Citrus Sinensis ID: 038036


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------64
QETLLSLNFSASNPPLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSCYFIHPRTDELASPNESSNNEL
cHHHHHHHHccccccccccccccccccccEEEcccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccccccccccccccccHHHHccccccEEEccccEEEEEcccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccHHHcccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccHHHHcccccccccccccccccccHHHHccccccccccccEEEcccccccccccHHHcccccccEEccccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHccccccccccccccccEEEEEEccccEEEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHcccccEEEEEccccccccccHHHHHHccccEEEEcccccccccccHHHHHHHccccccEEEEEccccccccccccHccccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEcccccccccccHHHHccccccEEEEEcccccccccccHcccccccccccccEEEEEccccccccccHHHHcccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccccHccccccccccccHHccccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccHHHccHHHccccccccccccccccccccccccccccccccccccccc
qetllslnfsasnpplnwsfstdccfwegikcdskarvthlwlpyrglsgsiypfignLTHLCHLnlshnhlsgplainsFSFVIHLETLdlsynsfsgQFLSSFFQLAENLITLNVshnmfsgsipsftswnnkslsslkildfsyndfsgqlppglgncsklqtFRAGFnylsgsipddisaatslqeislpgnqlsgaisdgvgnltsLSMLdlqsnkfsglipqdigkltnlkSLQLHTnslsgflpqslmnctnliTLNLRInnfrgdlsaynfstlhnlhtidlgnnnftgsfpltltSCKVLTAIRLsrnkivgqiSPEILALESLSYLsitnnnfsnITGAIRILMGCKNLRMLLLCKKFFheaipdenqRAISSYAFQNLLVLgigdceikgQIPTWLARLKKLQvldlgsnqitgsipgwlgnmpnlfyidlsynsisgefpkeFCGLRALALQEVknradgsqlqlplfvpktKIALYNQQYNklfslppaiylrnnslngsipieignlKFLHVLDLSlnnfsgeipdqisqltnlegldlsennlhgeiplsiidlhflssfsvanndlqgqipsggqfltfpsssfegnprfcgdiverqsscyfihprtdelaspnessnnel
qetllslnfsasnpplnwSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSCYFIHprtdelaspnessnnel
QETLLSLNFSASNPPLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGnlthlchlnlshnhlSGPLAINSFSFVIHLETLDLSYNsfsgqflssffqlAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMnctnlitlnlrinnFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSCYFIHPRTDELASPNESSNNEL
**************PLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAAT*************GAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSCYFIH*****************
QETLLSLNFSASN*P*NWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQ**************LFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGD*****************************
QETLLSLNFSASNPPLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSCYFIHPRTDE************
*ET*LSLNFSASNPPLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSCYFIHP****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QETLLSLNFSASNPPLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSCYFIHPRTDELASPNESSNNEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query638 2.2.26 [Sep-21-2011]
Q9C7S5 1095 Tyrosine-sulfated glycope yes no 0.949 0.553 0.491 1e-168
Q9SHI3729 Receptor-like protein 2 O no no 0.934 0.817 0.485 1e-164
Q9FN37 1036 Phytosulfokine receptor 2 no no 0.896 0.552 0.414 1e-108
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.913 0.571 0.419 1e-107
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.905 0.573 0.414 1e-105
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.813 0.414 0.345 4e-66
Q9FL28 1173 LRR receptor-like serine/ no no 0.865 0.470 0.316 9e-66
C0LGQ5 1249 LRR receptor-like serine/ no no 0.844 0.431 0.347 6e-65
O82318 960 Probably inactive leucine no no 0.893 0.593 0.327 1e-63
Q9LVP0 1102 Probable leucine-rich rep no no 0.860 0.498 0.341 6e-63
>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  592 bits (1527), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 318/647 (49%), Positives = 424/647 (65%), Gaps = 41/647 (6%)

Query: 1   QETLLSLNFSASNP--PLNWSFSTDCCFWEGIKCDS--KARVTHLWLPYRGLSGSIYPFI 56
           +++LL  + + S+P  PL+W+ S DCC WEGI CD   + RVT + L  RGLSG++   +
Sbjct: 53  RDSLLWFSGNVSSPVSPLHWNSSIDCCSWEGISCDKSPENRVTSIILSSRGLSGNLPSSV 112

Query: 57  GNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQF--------------- 101
            +L  L  L+LSHN LSGPL     S +  L  LDLSYNSF G+                
Sbjct: 113 LDLQRLSRLDLSHNRLSGPLPPGFLSALDQLLVLDLSYNSFKGELPLQQSFGNGSNGIFP 172

Query: 102 ---------------LSS--FFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILD 144
                          LSS  F Q A NL + NVS+N F+GSIPSF    +  L+ L   D
Sbjct: 173 IQTVDLSSNLLEGEILSSSVFLQGAFNLTSFNVSNNSFTGSIPSFMCTASPQLTKL---D 229

Query: 145 FSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISD 204
           FSYNDFSG L   L  CS+L   RAGFN LSG IP +I     L+++ LP N+LSG I +
Sbjct: 230 FSYNDFSGDLSQELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDN 289

Query: 205 GVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLN 264
           G+  LT L++L+L SN   G IP+DIGKL+ L SLQLH N+L G +P SL NCT L+ LN
Sbjct: 290 GITRLTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLN 349

Query: 265 LRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQIS 324
           LR+N   G LSA +FS   +L  +DLGNN+FTG FP T+ SCK++TA+R + NK+ GQIS
Sbjct: 350 LRVNQLGGTLSAIDFSRFQSLSILDLGNNSFTGEFPSTVYSCKMMTAMRFAGNKLTGQIS 409

Query: 325 PEILALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSY 384
           P++L LESLS+ + ++N  +N+TGA+ IL GCK L  L++ K F+ E +P  N+  + S 
Sbjct: 410 PQVLELESLSFFTFSDNKMTNLTGALSILQGCKKLSTLIMAKNFYDETVP-SNKDFLRSD 468

Query: 385 AFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSY 444
            F +L + GIG C + G+IP WL +L++++V+DL  N+  G+IPGWLG +P+LFY+DLS 
Sbjct: 469 GFPSLQIFGIGACRLTGEIPAWLIKLQRVEVMDLSMNRFVGTIPGWLGTLPDLFYLDLSD 528

Query: 445 NSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIY 504
           N ++GE PKE   LRAL  Q+  +  + + L+LP+FV    +   NQQYN+L SLPP IY
Sbjct: 529 NFLTGELPKELFQLRALMSQKAYDATERNYLELPVFVNPNNVT-TNQQYNQLSSLPPTIY 587

Query: 505 LRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPL 564
           ++ N+L G+IP+E+G LK LH+L+L  NNFSG IPD++S LTNLE LDLS NNL G IP 
Sbjct: 588 IKRNNLTGTIPVEVGQLKVLHILELLGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIPW 647

Query: 565 SIIDLHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIV 611
           S+  LHFLS F+VANN L G IP+G QF TFP ++FEGNP  CG ++
Sbjct: 648 SLTGLHFLSYFNVANNTLSGPIPTGTQFDTFPKANFEGNPLLCGGVL 694




Tyrosine-sulfated glycopeptide receptor with a serine/threonine-protein kinase activity. Regulates, in response to tyrosine-sulfated glycopeptide binding, a signaling cascade involved in cellular proliferation and plant growth. Not involved in PSK perception.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query638
359482434 1280 PREDICTED: tyrosine-sulfated glycopeptid 0.952 0.475 0.568 0.0
255537393 1087 Leucine-rich repeat receptor protein kin 0.967 0.567 0.563 0.0
224074123 1050 predicted protein [Populus trichocarpa] 0.962 0.584 0.561 0.0
224138536 1092 predicted protein [Populus trichocarpa] 0.962 0.562 0.563 0.0
219718185 1085 receptor kinase [Gossypium barbadense] 0.934 0.549 0.551 0.0
297841971 1096 hypothetical protein ARALYDRAFT_476358 [ 0.973 0.566 0.495 1e-172
147832546 1188 hypothetical protein VITISV_009907 [Viti 0.945 0.507 0.520 1e-170
356504209 1076 PREDICTED: tyrosine-sulfated glycopeptid 0.959 0.568 0.520 1e-169
358248614 1065 tyrosine-sulfated glycopeptide receptor 0.938 0.562 0.527 1e-167
356520190 1103 PREDICTED: tyrosine-sulfated glycopeptid 0.938 0.543 0.526 1e-167
>gi|359482434|ref|XP_002270860.2| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/645 (56%), Positives = 454/645 (70%), Gaps = 37/645 (5%)

Query: 1   QETLLSLNFSASNPP---LNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIG 57
           + +LLS +   S+PP   LNWS S DCC WEGI C  + RVTHL LP RGLSG + P + 
Sbjct: 257 RASLLSFSRDISSPPSAPLNWS-SFDCCLWEGITC-YEGRVTHLRLPLRGLSGGVSPSLA 314

Query: 58  NLTHLCHLNLSHNHLSGPLAINSFSFV--------------------------IHLETLD 91
           NLT L HLNLS N  SG + +  FS +                          + L+T+D
Sbjct: 315 NLTLLSHLNLSRNSFSGSVPLELFSSLEILDVSFNRLSGELPLSLSQSPNNSGVSLQTID 374

Query: 92  LSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFS 151
           LS N F G   SSF QLA NL   NVS+N F+ SIPS    N+  +   +++DFSYN FS
Sbjct: 375 LSSNHFYGVIQSSFLQLARNLTNFNVSNNSFTDSIPSDICRNSPLV---RLMDFSYNKFS 431

Query: 152 GQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTS 211
           G++P GLG+CSKL+  RAGFN LSG IP+DI +A +L+EISLP N LSG ISD + NL++
Sbjct: 432 GRVPLGLGDCSKLEVLRAGFNSLSGLIPEDIYSAAALREISLPVNSLSGPISDAIVNLSN 491

Query: 212 LSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFR 271
           L++L+L SN+  G +P+D+GKL  LK L LH N L+G LP SLMNCT L TLNLR+N F 
Sbjct: 492 LTVLELYSNQLIGNLPKDMGKLFYLKRLLLHINKLTGPLPASLMNCTKLTTLNLRVNLFE 551

Query: 272 GDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALE 331
           GD+S   FSTL  L T+DLG+NNFTG+ P++L SCK LTA+RL+ N++ GQI P+ILAL+
Sbjct: 552 GDISVIKFSTLQELSTLDLGDNNFTGNLPVSLYSCKSLTAVRLANNRLEGQILPDILALQ 611

Query: 332 SLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLV 391
           SLS+LSI+ NN +NITGAIR+LMGC+NL  ++L + FF+E +PD++   + S  FQ L V
Sbjct: 612 SLSFLSISKNNLTNITGAIRMLMGCRNLSTVILTQNFFNERLPDDDS-ILDSNGFQRLQV 670

Query: 392 LGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEF 451
           LG+G C   GQ+PTWLA+L KL+VLDL  NQITGSIPGWLG +P+LFYIDLS N ISGEF
Sbjct: 671 LGLGGCRFTGQVPTWLAKLSKLEVLDLSLNQITGSIPGWLGTLPSLFYIDLSSNLISGEF 730

Query: 452 PKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLN 511
           PKE   L  L  +E     D S L+LP+FV        N QY +L +LPPAIYLRNNSL+
Sbjct: 731 PKEIIRLPRLTSEEAATEVDQSYLELPVFVMPNNAT--NLQYKQLSNLPPAIYLRNNSLS 788

Query: 512 GSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHF 571
           G+IP EIG LKF+H+LDLS NNFSG IPDQIS LTNLE LDLS N+L GEIP S+  LHF
Sbjct: 789 GNIPTEIGQLKFIHILDLSYNNFSGSIPDQISNLTNLEKLDLSGNHLSGEIPGSLRSLHF 848

Query: 572 LSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSS 616
           LSSF+VANN L+G IPSGGQF TFP+SSFEGNP  CG  ++R  S
Sbjct: 849 LSSFNVANNSLEGAIPSGGQFDTFPNSSFEGNPGLCGPPLQRSCS 893




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537393|ref|XP_002509763.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] gi|223549662|gb|EEF51150.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224074123|ref|XP_002304261.1| predicted protein [Populus trichocarpa] gi|222841693|gb|EEE79240.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224138536|ref|XP_002326627.1| predicted protein [Populus trichocarpa] gi|222833949|gb|EEE72426.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|219718185|gb|ACL35341.1| receptor kinase [Gossypium barbadense] Back     alignment and taxonomy information
>gi|297841971|ref|XP_002888867.1| hypothetical protein ARALYDRAFT_476358 [Arabidopsis lyrata subsp. lyrata] gi|297334708|gb|EFH65126.1| hypothetical protein ARALYDRAFT_476358 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147832546|emb|CAN68301.1| hypothetical protein VITISV_009907 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356504209|ref|XP_003520891.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Glycine max] Back     alignment and taxonomy information
>gi|358248614|ref|NP_001239911.1| tyrosine-sulfated glycopeptide receptor 1-like precursor [Glycine max] gi|223452476|gb|ACM89565.1| leucine-rich repeat receptor-like kinase [Glycine max] Back     alignment and taxonomy information
>gi|356520190|ref|XP_003528747.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query638
TAIR|locus:2207056 1095 PSY1R "PSY1 receptor" [Arabido 0.899 0.524 0.463 6.7e-136
TAIR|locus:2020402729 RLP2 "AT1G17240" [Arabidopsis 0.894 0.783 0.455 5.6e-132
TAIR|locus:2020382756 RLP3 "AT1G17250" [Arabidopsis 0.783 0.661 0.506 8.1e-131
TAIR|locus:2051628 1008 PSKR1 "phytosulfokin receptor 0.905 0.573 0.387 2.1e-100
TAIR|locus:2154709 1036 PSKR2 "phytosylfokine-alpha re 0.902 0.555 0.386 1.3e-98
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.858 0.497 0.322 3.5e-60
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.829 0.744 0.338 3.5e-59
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.866 0.498 0.309 4.6e-57
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.800 0.409 0.347 1.1e-56
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.882 0.549 0.312 4.1e-56
TAIR|locus:2207056 PSY1R "PSY1 receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1331 (473.6 bits), Expect = 6.7e-136, P = 6.7e-136
 Identities = 273/589 (46%), Positives = 372/589 (63%)

Query:    37 RVTHLWLPYRGLSGSIYP-FIGXXXXXXXXXXXXXXXSGPLAI-----NSFSFVIHLETL 90
             R++ L L +  LSG + P F+                 G L +     N  + +  ++T+
Sbjct:   117 RLSRLDLSHNRLSGPLPPGFLSALDQLLVLDLSYNSFKGELPLQQSFGNGSNGIFPIQTV 176

Query:    91 DLSYNXXXXXXXXXXXXX--AENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYN 148
             DLS N               A NL + NVS+N F+GSIPSF    +  L+ L   DFSYN
Sbjct:   177 DLSSNLLEGEILSSSVFLQGAFNLTSFNVSNNSFTGSIPSFMCTASPQLTKL---DFSYN 233

Query:   149 DFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGN 208
             DFSG L   L  CS+L   RAGFN LSG IP +I     L+++ LP N+LSG I +G+  
Sbjct:   234 DFSGDLSQELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDNGITR 293

Query:   209 LTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMXXXXXXXXXXXXX 268
             LT L++L+L SN   G IP+DIGKL+ L SLQLH N+L G +P SL              
Sbjct:   294 LTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLNLRVN 353

Query:   269 XFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEIL 328
                G LSA +FS   +L  +DLGNN+FTG FP T+ SCK++TA+R + NK+ GQISP++L
Sbjct:   354 QLGGTLSAIDFSRFQSLSILDLGNNSFTGEFPSTVYSCKMMTAMRFAGNKLTGQISPQVL 413

Query:   329 ALESLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQN 388
              LESLS+ + ++N  +N+TGA+ IL GCK L  L++ K F+ E +P  N+  + S  F +
Sbjct:   414 ELESLSFFTFSDNKMTNLTGALSILQGCKKLSTLIMAKNFYDETVPS-NKDFLRSDGFPS 472

Query:   389 LLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSIS 448
             L + GIG C + G+IP WL +L++++V+DL  N+  G+IPGWLG +P+LFY+DLS N ++
Sbjct:   473 LQIFGIGACRLTGEIPAWLIKLQRVEVMDLSMNRFVGTIPGWLGTLPDLFYLDLSDNFLT 532

Query:   449 GEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNN 508
             GE PKE   LRAL  Q+  +  + + L+LP+FV    +   NQQYN+L SLPP IY++ N
Sbjct:   533 GELPKELFQLRALMSQKAYDATERNYLELPVFVNPNNVTT-NQQYNQLSSLPPTIYIKRN 591

Query:   509 SLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIID 568
             +L G+IP+E+G LK LH+L+L  NNFSG IPD++S LTNLE LDLS NNL G IP S+  
Sbjct:   592 NLTGTIPVEVGQLKVLHILELLGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIPWSLTG 651

Query:   569 LHFLSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSC 617
             LHFLS F+VANN L G IP+G QF TFP ++FEGNP  CG ++   +SC
Sbjct:   652 LHFLSYFNVANNTLSGPIPTGTQFDTFPKANFEGNPLLCGGVL--LTSC 698


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0001653 "peptide receptor activity" evidence=IMP
GO:0004888 "transmembrane signaling receptor activity" evidence=IMP
GO:0009611 "response to wounding" evidence=IGI
GO:0031347 "regulation of defense response" evidence=IGI
TAIR|locus:2020402 RLP2 "AT1G17240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020382 RLP3 "AT1G17250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051628 PSKR1 "phytosulfokin receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154709 PSKR2 "phytosylfokine-alpha receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query638
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-85
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  287 bits (735), Expect = 2e-85
 Identities = 215/616 (34%), Positives = 320/616 (51%), Gaps = 43/616 (6%)

Query: 1   QETLLSLNFSAS-NPPL----NWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPF 55
           +E  L L+F +S N PL    NW+ S D C W+GI C++ +RV  + L  + +SG I   
Sbjct: 29  EELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSA 88

Query: 56  IGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITL 115
           I  L ++  +NLS+N LSGP+  + F+    L  L+LS N+F+G           NL TL
Sbjct: 89  IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGS---IPNLETL 145

Query: 116 NVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLS 175
           ++S+NM SG IP+    +  S SSLK+LD   N   G++P  L N + L+      N L 
Sbjct: 146 DLSNNMLSGEIPN----DIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLV 201

Query: 176 GSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTN 235
           G IP ++    SL+ I L  N LSG I   +G LTSL+ LDL  N  +G IP  +G L N
Sbjct: 202 GQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKN 261

Query: 236 LKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNF 295
           L+ L L+ N LSG +P S+ +   LI+L+L  N+  G++       L NL  + L +NNF
Sbjct: 262 LQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPEL-VIQLQNLEILHLFSNNF 320

Query: 296 TGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAI-RILM 354
           TG  P+ LTS   L  ++L  NK  G+I   +    +L+ L ++ N   N+TG I   L 
Sbjct: 321 TGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTN---NLTGEIPEGLC 377

Query: 355 GCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQ 414
              NL  L+L    F  ++  E  +++   A ++L  + + D    G++P+   +L  + 
Sbjct: 378 SSGNLFKLIL----FSNSLEGEIPKSLG--ACRSLRRVRLQDNSFSGELPSEFTKLPLVY 431

Query: 415 VLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQ 474
            LD+ +N + G I     +MP+L  + L+ N   G  P  F   R   L   +N+  G+ 
Sbjct: 432 FLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGA- 490

Query: 475 LQLPLFVPKTKIALYNQQYNKLFSLPPAIYLR--NNSLNGSIPIEIGNLKFLHVLDLSLN 532
                 VP            KL SL   + L+   N L+G IP E+ + K L  LDLS N
Sbjct: 491 ------VP-----------RKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHN 533

Query: 533 NFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQF 592
             SG+IP   S++  L  LDLS+N L GEIP ++ ++  L   ++++N L G +PS G F
Sbjct: 534 QLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAF 593

Query: 593 LTFPSSSFEGNPRFCG 608
           L   +S+  GN   CG
Sbjct: 594 LAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 638
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
PLN03150623 hypothetical protein; Provisional 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
PLN03150623 hypothetical protein; Provisional 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.87
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.47
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
KOG4341483 consensus F-box protein containing LRR [General fu 98.13
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
KOG4341483 consensus F-box protein containing LRR [General fu 97.8
PRK15386 426 type III secretion protein GogB; Provisional 97.75
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.68
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
PRK15386 426 type III secretion protein GogB; Provisional 97.55
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.87
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.58
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.48
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 96.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.38
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.18
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.84
KOG4308478 consensus LRR-containing protein [Function unknown 93.95
KOG4308478 consensus LRR-containing protein [Function unknown 92.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.61
smart0037026 LRR Leucine-rich repeats, outliers. 90.61
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.21
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.21
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.96
smart0037026 LRR Leucine-rich repeats, outliers. 86.96
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.43
KOG0473 326 consensus Leucine-rich repeat protein [Function un 82.79
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4e-64  Score=581.60  Aligned_cols=567  Identities=35%  Similarity=0.523  Sum_probs=508.7

Q ss_pred             CCCCCCCCCCCCcCccceEECCCCCeEEEECCCCCceeeccccCcCCCCCCEEECCCCCCCCCCccccccccceecEEEc
Q 038036           13 NPPLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDL   92 (638)
Q Consensus        13 ~~~~~w~~~~~~~~w~g~~c~~~~~v~~L~l~~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~L   92 (638)
                      +.+.+|+...+||.|.|+.|+..++|+.|+++++.+.+.+++++..+++|++|+|++|.+.+.+|...|..+.+|++|+|
T Consensus        46 ~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~L  125 (968)
T PLN00113         46 KYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNL  125 (968)
T ss_pred             ccCCCCCCCCCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEEC
Confidence            45789988889999999999877899999999999999999999999999999999999998999998889999999999


Q ss_pred             CCccccccccHHHHhcCCCCcEEEcccCcCcccCCCccccCCCCCCCcCEEEccCCcCCccCCccCCCCCCCcEEEcccc
Q 038036           93 SYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFN  172 (638)
Q Consensus        93 s~n~i~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~l~~L~~L~ls~n~i~~~~~~~l~~l~~L~~L~l~~n  172 (638)
                      ++|++++.+|.   ..+++|++|++++|.+.+..|..+.    .+++|++|++++|.+.+.+|..+.++++|++|++++|
T Consensus       126 s~n~l~~~~p~---~~l~~L~~L~Ls~n~~~~~~p~~~~----~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n  198 (968)
T PLN00113        126 SNNNFTGSIPR---GSIPNLETLDLSNNMLSGEIPNDIG----SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN  198 (968)
T ss_pred             cCCccccccCc---cccCCCCEEECcCCcccccCChHHh----cCCCCCEEECccCcccccCChhhhhCcCCCeeeccCC
Confidence            99999887775   3478999999999999887776555    7999999999999999899999999999999999999


Q ss_pred             cccccCCccccCCCCCCEEEccCCCCccccCccccCCCCCCEEEeecCcCcccCCcccCCCCCCCEEEccCCCCCCCcch
Q 038036          173 YLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQ  252 (638)
Q Consensus       173 ~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~  252 (638)
                      .+.+.+|..+.++++|++|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|++|++++|.+.+..|.
T Consensus       199 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~  278 (968)
T PLN00113        199 QLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP  278 (968)
T ss_pred             CCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCch
Confidence            99989999999999999999999999989999999999999999999999999999999999999999999999988999


Q ss_pred             hhcCCCCCcEEEccCcccccccCcccccCCCCccEEecCCCcccccccccCcCCCCCCEEEcCCCcccccCchhhhcCCC
Q 038036          253 SLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALES  332 (638)
Q Consensus       253 ~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~l~~~~~L~~L~L~~n~i~~~~~~~l~~l~~  332 (638)
                      .+.++++|+.|++++|.+.+.++. .+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+..+++
T Consensus       279 ~l~~l~~L~~L~Ls~n~l~~~~p~-~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~  357 (968)
T PLN00113        279 SIFSLQKLISLDLSDNSLSGEIPE-LVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNN  357 (968)
T ss_pred             hHhhccCcCEEECcCCeeccCCCh-hHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCC
Confidence            999999999999999999877664 6788999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEccCCcCCCCccccccccCCCCCcEEEcCCCcccccCCcchhhhccccCCCCccEEEeeCCcccccchHHhhcCCC
Q 038036          333 LSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKK  412 (638)
Q Consensus       333 L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~  412 (638)
                      |+.|++++|.+....  ...+..+++|+.+++++|.+.+..+....      .+++|+.|++++|.+.+..|..+..++.
T Consensus       358 L~~L~Ls~n~l~~~~--p~~~~~~~~L~~L~l~~n~l~~~~p~~~~------~~~~L~~L~L~~n~l~~~~p~~~~~l~~  429 (968)
T PLN00113        358 LTVLDLSTNNLTGEI--PEGLCSSGNLFKLILFSNSLEGEIPKSLG------ACRSLRRVRLQDNSFSGELPSEFTKLPL  429 (968)
T ss_pred             CcEEECCCCeeEeeC--ChhHhCcCCCCEEECcCCEecccCCHHHh------CCCCCCEEECcCCEeeeECChhHhcCCC
Confidence            999999999887432  23456678999999999999887776543      6789999999999999999999999999


Q ss_pred             CCEEecCCCccccCcCccccCCCCCCEEEccCCcCccccchhhhhhccchhhhccccCCCCCCcccccccccchhhhhcc
Q 038036          413 LQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQ  492 (638)
Q Consensus       413 L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~  492 (638)
                      |+.|++++|.+++.++..+..+++|+.|++++|.+.+.+|..+. .+.|+.++++.+.-...... .+..          
T Consensus       430 L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~-~~~L~~L~ls~n~l~~~~~~-~~~~----------  497 (968)
T PLN00113        430 VYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG-SKRLENLDLSRNQFSGAVPR-KLGS----------  497 (968)
T ss_pred             CCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccc-cccceEEECcCCccCCccCh-hhhh----------
Confidence            99999999999998888888999999999999999888887653 46677776665432211100 0000          


Q ss_pred             cccccCCCCeEEccCCcccccCchhhhcCcCCCeeeCCCCeeeecCChhhhCCCCCCeeeCCCCcceecCCccccccCCC
Q 038036          493 YNKLFSLPPAIYLRNNSLNGSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFL  572 (638)
Q Consensus       493 ~~~l~~~~~~L~ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L  572 (638)
                          ......|++++|.+.+.+|..+.++++|++|+|++|.+++.+|..|..+++|+.|+|++|++++.+|..+..+++|
T Consensus       498 ----l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L  573 (968)
T PLN00113        498 ----LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESL  573 (968)
T ss_pred             ----hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCccc
Confidence                0112479999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEecccCceeecCCCCCcCCCcCCCccCCCCCCCCCCC
Q 038036          573 SSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIV  611 (638)
Q Consensus       573 ~~L~l~~n~l~~~~p~~~~~~~l~~~~~~~n~~lc~~~~  611 (638)
                      +.|++++|++.|.+|..+++.++....+.|||.+||...
T Consensus       574 ~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~  612 (968)
T PLN00113        574 VQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDT  612 (968)
T ss_pred             CEEeccCCcceeeCCCcchhcccChhhhcCCccccCCcc
Confidence            999999999999999999999999999999999998654



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query638
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-46
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-18
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-46
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-17
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-08
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-07
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 4e-07
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 4e-07
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-06
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 184 bits (466), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 183/597 (30%), Positives = 266/597 (44%), Gaps = 85/597 (14%) Query: 82 SFVIHLETLDLSYNXXXXXXXXXXXXXAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLK 141 S ++LE LD+S N A L L++S N SG S + + LK Sbjct: 194 SRCVNLEFLDVSSNNFSTGIPFLGDCSA--LQHLDISGNKLSGDFSRAIS----TCTELK 247 Query: 142 ILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAAT-SLQEISLPGNQLSG 200 +L+ S N F G +PP LQ N +G IPD +S A +L + L GN G Sbjct: 248 LLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 305 Query: 201 AISDGVGNLTSLSMLDLQSNKFSGLIPQD-IGKLTNLKSLQLHTNSLSGFLPQSLMXXXX 259 A+ G+ + L L L SN FSG +P D + K+ LK L L N SG LP+SL Sbjct: 306 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 365 Query: 260 XXXXXXXXXXFRGDLSAYNFS----------TLHNLHTIDLGNNNFTGSFPLTLTSCKVL 309 DLS+ NFS + L + L NN FTG P TL++C L Sbjct: 366 SLLTL--------DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSEL 417 Query: 310 TAIRLSRNKIVGQISPEILALESLSYLSITNNNFSNITGAI-RILMGCKNLRMLLLCKKF 368 ++ LS N + G I + +L L L + N + G I + LM K L L+L Sbjct: 418 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM---LEGEIPQELMYVKTLETLILDFND 474 Query: 369 FHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLKKLQVLDLGSNQITGSIP 428 IP NL + + + + G+IP W+ RL+ L +L L +N +G+IP Sbjct: 475 LTGEIPSGLSNC------TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP 528 Query: 429 GWLGNMPNLFYIDLSYNSISGEFPKEF------------CGLRALALQE--VKNRADGSQ 474 LG+ +L ++DL+ N +G P G R + ++ +K G+ Sbjct: 529 AELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAG 588 Query: 475 LQLPLFVPKTKIALYNQQYNKLFSLPPA-----IY------------------LRNNSLN 511 L + ++Q N+L + P +Y + N L+ Sbjct: 589 NLLEF------QGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS 642 Query: 512 GSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHF 571 G IP EIG++ +L +L+L N+ SG IPD++ L L LDLS N L G IP ++ L Sbjct: 643 GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTM 702 Query: 572 LSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVER----QSSCYFIHPRT 624 L+ ++NN+L G IP GQF TFP + F NP CG + R + Y H R+ Sbjct: 703 LTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRS 759
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query638
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-127
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-125
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-79
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-73
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-38
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-63
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-57
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-38
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  393 bits (1012), Expect = e-127
 Identities = 169/586 (28%), Positives = 249/586 (42%), Gaps = 67/586 (11%)

Query: 39  THLWLPYRGLSGSIYPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFS 98
            HL +    LSG     I   T L  LN+S N   GP+          L+ L L+ N F+
Sbjct: 226 QHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLK---SLQYLSLAENKFT 282

Query: 99  GQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPG- 157
           G+         + L  L++S N F G++P F      S S L+ L  S N+FSG+LP   
Sbjct: 283 GEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFG----SCSLLESLALSSNNFSGELPMDT 338

Query: 158 LGNCSKLQTFRAGFNYLSGSIPDDISAAT-SLQEISLPGNQLSGAISDGVGN--LTSLSM 214
           L     L+     FN  SG +P+ ++  + SL  + L  N  SG I   +      +L  
Sbjct: 339 LLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE 398

Query: 215 LDLQSNKFSGLIPQDIGKLTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDL 274
           L LQ+N F+G IP  +   + L SL L  N LSG +P SL + + L  L L +N   G++
Sbjct: 399 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 458

Query: 275 SAYNFSTLHNLHTIDLGNNNFTGSFPLTLTSCKVLTAIRLSRNKIVGQISPEILALESLS 334
                  +  L T+ L  N+ TG  P  L++C  L  I LS N++ G+I   I  LE+L+
Sbjct: 459 PQ-ELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLA 517

Query: 335 YLSITNNNFSNITGAI-RILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLG 393
            L ++NN+FS   G I   L  C++L  L L    F+  IP                   
Sbjct: 518 ILKLSNNSFS---GNIPAELGDCRSLIWLDLNTNLFNGTIPAA---------MFKQS-GK 564

Query: 394 IGDCEIKGQIPTWLARLKKLQVLDLGSN--QITGSIPGWLGNMPNLFYIDLSYNSISGEF 451
           I    I G+   ++      +      N  +  G     L  +      +++     G  
Sbjct: 565 IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHT 624

Query: 452 PKEFCGLRALALQEVKNRADGSQLQLPLFVPKTKIALYNQQYNKLFSLPPAIYLRNNSLN 511
              F    ++                                         + +  N L+
Sbjct: 625 SPTFDNNGSMMF---------------------------------------LDMSYNMLS 645

Query: 512 GSIPIEIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHF 571
           G IP EIG++ +L +L+L  N+ SG IPD++  L  L  LDLS N L G IP ++  L  
Sbjct: 646 GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTM 705

Query: 572 LSSFSVANNDLQGQIPSGGQFLTFPSSSFEGNPRFCGDIVERQSSC 617
           L+   ++NN+L G IP  GQF TFP + F  NP  CG  + R    
Sbjct: 706 LTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPS 751


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query638
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.31
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.13
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.47
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.99
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.88
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.24
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.51
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.37
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-72  Score=634.11  Aligned_cols=600  Identities=31%  Similarity=0.464  Sum_probs=448.8

Q ss_pred             cccCCCCCCCCCCCCCCcCccceEECCCCCeEEEECCCCCceee---cc-----------------------ccCcCCCC
Q 038036            8 NFSASNPPLNWSFSTDCCFWEGIKCDSKARVTHLWLPYRGLSGS---IY-----------------------PFIGNLTH   61 (638)
Q Consensus         8 ~~~~~~~~~~w~~~~~~~~w~g~~c~~~~~v~~L~l~~~~~~~~---~~-----------------------~~l~~l~~   61 (638)
                      ++.|..++++|..+.+||+|.||.|+ .++|++|+|+++.+.|.   ++                       +.++.+++
T Consensus        23 ~~~~~~~l~~W~~~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~  101 (768)
T 3rgz_A           23 VLPDKNLLPDWSSNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSAS  101 (768)
T ss_dssp             TCSCTTSSTTCCTTSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTT
T ss_pred             hCCCcccccCCCCCCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCC
Confidence            35455589999888999999999998 78999999999888775   33                       46777788


Q ss_pred             CCEEECCCCCCCCCCcc-ccccccceecEEEcCCccccccccHHHHhcCCCCcEEEcccCcCcccCCCc---cc------
Q 038036           62 LCHLNLSHNHLSGPLAI-NSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSF---TS------  131 (638)
Q Consensus        62 L~~L~Ls~n~l~~~~~~-~~~~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~---~~------  131 (638)
                      |++|+|++|.+.|.+|. ..+..+++|++|+|++|.+++.+|..++..+++|++|++++|.+++..+..   +.      
T Consensus       102 L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~  181 (768)
T 3rgz_A          102 LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELK  181 (768)
T ss_dssp             CCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCC
T ss_pred             CCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCC
Confidence            88888888888765554 145566677777777776665555444344555555555555554332211   00      


Q ss_pred             ------------cCCCCCCCcCEEEccCCcCCccCCccCCCCCCCcEEEcccccccccCCccccCCCCCCEEEccCCCCc
Q 038036          132 ------------WNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLS  199 (638)
Q Consensus       132 ------------~~~~~l~~L~~L~ls~n~i~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~i~  199 (638)
                                  .....+++|++|++++|.+.+.+|. +.++++|++|++++|.+.+.+|..+..+++|++|++++|.+.
T Consensus       182 ~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~  260 (768)
T 3rgz_A          182 HLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV  260 (768)
T ss_dssp             EEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCE
T ss_pred             EEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCccc
Confidence                        0013677788888888887766665 788888888888888887777777888888888888888777


Q ss_pred             cccCccccCCCCCCEEEeecCcCcccCCcccCCC-CCCCEEEccCCCCCCCcchhhcCCCCCcEEEccCcccccccCccc
Q 038036          200 GAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKL-TNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYN  278 (638)
Q Consensus       200 ~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l-~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~  278 (638)
                      +..|..  .+++|++|++++|.+++.+|..+... ++|++|++++|.+++..|..+.++++|+.|++++|.+.+.++...
T Consensus       261 ~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~  338 (768)
T 3rgz_A          261 GPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDT  338 (768)
T ss_dssp             ESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHH
T ss_pred             CccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHH
Confidence            655543  66777777777777776667666654 778888888887777777777777888888888777776666555


Q ss_pred             ccCCCCccEEecCCCcccccccccCcC---------------------------CCCCCEEEcCCCcccccCchhhhcCC
Q 038036          279 FSTLHNLHTIDLGNNNFTGSFPLTLTS---------------------------CKVLTAIRLSRNKIVGQISPEILALE  331 (638)
Q Consensus       279 ~~~~~~L~~L~l~~n~i~~~~~~~l~~---------------------------~~~L~~L~L~~n~i~~~~~~~l~~l~  331 (638)
                      +..+++|++|++++|.+++.+|..+..                           +++|++|++++|.+++.+|..+..++
T Consensus       339 l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~  418 (768)
T 3rgz_A          339 LLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS  418 (768)
T ss_dssp             HTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCT
T ss_pred             HhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCC
Confidence            677777777777777766555544433                           44566666666666666666677777


Q ss_pred             CCCEEEccCCcCCCCccccccccCCCCCcEEEcCCCcccccCCcchhhhccccCCCCccEEEeeCCcccccchHHhhcCC
Q 038036          332 SLSYLSITNNNFSNITGAIRILMGCKNLRMLLLCKKFFHEAIPDENQRAISSYAFQNLLVLGIGDCEIKGQIPTWLARLK  411 (638)
Q Consensus       332 ~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~  411 (638)
                      +|+.|++++|.++...+  ..+..+++|+.|++++|.+.+..+....      .+++|++|++++|.+.+.+|..+..++
T Consensus       419 ~L~~L~Ls~N~l~~~~p--~~l~~l~~L~~L~L~~n~l~~~~p~~~~------~l~~L~~L~L~~N~l~~~~p~~l~~l~  490 (768)
T 3rgz_A          419 ELVSLHLSFNYLSGTIP--SSLGSLSKLRDLKLWLNMLEGEIPQELM------YVKTLETLILDFNDLTGEIPSGLSNCT  490 (768)
T ss_dssp             TCCEEECCSSEEESCCC--GGGGGCTTCCEEECCSSCCCSCCCGGGG------GCTTCCEEECCSSCCCSCCCGGGGGCT
T ss_pred             CCCEEECcCCcccCccc--HHHhcCCCCCEEECCCCcccCcCCHHHc------CCCCceEEEecCCcccCcCCHHHhcCC
Confidence            77777777776663222  3456677788888888777766665443      578899999999999988999999999


Q ss_pred             CCCEEecCCCccccCcCccccCCCCCCEEEccCCcCccccchhhhhhccchhhhccccCCCCCCcccccccc--------
Q 038036          412 KLQVLDLGSNQITGSIPGWLGNMPNLFYIDLSYNSISGEFPKEFCGLRALALQEVKNRADGSQLQLPLFVPK--------  483 (638)
Q Consensus       412 ~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~l~~~~~~~~~~~~~~~~~~~--------  483 (638)
                      +|++|++++|++++.+|.++..+++|++|++++|++.+.+|..++.+++|+.+++..+.-....+...+...        
T Consensus       491 ~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~  570 (768)
T 3rgz_A          491 NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFI  570 (768)
T ss_dssp             TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTT
T ss_pred             CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcc
Confidence            999999999999999999999999999999999999999999999999999888875532211110000000        


Q ss_pred             -------------------------------------cchhhhhcccccc----------cCCCCeEEccCCcccccCch
Q 038036          484 -------------------------------------TKIALYNQQYNKL----------FSLPPAIYLRNNSLNGSIPI  516 (638)
Q Consensus       484 -------------------------------------~~l~~~~~~~~~l----------~~~~~~L~ls~n~l~~~~~~  516 (638)
                                                           ......++..+.+          ......|++++|+++|.+|.
T Consensus       571 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~  650 (768)
T 3rgz_A          571 AGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK  650 (768)
T ss_dssp             CSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCG
T ss_pred             ccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCH
Confidence                                                 0000000010100          12345899999999999999


Q ss_pred             hhhcCcCCCeeeCCCCeeeecCChhhhCCCCCCeeeCCCCcceecCCccccccCCCCeEecccCceeecCCCCCcCCCcC
Q 038036          517 EIGNLKFLHVLDLSLNNFSGEIPDQISQLTNLEGLDLSENNLHGEIPLSIIDLHFLSSFSVANNDLQGQIPSGGQFLTFP  596 (638)
Q Consensus       517 ~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~p~~~~~~~l~  596 (638)
                      .++++++|+.|+|++|.+++.+|+.|+++++|+.|||++|++++.+|..+..+++|++|++++|+++|.||.++++.+++
T Consensus       651 ~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~  730 (768)
T 3rgz_A          651 EIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFP  730 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSC
T ss_pred             HHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccCCCCCCCCCCCCCCCCCCCCCC
Q 038036          597 SSSFEGNPRFCGDIVERQSSCYFIHP  622 (638)
Q Consensus       597 ~~~~~~n~~lc~~~~~~~~~c~~~~~  622 (638)
                      ..+|.|||++||+++.   .|...+.
T Consensus       731 ~~~~~gN~~Lcg~~l~---~C~~~~~  753 (768)
T 3rgz_A          731 PAKFLNNPGLCGYPLP---RCDPSNA  753 (768)
T ss_dssp             GGGGCSCTEEESTTSC---CCCSCC-
T ss_pred             HHHhcCCchhcCCCCc---CCCCCcc
Confidence            9999999999999874   6866544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 638
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 85.6 bits (210), Expect = 7e-19
 Identities = 71/309 (22%), Positives = 112/309 (36%), Gaps = 17/309 (5%)

Query: 2   ETLLSLNFSASNPPL--NWSFSTDCC--FWEGIKCDSKA---RVTHLWLPYRGLSG--SI 52
           + LL +     NP    +W  +TDCC   W G+ CD+     RV +L L    L     I
Sbjct: 9   QALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI 68

Query: 53  YPFIGNLTHLCHLNLSHNHLSGPLAINSFSFVIHLETLDLSYNSFSGQFLSSFFQLAENL 112
              + NL +L  L +   +        + + +  L  L +++ + SG       Q  + L
Sbjct: 69  PSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQ-IKTL 127

Query: 113 ITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGNCSKLQTFRAGFN 172
           +TL+ S+N  SG++P   S       +L  + F  N  SG +P   G+ SKL T      
Sbjct: 128 VTLDFSYNALSGTLPPSISSL----PNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISR 183

Query: 173 YLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGK 232
               +     + A            +    +  +      +     +          +G 
Sbjct: 184 N-RLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGL 242

Query: 233 LTNLKSLQLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGN 292
             NL  L L  N + G LPQ L     L +LN+  NN  G++       L         N
Sbjct: 243 SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP--QGGNLQRFDVSAYAN 300

Query: 293 NNFTGSFPL 301
           N      PL
Sbjct: 301 NKCLCGSPL 309


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query638
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.22
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=7.6e-33  Score=275.43  Aligned_cols=276  Identities=30%  Similarity=0.447  Sum_probs=211.6

Q ss_pred             ccCCCCCCCCCCCCCCcC--ccceEECC---CCCeEEEECCCCCcee--eccccCcCCCCCCEEECCC-CCCCCCCcccc
Q 038036            9 FSASNPPLNWSFSTDCCF--WEGIKCDS---KARVTHLWLPYRGLSG--SIYPFIGNLTHLCHLNLSH-NHLSGPLAINS   80 (638)
Q Consensus         9 ~~~~~~~~~w~~~~~~~~--w~g~~c~~---~~~v~~L~l~~~~~~~--~~~~~l~~l~~L~~L~Ls~-n~l~~~~~~~~   80 (638)
                      +.+.+.+.+|..+.|||.  |.||.|+.   ..||++|+|+++++.+  .+|++++++++|++|+|++ |.++|.+|.. 
T Consensus        18 ~~~~~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~-   96 (313)
T d1ogqa_          18 LGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPA-   96 (313)
T ss_dssp             TTCCGGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGG-
T ss_pred             CCCCCcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccc-
Confidence            677778999998999994  99999985   3489999999999887  5789999999999999986 7888888865 


Q ss_pred             ccccceecEEEcCCccccccccHHHHhcCCCCcEEEcccCcCcccCCCccccCCCCCCCcCEEEccCCcCCccCCccCCC
Q 038036           81 FSFVIHLETLDLSYNSFSGQFLSSFFQLAENLITLNVSHNMFSGSIPSFTSWNNKSLSSLKILDFSYNDFSGQLPPGLGN  160 (638)
Q Consensus        81 ~~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~l~~L~~L~ls~n~i~~~~~~~l~~  160 (638)
                      |.++++|++|+|++|++.+..+. .+..+..|+++++++|.+.+.+|..+.    +++.++++++++|.+.+.+|..+..
T Consensus        97 i~~L~~L~~L~Ls~N~l~~~~~~-~~~~~~~L~~l~l~~N~~~~~~p~~l~----~l~~L~~l~l~~n~l~~~ip~~~~~  171 (313)
T d1ogqa_          97 IAKLTQLHYLYITHTNVSGAIPD-FLSQIKTLVTLDFSYNALSGTLPPSIS----SLPNLVGITFDGNRISGAIPDSYGS  171 (313)
T ss_dssp             GGGCTTCSEEEEEEECCEEECCG-GGGGCTTCCEEECCSSEEESCCCGGGG----GCTTCCEEECCSSCCEEECCGGGGC
T ss_pred             cccccccchhhhccccccccccc-cccchhhhcccccccccccccCchhhc----cCcccceeecccccccccccccccc
Confidence            56788888888888888855544 445577888888888877776665544    6778888888888887777777777


Q ss_pred             CCCC-cEEEcccccccccCCccccCCCCCCEEEccCCCCccccCccccCCCCCCEEEeecCcCcccCCcccCCCCCCCEE
Q 038036          161 CSKL-QTFRAGFNYLSGSIPDDISAATSLQEISLPGNQLSGAISDGVGNLTSLSMLDLQSNKFSGLIPQDIGKLTNLKSL  239 (638)
Q Consensus       161 l~~L-~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L  239 (638)
                      +..+ +.++++.|++++..|..+..+..+ .+++.++...+..|..+..+++++.++++++.+.+.++ .+..+++|+.|
T Consensus       172 l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L  249 (313)
T d1ogqa_         172 FSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGL  249 (313)
T ss_dssp             CCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEE
T ss_pred             ccccccccccccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccc-ccccccccccc
Confidence            6665 677778887777777776665443 67777777777777777777777788777777765543 56667777777


Q ss_pred             EccCCCCCCCcchhhcCCCCCcEEEccCcccccccCcccccCCCCccEEecCCCc
Q 038036          240 QLHTNSLSGFLPQSLMNCTNLITLNLRINNFRGDLSAYNFSTLHNLHTIDLGNNN  294 (638)
Q Consensus       240 ~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~l~~n~  294 (638)
                      ++++|++++.+|..++++++|+.|+|++|+++|.+|  .+..+++|+.+++++|+
T Consensus       250 ~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP--~~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         250 DLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP--QGGNLQRFDVSAYANNK  302 (313)
T ss_dssp             ECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECC--CSTTGGGSCGGGTCSSS
T ss_pred             cCccCeecccCChHHhCCCCCCEEECcCCcccccCC--CcccCCCCCHHHhCCCc
Confidence            777777777777777777777777777777776666  34566667777777765



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure