Citrus Sinensis ID: 038042

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MGCLFKLPCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFMLPDDQLPYIFRLTQKI
cccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccEEEEccccccEEEEEEEEEEEEEEEEccccEEEEEEccccccccccccccccccccccccccccEEEEccEEEEEEEccccHHHHHHHcccccccccccEEEEccc
cccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHcEEEEEEEccEEEEcccccccccEccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHEEEEcccc
mgclfklpcglniithantltplhsLVLHQVFDRIDEHFLNAMLDLLKlvpytersilvhegsgveKMFFIVRGkiwsepttirtttfsfnasndghfcgeellprasvlqlgglpistrtviahtPVEAFVIEADDWKQLVnsfmlpddqlpYIFRLTQKI
MGCLFKLPCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILvhegsgveKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSfmlpddqlpyifrltqki
MGCLFKLPCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFMLPDDQLPYIFRLTQKI
**CLFKLPCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFMLPDDQLPYIFRL****
**C****PCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQ*****ISTRTVIAHTPVEAFVIEADDWKQLVNSFMLPDDQLPYIFRLTQ*I
MGCLFKLPCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFMLPDDQLPYIFRLTQKI
*GCLFKLPCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFMLPDDQLPYIFRLTQK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCLFKLPCGLNIITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFMLPDDQLPYIFRLTQKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q9LD40696 Putative cyclic nucleotid yes no 0.783 0.182 0.454 3e-17
O65717716 Cyclic nucleotide-gated i no no 0.753 0.170 0.437 4e-17
Q9LNJ0 711 Probable cyclic nucleotid no no 0.783 0.178 0.431 5e-17
Q9M0A4733 Putative cyclic nucleotid no no 0.783 0.173 0.431 7e-16
O82226747 Probable cyclic nucleotid no no 0.783 0.170 0.416 2e-15
Q9FXH6 753 Putative cyclic nucleotid no no 0.790 0.169 0.412 3e-15
Q9S9N5 738 Putative cyclic nucleotid no no 0.790 0.173 0.404 1e-14
Q9SL29678 Putative cyclic nucleotid no no 0.759 0.181 0.419 6e-14
Q9SKD6621 Cyclic nucleotide-gated i no no 0.753 0.196 0.425 6e-14
Q9SKD7706 Probable cyclic nucleotid no no 0.771 0.177 0.415 8e-14
>sp|Q9LD40|CNG13_ARATH Putative cyclic nucleotide-gated ion channel 13 OS=Arabidopsis thaliana GN=CNGC13 PE=3 SV=2 Back     alignment and function desciption
 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 31  VFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSF 90
           +F+ +DE  L+A+ D LK V YTE S  + EG  VE+M F++RGK+ S  T    T F F
Sbjct: 474 LFEIMDEQLLDAVCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGF-F 532

Query: 91  NAS--NDGHFCGEELLPRASVLQLGG-LPISTRTVIAHTPVEAFVIEADDWKQLVNSF-M 146
           NA       FCGE+LL  A   Q     PISTRTV A T VEAF + ADD K + + F  
Sbjct: 533 NAVYLKPSDFCGEDLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRR 592

Query: 147 LPDDQLPYIFRL 158
           L   QL + FR 
Sbjct: 593 LHSKQLQHTFRF 604
Putative cyclic nucleotide-gated ion channel.
Arabidopsis thaliana (taxid: 3702)
>sp|O65717|CNGC1_ARATH Cyclic nucleotide-gated ion channel 1 OS=Arabidopsis thaliana GN=CNGC1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LNJ0|CNG10_ARATH Probable cyclic nucleotide-gated ion channel 10 OS=Arabidopsis thaliana GN=CNGC10 PE=2 SV=2 Back     alignment and function description
>sp|Q9M0A4|CNGC9_ARATH Putative cyclic nucleotide-gated ion channel 9 OS=Arabidopsis thaliana GN=CNGC9 PE=1 SV=1 Back     alignment and function description
>sp|O82226|CNGC6_ARATH Probable cyclic nucleotide-gated ion channel 6 OS=Arabidopsis thaliana GN=CNGC6 PE=1 SV=2 Back     alignment and function description
>sp|Q9FXH6|CNGC8_ARATH Putative cyclic nucleotide-gated ion channel 8 OS=Arabidopsis thaliana GN=CNGC8 PE=3 SV=2 Back     alignment and function description
>sp|Q9S9N5|CNGC7_ARATH Putative cyclic nucleotide-gated ion channel 7 OS=Arabidopsis thaliana GN=CNGC7 PE=2 SV=1 Back     alignment and function description
>sp|Q9SL29|CNG15_ARATH Putative cyclic nucleotide-gated ion channel 15 OS=Arabidopsis thaliana GN=CNGC15 PE=3 SV=1 Back     alignment and function description
>sp|Q9SKD6|CNG11_ARATH Cyclic nucleotide-gated ion channel 11 OS=Arabidopsis thaliana GN=CNGC11 PE=2 SV=2 Back     alignment and function description
>sp|Q9SKD7|CNGC3_ARATH Probable cyclic nucleotide-gated ion channel 3 OS=Arabidopsis thaliana GN=CNGC3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
449497318 714 PREDICTED: cyclic nucleotide-gated ion c 0.759 0.172 0.463 7e-18
449456377 713 PREDICTED: cyclic nucleotide-gated ion c 0.759 0.172 0.463 7e-18
2058454233 CaMB-channel protein [Nicotiana tabacum] 0.790 0.549 0.450 6e-17
224064230 717 predicted protein [Populus trichocarpa] 0.703 0.158 0.470 8e-17
356551532 718 PREDICTED: cyclic nucleotide-gated ion c 0.759 0.171 0.448 9e-17
255545024 838 Cyclic nucleotide-gated ion channel, put 0.759 0.146 0.448 1e-16
356509281 715 PREDICTED: cyclic nucleotide-gated ion c 0.759 0.172 0.448 2e-16
356516029 715 PREDICTED: cyclic nucleotide-gated ion c 0.759 0.172 0.441 2e-16
224118210 709 predicted protein [Populus trichocarpa] 0.759 0.173 0.441 2e-16
225462733 709 PREDICTED: cyclic nucleotide-gated ion c 0.790 0.180 0.435 2e-16
>gi|449497318|ref|XP_004160370.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 81/136 (59%), Gaps = 13/136 (9%)

Query: 31  VFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSF 90
           +F+++DE  L+AM D LK V YTE S +V EG  V++M FI+RGK+ S  T    T F F
Sbjct: 483 IFEKMDEQLLDAMCDRLKPVLYTEESYIVREGDPVDEMIFIMRGKLLSVTTNGGRTGF-F 541

Query: 91  NAS--NDGHFCGEELL-----PRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVN 143
           N+     G FCGEELL     P +S      LPISTRTV   + VEAF ++ADD K + +
Sbjct: 542 NSEHLKAGDFCGEELLTWALDPHSS----SNLPISTRTVRTLSEVEAFALKADDLKFVAS 597

Query: 144 SF-MLPDDQLPYIFRL 158
            F  L   QL + FRL
Sbjct: 598 QFRRLHSKQLRHTFRL 613

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449456377|ref|XP_004145926.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|2058454|gb|AAB53255.1| CaMB-channel protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224064230|ref|XP_002301407.1| predicted protein [Populus trichocarpa] gi|222843133|gb|EEE80680.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356551532|ref|XP_003544128.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255545024|ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547481|gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356509281|ref|XP_003523379.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356516029|ref|XP_003526699.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224118210|ref|XP_002317760.1| predicted protein [Populus trichocarpa] gi|222858433|gb|EEE95980.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225462733|ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera] gi|302143681|emb|CBI22542.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2125206696 CNGC13 "cyclic nucleotide-gate 0.777 0.181 0.458 9.7e-18
TAIR|locus:2163776716 CNGC1 "cyclic nucleotide gated 0.777 0.175 0.442 3.5e-17
TAIR|locus:2118836733 CNGC9 "cyclic nucleotide gated 0.777 0.171 0.435 5.5e-16
TAIR|locus:2061401747 CNGC6 "cyclic nucleotide-gated 0.777 0.168 0.419 1.2e-15
TAIR|locus:2013139 753 CNGC8 "cyclic nucleotide gated 0.783 0.168 0.415 3.3e-15
TAIR|locus:2200502 738 CNGC7 "cyclic nucleotide gated 0.783 0.172 0.407 8.5e-15
TAIR|locus:2062814678 CNGC15 "cyclic nucleotide-gate 0.753 0.179 0.422 4.2e-14
TAIR|locus:2039084706 CNGC3 "cyclic nucleotide gated 0.765 0.175 0.410 4.4e-14
TAIR|locus:2174448717 CNGC5 "cyclic nucleotide gated 0.777 0.175 0.404 4.6e-14
TAIR|locus:2039099621 CNGC11 "cyclic nucleotide-gate 0.746 0.194 0.428 7.6e-14
TAIR|locus:2125206 CNGC13 "cyclic nucleotide-gated channel 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 226 (84.6 bits), Expect = 9.7e-18, P = 9.7e-18
 Identities = 60/131 (45%), Positives = 75/131 (57%)

Query:    31 VFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSF 90
             +F+ +DE  L+A+ D LK V YTE S  + EG  VE+M F++RGK+ S  T    T F F
Sbjct:   474 LFEIMDEQLLDAVCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGF-F 532

Query:    91 NAS--NDGHFCGEELLPRASVLQLGG-LPISTRTVIAHTPVEAFVIEADDWKQLVNSFM- 146
             NA       FCGE+LL  A   Q     PISTRTV A T VEAF + ADD K + + F  
Sbjct:   533 NAVYLKPSDFCGEDLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRR 592

Query:   147 LPDDQLPYIFR 157
             L   QL + FR
Sbjct:   593 LHSKQLQHTFR 603
GO:0005216 "ion channel activity" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006811 "ion transport" evidence=IEA
GO:0030551 "cyclic nucleotide binding" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005516 "calmodulin binding" evidence=ISS
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0045087 "innate immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2163776 CNGC1 "cyclic nucleotide gated channel 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118836 CNGC9 "cyclic nucleotide gated channel 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061401 CNGC6 "cyclic nucleotide-gated channel 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013139 CNGC8 "cyclic nucleotide gated channel 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200502 CNGC7 "cyclic nucleotide gated channel 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062814 CNGC15 "cyclic nucleotide-gated channel 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039084 CNGC3 "cyclic nucleotide gated channel 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174448 CNGC5 "cyclic nucleotide gated channel 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039099 CNGC11 "cyclic nucleotide-gated channels" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 5e-08
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 6e-05
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 8e-05
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 9e-05
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 48.5 bits (116), Expect = 5e-08
 Identities = 22/115 (19%), Positives = 45/115 (39%), Gaps = 14/115 (12%)

Query: 31  VFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKI---WSEPTTIRTTT 87
           +F  +D+  L  + D L+   +    +++ +G   + ++ ++ G +     +        
Sbjct: 1   LFSGLDDEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSVEVYKLDEDGREQIV 60

Query: 88  FSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLV 142
                   G   GE  L       LG  P  + TV A T  E  V+   D+++L+
Sbjct: 61  GFLGP---GDLFGELAL-------LGNGP-RSATVRALTDSELLVLPRSDFRRLL 104

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
KOG0498 727 consensus K+-channel ERG and related proteins, con 99.89
KOG0500536 consensus Cyclic nucleotide-gated cation channel C 99.83
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.82
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.81
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.75
cd00038115 CAP_ED effector domain of the CAP family of transc 99.73
KOG0499 815 consensus Cyclic nucleotide-gated cation channel C 99.73
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.72
PLN02868 413 acyl-CoA thioesterase family protein 99.7
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.69
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.69
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.67
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.67
COG2905 610 Predicted signal-transduction protein containing c 99.63
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.56
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.55
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.52
KOG1113 368 consensus cAMP-dependent protein kinase types I an 99.52
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.48
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.41
KOG1113368 consensus cAMP-dependent protein kinase types I an 99.31
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 99.21
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 98.54
PF04831153 Popeye: Popeye protein conserved region; InterPro: 98.34
PRK11832207 putative DNA-binding transcriptional regulator; Pr 98.07
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 98.05
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 97.75
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 96.08
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 93.6
PRK13290125 ectC L-ectoine synthase; Reviewed 90.26
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 88.91
COG1917131 Uncharacterized conserved protein, contains double 81.5
smart00835146 Cupin_1 Cupin. This family represents the conserve 80.11
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.89  E-value=2.9e-24  Score=183.88  Aligned_cols=147  Identities=33%  Similarity=0.388  Sum_probs=130.1

Q ss_pred             ccccCCcCce--eeeeccccchHhhhhhCccccccCHHHHHHHHhhceeeeecCCCEEEecCCccCeEEEEEeeEEEEee
Q 038042            3 CLFKLPCGLN--IITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEP   80 (162)
Q Consensus         3 ~~~~lp~~~~--~~~~~~~~~~~~~L~~~~lF~~l~~~~l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~v~~   80 (162)
                      .|..||+.||  |++|    .++++++++|+|+++|+..+.+|+..++...|++|++|++|||+.+.||||.+|.+++..
T Consensus       400 lL~~LP~~LR~dI~~h----L~~~lv~~vpLF~~md~~~L~al~~rlk~~~f~pge~iireGd~v~~myFI~rG~le~~~  475 (727)
T KOG0498|consen  400 LLQSLPKDLRRDIKRH----LCLDLVRKVPLFAGMDDGLLDALCSRLKPEYFTPGEYIIREGDPVTDMYFIVRGSLESIT  475 (727)
T ss_pred             HHHhCCHHHHHHHHHH----HhHHHHhhCchhhcCCHHHHHHHHHHhhhhccCCCCeEEecCCccceeEEEEeeeEEEEE
Confidence            4788999999  9999    889999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCceeeeeeeeCCCCeee-cccccCccccccCCCCcceeEEEecceeEEEEEeHHHHHHHHhhCC-CCCCchhHHHhh
Q 038042           81 TTIRTTTFSFNASNDGHFCG-EELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFM-LPDDQLPYIFRL  158 (162)
Q Consensus        81 ~~~~~~~~~~~~~~~G~~~G-e~~l~~~~~~~~~~~~~~~~tv~a~~~~~l~~i~~~~~~~l~~~~p-~~~~~l~~~~~~  158 (162)
                      .+|. .......++|||+|| |......      .. |++.||+|.|.|+++.+++++|..+++++| +.+++++..++.
T Consensus       476 ~~~g-~~~~~~~L~~Gd~~GeEl~~~~~------~~-p~t~TVralt~~el~~L~~~dL~~V~~~f~~~~~~~l~~~~r~  547 (727)
T KOG0498|consen  476 TDGG-GFFVVAILGPGDFFGEELLTWCL------DL-PQTRTVRALTYCELFRLSADDLKEVLQQFRRLGSKFLQHTFRY  547 (727)
T ss_pred             ccCC-ceEEEEEecCCCccchHHHHHHh------cC-CCCceeehhhhhhHHhccHHHHHHHHHHhHHHHHHHHHhHHHH
Confidence            8754 333457899999999 5444322      02 568999999999999999999999999999 888888888887


Q ss_pred             hcc
Q 038042          159 TQK  161 (162)
Q Consensus       159 ~~~  161 (162)
                      +++
T Consensus       548 ~s~  550 (727)
T KOG0498|consen  548 YSH  550 (727)
T ss_pred             hhh
Confidence            764

>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1wgp_A137 Solution Structure Of The Cnmp-Binding Domain From 6e-16
>pdb|1WGP|A Chain A, Solution Structure Of The Cnmp-Binding Domain From Arabidopsis Thaliana Cyclic Nucleotide-Regulated Ion Channel Length = 137 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 4/118 (3%)
Query: 31  VFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSF 90
           +F+ +DE  L+A+ + LK   +TE+S LV EG  V +M FI+RG++ S  T    + F +
Sbjct: 13  LFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGF-Y 71
Query: 91  NAS--NDGHFCGEELLPRASVLQLGG-LPISTRTVIAHTPVEAFVIEADDWKQLVNSF 145
           N S   +G FCG+ELL  A   + G  LP STRTV A T VEAF + AD+ K + + F
Sbjct: 72  NRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQF 129

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 5e-23
3ukn_A212 Novel protein similar to vertebrate potassium VOL 3e-18
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 2e-17
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 2e-17
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 4e-16
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 1e-08
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 2e-07
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 3e-05
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 1e-06
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 3e-06
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 4e-05
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 5e-06
4din_B381 CAMP-dependent protein kinase type I-beta regulat 1e-05
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 2e-05
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 2e-05
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 2e-05
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 4e-05
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 4e-05
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 6e-05
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 6e-05
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 7e-05
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 8e-05
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 1e-04
2pqq_A149 Putative transcriptional regulator; APC7345, strep 1e-04
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 2e-04
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 2e-04
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 3e-04
1ft9_A222 Carbon monoxide oxidation system transcription reg 4e-04
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 5e-04
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
 Score = 87.6 bits (217), Expect = 5e-23
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 2/116 (1%)

Query: 32  FDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTIRTTTFSFN 91
           F+ +DE  L+A+ + LK   +TE+S LV EG  V +M FI+RG++ S  T    + F   
Sbjct: 14  FENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNR 73

Query: 92  AS-NDGHFCGEELLPRASVLQLGG-LPISTRTVIAHTPVEAFVIEADDWKQLVNSF 145
           +   +G FCG+ELL  A   + G  LP STRTV A T VEAF + AD+ K + + F
Sbjct: 74  SLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQF 129
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.92
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.91
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.9
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.9
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.89
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.89
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.89
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.89
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.88
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.87
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.87
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.87
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.86
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.86
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.86
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.86
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.85
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.85
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.85
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.85
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.85
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.85
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.84
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.84
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.83
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.83
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.82
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.81
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.81
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.8
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.8
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.8
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.79
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.79
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.79
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.79
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.78
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.78
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.77
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.77
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.76
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.76
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.75
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.75
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.71
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.71
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.69
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.69
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.68
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.62
3b02_A195 Transcriptional regulator, CRP family; structural 99.55
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.42
3rns_A227 Cupin 2 conserved barrel domain protein; structura 93.88
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 91.45
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 90.3
3lwc_A119 Uncharacterized protein; structural genomics, unkn 88.92
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 87.05
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 85.88
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 85.77
3rns_A227 Cupin 2 conserved barrel domain protein; structura 85.56
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 84.48
3h8u_A125 Uncharacterized conserved protein with double-STR 83.99
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 83.59
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 83.14
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 82.69
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 81.64
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 80.99
3bcw_A123 Uncharacterized protein; structural genomics, join 80.35
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 80.24
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
Probab=99.92  E-value=2.8e-25  Score=163.75  Aligned_cols=142  Identities=16%  Similarity=0.239  Sum_probs=122.8

Q ss_pred             cccCCcCce--eeeeccccchHhhhhhCccccccCHHHHHHHHhhceeeeecCCCEEEecCCccCeEEEEEeeEEEEeee
Q 038042            4 LFKLPCGLN--IITHANTLTPLHSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPT   81 (162)
Q Consensus         4 ~~~lp~~~~--~~~~~~~~~~~~~L~~~~lF~~l~~~~l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~v~~~   81 (162)
                      |..||+.|+  |..+    .+.++|+++|+|.+++++++..++..++...|++|++|+++|+.++.+|||.+|.|+++..
T Consensus        53 l~~l~~~Lr~~i~~~----~~~~~l~~~~~f~~l~~~~l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~~~~~  128 (198)
T 2ptm_A           53 FREVSESIRQDVANY----NCRDLVASVPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMS  128 (198)
T ss_dssp             HHHSCHHHHHHHHHH----HTHHHHHHCGGGTTCCHHHHHHHHHHCEEEEECTTCEEECTTSCCSEEEEEEECCEEEECT
T ss_pred             HHHcCHHHHHHHHHH----HHHHHHhcCcchhcCCHHHHHHHHHhccceeeCCCCEEEECCCcCcEEEEEEeCEEEEEec
Confidence            567899999  6666    6789999999999999999999999999999999999999999999999999999999986


Q ss_pred             cCCceeeeeeeeCCCCeeecccccCccccccCCCCcceeEEEecceeEEEEEeHHHHHHHHhhCC-CCCCchhHHHhhhc
Q 038042           82 TIRTTTFSFNASNDGHFCGEELLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFM-LPDDQLPYIFRLTQ  160 (162)
Q Consensus        82 ~~~~~~~~~~~~~~G~~~Ge~~l~~~~~~~~~~~~~~~~tv~a~~~~~l~~i~~~~~~~l~~~~p-~~~~~l~~~~~~~~  160 (162)
                      +|+  .  ...+++|++||+.+++.+.        ++++++.|.++|+++.+++++|.+++.++| +....++...+++.
T Consensus       129 ~g~--~--~~~l~~G~~fGe~~~~~~~--------~~~~~~~a~~~~~l~~i~~~~f~~ll~~~p~~~~~~~~~~~~rl~  196 (198)
T 2ptm_A          129 DGV--I--ATSLSDGSYFGEICLLTRE--------RRVASVKCETYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRLT  196 (198)
T ss_dssp             TSC--E--EEEECTTCEESCHHHHHSS--------CCSSEEEESSCEEEEEEEHHHHHHHHHHCHHHHHHHHHHHHTCC-
T ss_pred             CCe--E--EEEecCCCEechHHHcCCC--------ccceEEEEeeEEEEEEEeHHHHHHHHHHChHHHHHHHHHHHHHHh
Confidence            664  2  3679999999998877543        788999999999999999999999999999 55555555555554


Q ss_pred             c
Q 038042          161 K  161 (162)
Q Consensus       161 ~  161 (162)
                      +
T Consensus       197 ~  197 (198)
T 2ptm_A          197 R  197 (198)
T ss_dssp             -
T ss_pred             c
Confidence            4
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 3e-09
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 1e-04
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 2e-04
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 2e-04
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 50.7 bits (120), Expect = 3e-09
 Identities = 44/117 (37%), Positives = 66/117 (56%), Gaps = 2/117 (1%)

Query: 31  VFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIW-SEPTTIRTTTFS 89
           +F+ +DE  L+A+ + LK   +TE+S LV EG  V +M FI+RG++        R+  ++
Sbjct: 13  LFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYN 72

Query: 90  FNASNDGHFCGEE-LLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSF 145
            +   +G FCG+E L           LP STRTV A T VEAF + AD+ K + + F
Sbjct: 73  RSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQF 129
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.91
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.9
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.9
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.9
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.9
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.89
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.89
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.89
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.88
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.87
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.86
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.83
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.83
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.83
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.82
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.78
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.73
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 95.43
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 93.93
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 93.43
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 90.3
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 88.88
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 86.62
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 86.49
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 85.83
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 85.48
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 85.44
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 84.63
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 84.04
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 83.91
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 82.84
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 80.66
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.91  E-value=7.2e-25  Score=150.85  Aligned_cols=121  Identities=14%  Similarity=0.230  Sum_probs=105.8

Q ss_pred             hhhhhCccccccCHHHHHHHHhhceeeeecCCCEEEecCCccCeEEEEEeeEEEEeeecC-CceeeeeeeeCCCCeeecc
Q 038042           24 HSLVLHQVFDRIDEHFLNAMLDLLKLVPYTERSILVHEGSGVEKMFFIVRGKIWSEPTTI-RTTTFSFNASNDGHFCGEE  102 (162)
Q Consensus        24 ~~L~~~~lF~~l~~~~l~~l~~~~~~~~~~~ge~I~~~G~~~~~ly~I~~G~v~v~~~~~-~~~~~~~~~~~~G~~~Ge~  102 (162)
                      ++|+++|+|++|+++++.+|++.++.+.|++|++|+++|+.++++|+|.+|.|+++..++ ....+....+++|++||+.
T Consensus         2 ~~L~~i~~f~~L~~~~~~~l~~~~~~~~~~~g~~I~~~Gd~~~~~yii~~G~v~~~~~~~~~~~~~~~~~~~~g~~fG~~   81 (132)
T d1ne6a2           2 EFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEI   81 (132)
T ss_dssp             HHHHTSGGGGGSCHHHHHHHHHHCEEEEECTTCEEECTTSCCCEEEEEEECCEEEEEESSSSCCEEEEEEECTTCEECHH
T ss_pred             hhHhCCHhhhCCCHHHHHHHHHhCEEEEECCCCEEEEcCCcchHHHHHHhhhheeeccCCccccchhhhhccccceeeEe
Confidence            689999999999999999999999999999999999999999999999999999987643 2223334689999999998


Q ss_pred             cccCccccccCCCCcceeEEEecceeEEEEEeHHHHHHHHhhCC-CCCCch
Q 038042          103 LLPRASVLQLGGLPISTRTVIAHTPVEAFVIEADDWKQLVNSFM-LPDDQL  152 (162)
Q Consensus       103 ~l~~~~~~~~~~~~~~~~tv~a~~~~~l~~i~~~~~~~l~~~~p-~~~~~l  152 (162)
                      +++.+.        +++++++|.++|+++.|++++|.+++.++| +..+.+
T Consensus        82 ~~~~~~--------~~~~t~~a~~~~~~~~i~~~~~~~ll~~~p~~~~~~i  124 (132)
T d1ne6a2          82 ALLMNR--------PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNI  124 (132)
T ss_dssp             HHHHTS--------SCSSEEEESSCEEEEEEEHHHHHHHTGGGHHHHHHGG
T ss_pred             eecCCC--------ceeEEEEEcccEEEEEEEHHHHHHHHHHCHHHHHHHH
Confidence            887543        778899999999999999999999999999 443333
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure