1e-109
356496420426 PREDICTED: E3 ubiquitin-protein ligase A 0.990 0.981 0.497 2e-98
356531305419 PREDICTED: E3 ubiquitin-protein ligase A 0.954 0.961 0.468 3e-96
255641525419 unknown [Glycine max] 0.954 0.961 0.461 6e-93
449468049412 PREDICTED: E3 ubiquitin-protein ligase A 0.895 0.917 0.460 1e-87
356554556395 PREDICTED: putative RING-H2 finger prote 0.862 0.921 0.476 1e-86
>gi|224089028|ref|XP_002308607.1| predicted protein [Populus trichocarpa] gi|222854583|gb|EEE92130.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  439 bits (1129), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 224/408 (54%), Positives = 298/408 (73%), Gaps = 8/408 (1%)

Query: 15  FFHVKAQETSNSEPDSLHPLHPNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDP 74
           FFHVKAQ TS S+  ++ P+H  + +++G+LS    + F VLAYAK+C  N +NF     
Sbjct: 13  FFHVKAQITSGSDSATVIPVHQGLPLILGILSTMLLITFFVLAYAKYCGRNQNNFLGRYL 72

Query: 75  HHRNLQELVRSRSRFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLP 134
           HH+N   L+RS SRFSGI + VI S+P FRF+SL+GSKEGLECAV +SKFED+++LRLLP
Sbjct: 73  HHQNFHGLIRSSSRFSGIGEEVINSMPFFRFSSLKGSKEGLECAVCISKFEDSDVLRLLP 132

Query: 135 KCRHAFHMSCIDQWLEGHASCPLCRYKFDGRDRGSFSYSNSLRFLRIPSNLTEEPNLEIF 194
           KC+HAFH +CIDQWL+ H+SCPLCRYK D +D  SF+YS S R L+ PSNL E+PNLEIF
Sbjct: 133 KCKHAFHENCIDQWLKSHSSCPLCRYKIDPKDVKSFTYSRSWRHLQNPSNLAEDPNLEIF 192

Query: 195 VQREQSHQGSSRFNLRSSFRKIELNKKQEELLIEGGNRSYGDQKLLHKFKHKIIVADVVI 254
           V+RE   Q SS FN  SSF+    N K+EELL++ G  +  ++KL HKF HKII++DV+I
Sbjct: 193 VEREHDRQVSSCFNPGSSFQISNDNSKKEELLVQAGGNADDNRKLFHKFMHKIIISDVLI 252

Query: 255 KNRWSDVNSSDLLSLNSEMLSVMSINRFLPSNSKSGRFDNVFSVNDNMVKIKEDIERKRL 314
           K+RWSD NSSD LSLN+EML VMS NRF P  S S RF N  S  +N+ K+K+D ERKRL
Sbjct: 253 KSRWSDANSSDFLSLNTEMLGVMSSNRFTPLKSSSARFYNGLSRVENLEKVKDDTERKRL 312

Query: 315 YESRFSGIEKSHSVSGSSISSSYYNDENSSKLLNGTEKRSMSEITNFARFREFNISKKIR 374
            + +F  +++S+SV  SS++        SSK+LN   KRS SEIT F+RFR+ +   K++
Sbjct: 313 SKPQFPTVDRSNSVPSSSLN--------SSKMLNPVGKRSTSEITIFSRFRQLSAKNKMK 364

Query: 375 ETSAGDESRKEERLRRVWLPMVQRTVQWFSGRERNFQELEHKRQDLNV 422
           E+++     K+ER+R +WLP+ +RTVQWF+GRERN ++LE++RQ  NV
Sbjct: 365 ESASLGNGGKDERIRMLWLPIARRTVQWFAGRERNLRQLEYERQASNV 412




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255550976|ref|XP_002516536.1| ring finger protein, putative [Ricinus communis] gi|223544356|gb|EEF45877.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359476036|ref|XP_002281341.2| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147765316|emb|CAN66948.1| hypothetical protein VITISV_020095 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225445146|ref|XP_002280643.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356496420|ref|XP_003517066.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Glycine max] Back     alignment and taxonomy information
>gi|356531305|ref|XP_003534218.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Glycine max] Back     alignment and taxonomy information
>gi|255641525|gb|ACU21036.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449468049|ref|XP_004151734.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis sativus] gi|449531894|ref|XP_004172920.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356554556|ref|XP_003545611.1| PREDICTED: putative RING-H2 finger protein ATL12-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
TAIR|locus:2061698390 AT2G20030 [Arabidopsis thalian 0.620 0.671 0.470 3.3e-67
TAIR|locus:2123558432 AT4G28890 [Arabidopsis thalian 0.902 0.881 0.389 2e-65
TAIR|locus:2199902369 AT1G23980 [Arabidopsis thalian 0.334 0.382 0.382 2.9e-23
TAIR|locus:2140069323 AT4G40070 [Arabidopsis thalian 0.319 0.417 0.430 1.6e-22
TAIR|locus:2151421362 AT5G17600 [Arabidopsis thalian 0.319 0.372 0.363 6.7e-21
TAIR|locus:2207026404 AT1G72200 [Arabidopsis thalian 0.291 0.304 0.401 4.8e-20
TAIR|locus:2054049423 MEE16 "maternal effect embryo 0.317 0.316 0.391 1.3e-19
TAIR|locus:2118666472 AT4G30400 [Arabidopsis thalian 0.495 0.442 0.325 1.4e-19
TAIR|locus:2206722327 AT1G35330 [Arabidopsis thalian 0.348 0.449 0.381 3.7e-19
TAIR|locus:2122358302 AT4G09110 [Arabidopsis thalian 0.350 0.490 0.320 4.3e-18
TAIR|locus:2061698 AT2G20030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 579 (208.9 bits), Expect = 3.3e-67, Sum P(2) = 3.3e-67
 Identities = 135/287 (47%), Positives = 178/287 (62%)

Query:    36 PNIAVVIGVLSIAFSLLFLVLAYAKFCQSNHSNFADGDP----HHRNLQELVRSRSRFSG 91
             P++A++ GV SI F+L F++L YAK   ++  +  D D     H R  Q L    SRFSG
Sbjct:    39 PSLAIITGVFSIVFTLTFVLLVYAKCFHNDLRSETDSDGERIRHDRLWQGLFNRSSRFSG 98

Query:    92 IDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEG 151
             +DK  IESLP FRF++L+G K+GLEC+V LSKFED EILRLLPKCRHAFH+ CIDQWLE 
Sbjct:    99 LDKKAIESLPFFRFSALKGLKQGLECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWLEQ 158

Query:   152 HASCPLCRYKFDGRDRGSF--SYSNSLRFLRIPSNLTEEPNLEIFVQREQ-SHQGSSRFN 208
             HA+CPLCR + +  D  S   + S SLR L       E+  LEI+++RE+ ++ GSSRF 
Sbjct:   159 HATCPLCRNRVNIEDDLSVLGNSSTSLRILNQSETREEDSRLEIYIEREEGTNDGSSRF- 217

Query:   209 LRSSFRKIELNKKQEELLIEG-GNRSYGDQKLLHKFKHKIIVADVVIKNRWXXXXXXXXX 267
               SSFRKI L K    LL+E  GN +  ++KL+HKF H+I+V+D V KNRW         
Sbjct:   218 --SSFRKI-LKKS---LLLEREGNENIDEKKLMHKFNHRIVVSDAVFKNRWSNITSSDLT 271

Query:   268 XXXXXXXXVMSINRFLPSNSKSGRFDNVFSVNDNMVKIKEDIERKRL 314
                         +  L S S S RF +V  V+   ++ KED+E KR+
Sbjct:   272 FLT---------SEMLNSVS-SDRFSSVDRVHRGNLRDKEDMEMKRM 308


GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0010043 "response to zinc ion" evidence=RCA
TAIR|locus:2123558 AT4G28890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199902 AT1G23980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140069 AT4G40070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151421 AT5G17600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207026 AT1G72200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054049 MEE16 "maternal effect embryo arrest 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118666 AT4G30400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206722 AT1G35330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122358 AT4G09110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SL78ATL12_ARATHNo assigned EC number0.43210.80800.8743yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 9e-15
cd0016245 cd00162, RING, RING-finger (Really Interesting New 9e-11
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 7e-08
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 1e-07
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 3e-06
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 3e-06
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 3e-06
smart0018440 smart00184, RING, Ring finger 7e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-05
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 67.8 bits (166), Expect = 9e-15
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 116 ECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCR 159
           EC + L +FE  E + +LP C H FH  C+D+WL    +CPLCR
Sbjct: 2   ECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 422
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.73
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.37
PHA02929238 N1R/p28-like protein; Provisional 99.21
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.18
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.1
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.09
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.73
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.73
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.72
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.69
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.68
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.67
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.63
PHA02926242 zinc finger-like protein; Provisional 98.59
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.56
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.52
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.47
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.44
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.42
PF1463444 zf-RING_5: zinc-RING finger domain 98.41
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.38
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.37
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 98.36
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.23
COG52191525 Uncharacterized conserved protein, contains RING Z 98.19
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.17
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.04
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.02
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.97
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.96
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.92
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.92
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.86
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.85
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.84
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.84
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.82
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.82
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.73
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.53
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.5
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.48
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.38
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.37
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.26
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.2
KOG4445368 consensus Uncharacterized conserved protein, conta 97.2
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.11
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.11
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.88
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.64
KOG0297391 consensus TNF receptor-associated factor [Signal t 96.64
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.61
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 96.45
KOG1941518 consensus Acetylcholine receptor-associated protei 95.86
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.79
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.55
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.54
KOG2660331 consensus Locus-specific chromosome binding protei 95.48
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.44
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.3
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.21
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.03
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.76
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.74
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.61
COG5152259 Uncharacterized conserved protein, contains RING a 94.52
PHA02862156 5L protein; Provisional 94.52
PHA03096284 p28-like protein; Provisional 94.18
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 94.09
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.02
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.8
PF04641260 Rtf2: Rtf2 RING-finger 93.53
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.92
PHA02825162 LAP/PHD finger-like protein; Provisional 92.85
KOG4739233 consensus Uncharacterized protein involved in syna 92.74
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.65
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 92.45
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.4
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 92.38
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 91.58
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 91.35
PF10272358 Tmpp129: Putative transmembrane protein precursor; 89.89
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 89.08
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.99
KOG1001674 consensus Helicase-like transcription factor HLTF/ 88.83
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.2
COG5222427 Uncharacterized conserved protein, contains RING Z 88.14
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 87.89
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 87.74
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 87.17
KOG1940276 consensus Zn-finger protein [General function pred 86.91
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 86.62
KOG02981394 consensus DEAD box-containing helicase-like transc 84.68
COG5175 480 MOT2 Transcriptional repressor [Transcription] 84.31
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 84.15
KOG3002299 consensus Zn finger protein [General function pred 82.19
PF0721379 DAP10: DAP10 membrane protein; InterPro: IPR009861 80.66
KOG03091081 consensus Conserved WD40 repeat-containing protein 80.54
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 80.52
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.73  E-value=9.9e-18  Score=168.80  Aligned_cols=77  Identities=32%  Similarity=0.733  Sum_probs=66.8

Q ss_pred             cCCCCCHHHHhhCCceEeeccCCCCCCccccccccccccccceeecCCCCceeeCCchhhhhccCC-CCCcccccccCC
Q 038034           88 RFSGIDKAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHA-SCPLCRYKFDGR  165 (422)
Q Consensus        88 ~~~gl~~~~i~~LP~~~~~~~~~~~e~~~CsICLe~f~~~~~~r~Lp~C~H~FH~~CI~~WL~~~~-sCPlCR~~l~~~  165 (422)
                      +...+.+..++++|...|...........|+||||+|+.|+++++|| |+|.||..|||+||..+. .||+|++++...
T Consensus       203 ~~~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di~~~  280 (348)
T KOG4628|consen  203 RRNRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDIRTD  280 (348)
T ss_pred             hhhhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcCCCC
Confidence            45578899999999999977655444469999999999999999999 999999999999998875 599999977654



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF07213 DAP10: DAP10 membrane protein; InterPro: IPR009861 This family consists of several mammalian DAP10 membrane proteins Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 6e-13
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 8e-09
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-08
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 8e-07
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 2e-04
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 3e-04
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 6e-13, Method: Composition-based stats. Identities = 26/47 (55%), Positives = 34/47 (72%) Query: 113 EGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCR 159 +G+ECAV L++ ED E R LP+C H FH C+D WL H++CPLCR Sbjct: 4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 50
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-31
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 8e-29
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 8e-26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-21
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-21
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-19
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 3e-17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 4e-17
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-16
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-12
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 3e-11
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-11
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 6e-11
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-10
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 6e-10
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 7e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 7e-08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 5e-07
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 8e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 6e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 7e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 8e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 4e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 5e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 7e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 7e-05
2ecw_A85 Tripartite motif-containing protein 30; metal bind 1e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 3e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 4e-04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 7e-04
3nw0_A238 Non-structural maintenance of chromosomes element 7e-04
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 8e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 8e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score =  112 bits (282), Expect = 7e-31
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 94  KAVIESLPLFRFASLRGSKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHA 153
                 LP +RF       E   C V +  FE  ++LR+LP C H FH  C+D+WL+ + 
Sbjct: 3   SGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANR 61

Query: 154 SCPLCRY 160
           +CP+CR 
Sbjct: 62  TCPICRA 68


>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.62
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.6
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.46
2ect_A78 Ring finger protein 126; metal binding protein, st 99.45
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.41
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.39
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.32
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.3
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.3
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.28
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.27
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.24
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.23
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.21
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.19
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.19
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.17
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.17
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.15
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.14
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.13
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.11
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.06
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.02
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.01
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.01
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.01
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.99
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.99
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.95
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.94
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.93
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.91
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.9
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.9
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.89
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.88
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.85
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.83
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.82
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.82
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.79
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.76
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.75
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.74
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.73
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.72
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.71
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.65
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.64
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.62
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.61
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.58
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.53
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.51
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.46
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.45
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.39
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.37
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.32
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.25
2ea5_A68 Cell growth regulator with ring finger domain prot 98.24
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.19
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.16
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.03
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.02
3nw0_A238 Non-structural maintenance of chromosomes element 97.8
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.61
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.51
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.5
1we9_A64 PHD finger family protein; structural genomics, PH 91.44
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 90.94
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 89.85
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 89.73
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 89.21
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 88.18
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 87.36
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 87.22
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 85.66
2yt5_A66 Metal-response element-binding transcription facto 85.23
2k16_A75 Transcription initiation factor TFIID subunit 3; p 83.15
1wil_A89 KIAA1045 protein; ring finger domain, structural g 83.01
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 82.85
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 82.29
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 81.92
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 81.47
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 80.81
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 80.7
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 80.39
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 80.06
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=2.5e-16  Score=128.96  Aligned_cols=78  Identities=27%  Similarity=0.625  Sum_probs=68.5

Q ss_pred             cccCCCCCHHHHhhCCceEeeccCC-CCCCccccccccccccccceeecCCCCceeeCCchhhhhccCCCCCcccccccC
Q 038034           86 RSRFSGIDKAVIESLPLFRFASLRG-SKEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFDG  164 (422)
Q Consensus        86 ~~~~~gl~~~~i~~LP~~~~~~~~~-~~e~~~CsICLe~f~~~~~~r~Lp~C~H~FH~~CI~~WL~~~~sCPlCR~~l~~  164 (422)
                      .....+++++.|+.||.+.+..... ..++..|+||++.|..++.++.+| |+|.||..||..|+..+.+||+||+.+.+
T Consensus        11 ~~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           11 MVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             SSCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CcCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            4457799999999999999876443 346678999999999999899999 99999999999999999999999998865



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 422
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-19
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-13
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-12
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-10
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 8e-10
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-09
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 4e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-07
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 5e-05
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 79.1 bits (195), Expect = 2e-19
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query: 112 KEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYK 161
            +G+ECAV L++ ED E  R LP+C H FH  C+D WL  H++CPLCR  
Sbjct: 3   DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.6
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.33
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.31
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.27
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.22
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.2
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.07
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.02
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.93
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.92
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.87
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.85
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.72
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.7
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.55
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.3
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 92.57
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 90.57
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.13
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 87.84
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 87.63
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 82.1
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.60  E-value=1.9e-16  Score=117.52  Aligned_cols=52  Identities=50%  Similarity=1.146  Sum_probs=47.3

Q ss_pred             CCCccccccccccccccceeecCCCCceeeCCchhhhhccCCCCCccccccc
Q 038034          112 KEGLECAVYLSKFEDTEILRLLPKCRHAFHMSCIDQWLEGHASCPLCRYKFD  163 (422)
Q Consensus       112 ~e~~~CsICLe~f~~~~~~r~Lp~C~H~FH~~CI~~WL~~~~sCPlCR~~l~  163 (422)
                      +++.+|+||+++|..++.+..++.|+|.||..||.+|++.+.+||+||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            4567899999999999999888779999999999999999999999998764



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure