Citrus Sinensis ID: 038108


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-------
MCLVYVCSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELYH
cEEEEEccccEEEEEEEcccccccccccEEEEEEEccEEEEEEEEEEEEEEEEEEEEccccEEEEcc
cEEEEEEccccEEEccccccccccccccEEEEEEcccHHEEEEcHHHHHcccEEHHHHHHHHEEEcc
MCLVYVCSEEERelgrqqapgscpycggkvlaidfesqcrfcflpicyniKKKYFCSLCSRRLELYH
MCLVYVCSEEErelgrqqapgscpYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELYH
MCLVYVCSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELYH
**LVYVC*************GSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLE***
MCLVYV*SEEE***********CPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELYH
MCLVYVCSE*********APGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELYH
MCLVYVCSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELYH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLVYVCSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRLELYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
25560208467 conserved hypothetical protein [Ricinus 1.0 1.0 0.776 2e-22
22414430868 predicted protein [Populus trichocarpa] 1.0 0.985 0.761 2e-22
22409050567 predicted protein [Populus trichocarpa] 0.970 0.970 0.753 7e-22
38850537267 unknown [Lotus japonicus] 1.0 1.0 0.701 4e-21
35654832169 PREDICTED: uncharacterized protein LOC10 0.985 0.956 0.727 8e-21
35655442368 PREDICTED: uncharacterized protein LOC10 0.955 0.941 0.718 9e-21
35656186966 PREDICTED: uncharacterized protein LOC10 0.970 0.984 0.692 2e-20
357449639104 hypothetical protein MTR_2g038220 [Medic 1.0 0.644 0.671 7e-20
38851041669 unknown [Lotus japonicus] 1.0 0.971 0.656 2e-19
35747949968 hypothetical protein MTR_4g127190 [Medic 1.0 0.985 0.671 2e-19
>gi|255602084|ref|XP_002537812.1| conserved hypothetical protein [Ricinus communis] gi|223514986|gb|EEF24571.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/67 (77%), Positives = 59/67 (88%)

Query: 1  MCLVYVCSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS 60
          MCLV++C EEERELGRQQAPGSCPYCGGKV A+D E +  FCFLPICY IK+K+FCSLC+
Sbjct: 1  MCLVFLCEEEERELGRQQAPGSCPYCGGKVEAMDVERKWSFCFLPICYKIKRKFFCSLCA 60

Query: 61 RRLELYH 67
          RRLEL H
Sbjct: 61 RRLELCH 67




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224144308|ref|XP_002325255.1| predicted protein [Populus trichocarpa] gi|222866689|gb|EEF03820.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224090505|ref|XP_002309004.1| predicted protein [Populus trichocarpa] gi|222854980|gb|EEE92527.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388505372|gb|AFK40752.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356548321|ref|XP_003542551.1| PREDICTED: uncharacterized protein LOC100527565 [Glycine max] gi|356562056|ref|XP_003549291.1| PREDICTED: uncharacterized protein LOC100795948 [Glycine max] gi|255632626|gb|ACU16663.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356554423|ref|XP_003545546.1| PREDICTED: uncharacterized protein LOC100813676 [Glycine max] Back     alignment and taxonomy information
>gi|356561869|ref|XP_003549199.1| PREDICTED: uncharacterized protein LOC100800541 [Glycine max] Back     alignment and taxonomy information
>gi|357449639|ref|XP_003595096.1| hypothetical protein MTR_2g038220 [Medicago truncatula] gi|87162672|gb|ABD28467.1| hypothetical protein MtrDRAFT_AC148819g4v2 [Medicago truncatula] gi|355484144|gb|AES65347.1| hypothetical protein MTR_2g038220 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388510416|gb|AFK43274.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357479499|ref|XP_003610035.1| hypothetical protein MTR_4g127190 [Medicago truncatula] gi|355511090|gb|AES92232.1| hypothetical protein MTR_4g127190 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
TAIR|locus:50495485967 AT5G57123 "AT5G57123" [Arabido 1.0 1.0 0.686 2.3e-23
TAIR|locus:50495549767 AT4G29905 "AT4G29905" [Arabido 1.0 1.0 0.626 8e-21
TAIR|locus:50500659467 AT5G10695 [Arabidopsis thalian 0.940 0.940 0.539 2e-17
TAIR|locus:282749768 AT2G20835 "AT2G20835" [Arabido 0.940 0.926 0.301 5.5e-06
TAIR|locus:451510307568 AT3G15534 "AT3G15534" [Arabido 0.985 0.970 0.272 1.9e-05
TAIR|locus:100623068468 AT1G52855 "AT1G52855" [Arabido 0.985 0.970 0.272 3e-05
TAIR|locus:504954859 AT5G57123 "AT5G57123" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 269 (99.8 bits), Expect = 2.3e-23, P = 2.3e-23
 Identities = 46/67 (68%), Positives = 53/67 (79%)

Query:     1 MCLVYVCSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCS 60
             MCLV +C EEE ELGRQQAPGSCPYCGGKV  +D E +  FCF+P+C+ IK+KY CS C 
Sbjct:     1 MCLVCLCDEEETELGRQQAPGSCPYCGGKVQMLDVERKWMFCFVPLCFKIKRKYSCSSCD 60

Query:    61 RRLELYH 67
             RRL LYH
Sbjct:    61 RRLVLYH 67




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:504955497 AT4G29905 "AT4G29905" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006594 AT5G10695 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827497 AT2G20835 "AT2G20835" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103075 AT3G15534 "AT3G15534" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230684 AT1G52855 "AT1G52855" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 67
PF1300547 zf-IS66: zinc-finger binding domain of transposase 95.07
PF1060173 zf-LITAF-like: LITAF-like zinc ribbon domain; Inte 94.93
PRK00464 154 nrdR transcriptional regulator NrdR; Validated 94.12
PF1469047 zf-ISL3: zinc-finger of transposase IS204/IS1001/I 93.9
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 93.58
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 92.87
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 91.66
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 91.15
COG381384 Uncharacterized protein conserved in bacteria [Fun 91.12
PF1324826 zf-ribbon_3: zinc-ribbon domain 90.43
PF1324023 zinc_ribbon_2: zinc-ribbon domain 90.03
PF11672102 DUF3268: Protein of unknown function (DUF3268); In 89.97
smart0071467 LITAF Possible membrane-associated motif in LPS-in 89.4
TIGR0383146 YgiT_finger YgiT-type zinc finger domain. This dom 89.32
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 88.96
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 88.64
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 88.16
smart0066152 RPOL9 RNA polymerase subunit 9. 87.87
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 87.38
PF01927147 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 T 87.36
PF1436935 zf-RING_3: zinc-finger 87.18
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.08
PF0159947 Ribosomal_S27: Ribosomal protein S27a; InterPro: I 86.95
PRK0043250 30S ribosomal protein S27ae; Validated 86.67
COG0675364 Transposase and inactivated derivatives [DNA repli 85.96
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 85.75
PRK10445263 endonuclease VIII; Provisional 85.74
PRK14810272 formamidopyrimidine-DNA glycosylase; Provisional 85.35
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 84.91
PRK13945282 formamidopyrimidine-DNA glycosylase; Provisional 84.49
PRK00420112 hypothetical protein; Validated 84.26
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 82.4
PF1277350 DZR: Double zinc ribbon 82.22
PRK0967872 DNA-binding transcriptional regulator; Provisional 82.05
TIGR00577272 fpg formamidopyrimidine-DNA glycosylase (fpg). All 82.0
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 81.85
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 81.67
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 81.56
PRK01103274 formamidopyrimidine/5-formyluracil/ 5-hydroxymethy 81.0
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 80.59
PF1435461 Lar_restr_allev: Restriction alleviation protein L 80.52
>PF13005 zf-IS66: zinc-finger binding domain of transposase IS66 ; InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [] Back     alignment and domain information
Probab=95.07  E-value=0.049  Score=29.70  Aligned_cols=41  Identities=32%  Similarity=0.688  Sum_probs=29.2

Q ss_pred             CCCCCCCCcceEEEEec-eeeeEEEeeeEeeec----ceEEecccc
Q 038108           20 PGSCPYCGGKVLAIDFE-SQCRFCFLPICYNIK----KKYFCSLCS   60 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dve-s~~rfCflP~~~k~k----r~~~Ct~C~   60 (67)
                      +.+||.||+.+.-+-.+ .+-.|=++|.-+...    -+|.|+-|+
T Consensus         2 ~~~C~~Cg~~l~~ig~~~~~q~l~~~p~~~~V~e~~~~~y~C~~C~   47 (47)
T PF13005_consen    2 PRACPDCGGELKEIGEEKVRQVLDLPPAKPEVTEHVRHKYACPCCG   47 (47)
T ss_pred             CCcCCCCCceeeECCceeeEEEEeecccceEEEEEEeceEECCCCC
Confidence            56899999999866555 556666778666543    367777775



>PF10601 zf-LITAF-like: LITAF-like zinc ribbon domain; InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF14690 zf-ISL3: zinc-finger of transposase IS204/IS1001/IS1096/IS1165 Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF11672 DUF3268: Protein of unknown function (DUF3268); InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150 Back     alignment and domain information
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins Back     alignment and domain information
>TIGR03831 YgiT_finger YgiT-type zinc finger domain Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PF01927 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 This prokaryotic family of proteins have no known function Back     alignment and domain information
>PF14369 zf-RING_3: zinc-finger Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF01599 Ribosomal_S27: Ribosomal protein S27a; InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK10445 endonuclease VIII; Provisional Back     alignment and domain information
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg) Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 93.5
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 92.05
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 91.3
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 89.18
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 87.73
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 85.89
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 82.94
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 82.69
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 81.86
1k3x_A262 Endonuclease VIII; hydrolase/DNA, hydrolase-DNA co 80.79
2xzf_A271 Formamidopyrimidine-DNA glycosylase; hydrolase-DNA 80.24
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
Probab=93.50  E-value=0.038  Score=31.66  Aligned_cols=38  Identities=21%  Similarity=0.535  Sum_probs=25.9

Q ss_pred             cCCceeeeeeecCCCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEecccccee
Q 038108            7 CSEEERELGRQQAPGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLCSRRL   63 (67)
Q Consensus         7 cde~~kv~~~~~ApG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C~r~L   63 (67)
                      +|+ +++.+.   --.||.||.++..            .   ++..++.|..|+-..
T Consensus         9 v~~-gki~~~---~~fCPkCG~~~~m------------a---~~~dr~~C~kCgyt~   46 (55)
T 2k4x_A            9 IAD-GKLVRK---HRFCPRCGPGVFL------------A---EHADRYSCGRCGYTE   46 (55)
T ss_dssp             CCC-CCCCCS---SCCCTTTTTTCCC------------E---ECSSEEECTTTCCCE
T ss_pred             EcC-CEEEEc---cccCcCCCCceeE------------e---ccCCEEECCCCCCEE
Confidence            455 666542   4679999987722            1   445699999998653



>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>1k3x_A Endonuclease VIII; hydrolase/DNA, hydrolase-DNA complex; HET: BRU PED; 1.25A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1k3w_A* 1q39_A 2ea0_A* 2oq4_A* 1q3c_A 2opf_A* 1q3b_A* Back     alignment and structure
>2xzf_A Formamidopyrimidine-DNA glycosylase; hydrolase-DNA complex; HET: VET; 1.80A {Lactococcus lactis subsp} PDB: 1pm5_A* 1xc8_A* 1pji_A* 2xzu_A* 3c58_A* 1tdz_A* 1nnj_A 1kfv_A 1pjj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
d1k3xa340 Endonuclease VIII {Escherichia coli [TaxId: 562]} 91.06
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 91.01
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 89.65
d1k82a344 DNA repair protein MutM (Fpg) {Escherichia coli [T 87.68
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 85.84
d1tdza347 DNA repair protein MutM (Fpg) {Lactococcus lactis 85.24
d1r2za346 DNA repair protein MutM (Fpg) {Bacillus stearother 83.48
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 80.23
>d1k3xa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: C-terminal, Zn-finger domain of MutM-like DNA repair proteins
domain: Endonuclease VIII
species: Escherichia coli [TaxId: 562]
Probab=91.06  E-value=0.09  Score=27.19  Aligned_cols=27  Identities=26%  Similarity=0.698  Sum_probs=20.4

Q ss_pred             CCCCCCCCcceEEEEeceeeeEEEeeeEeeecceEEeccc
Q 038108           20 PGSCPYCGGKVLAIDFESQCRFCFLPICYNIKKKYFCSLC   59 (67)
Q Consensus        20 pG~Cp~CGG~v~a~Dves~~rfCflP~~~k~kr~~~Ct~C   59 (67)
                      .-.|++||+.|.-+.+..             .+.|+|+.|
T Consensus        12 g~pC~~C~~~I~~~~~~g-------------R~t~~Cp~C   38 (40)
T d1k3xa3          12 GEPCERCGSIIEKTTLSS-------------RPFYWCPGC   38 (40)
T ss_dssp             TSBCTTTCCBCEEEEETT-------------EEEEECTTT
T ss_pred             CCccCcCCCEEEEEEECC-------------CCCEEChhh
Confidence            345999999999998864             355667666



>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1k82a3 g.39.1.8 (A:225-268) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tdza3 g.39.1.8 (A:225-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r2za3 g.39.1.8 (A:229-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure