Citrus Sinensis ID: 038187

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560
MAAASSVSRLVVIIILINVGAKSDTTISVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLCVDGNNFE
cccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccHHHHccccccccccccccccccccccccEEccccccEEEEEEEEccccccEEEccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEEEccccEEccccccccccccccEEcccccccccccHHcccccccccccccccccEEcccHHHHccccccEEEcccccccccccccccccccccEEEccccEEEEcccccccccccccEEEccccEEEEcccHHHHccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEccccccccccccHHHcccccccEEEcccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccEEEEEcccccEEEEEEEEcccccccccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEccccccc
MAAASSVSRLVVIIILINvgaksdttISVTASAAAGLLSSPIQLERKALLgtgwwvnngatsgnytsnhckwtgiscnsagsvTGVSLLLYEndnikgelgrfnfscfpnlkkmgrlrnlvhldlsdnyiegyilptlghlsklenlnlssnaldgnipstlghltrLTTLAIasnqinssipleienlnflQVLDLsrneiggsipstlgHLKRLRSLDLSlnelvgpipsslghlteltffniysnringsipleignfnFLQVLDLsynklegpipstiANLVNLTSLflcnnsqtgfipstlghlnrltsldlsgnnlvgpipssmghlarlttfdmhsnringsipleignfnFLQVLDLsynklegpipsTIASLVNLTSLflcnnsqtgfipstlghlnrltsldlsgnnlvgpipssvghltqlttfdmhsnringsipleignlkhVEDVYLfnnkldgpippqllncsRLRALSLSnnllsgsipseigkLKELYYLDLsqnfingkipsqlgeipsidtvnlctnnlygsipeslrkvpslcvdgnnfe
maaassvsRLVVIIILInvgaksdttISVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLygsipeslrkvpslcvdgnnfe
MaaassvsrlvviiiliNVGAKSDTTISVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHlsklenlnlssnalDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQllncsrlralslsnnllsgsIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLCVDGNNFE
*******SRLVVIIILINVGAKSDTTISVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLC*******
***********VIIILINVGAKSDTTISVTASAAAGLLSSPIQLER****************GNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLCVDGNNFE
********RLVVIIILINVGAKSDTTISVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLCVDGNNFE
****SSVSRLVVIIILINVGAKSDTTISVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLCVD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAASSVSRLVVIIILINVGAKSDTTISVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLCVDGNNFE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query560 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ yes no 0.835 0.374 0.393 2e-78
Q8VZG8 1045 Probable LRR receptor-lik no no 0.964 0.516 0.350 3e-76
Q9LP24 1120 Probable leucine-rich rep no no 0.880 0.440 0.376 1e-75
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.826 0.369 0.392 4e-75
Q9LHP4 1141 Receptor-like protein kin no no 0.783 0.384 0.383 1e-73
Q42371 976 LRR receptor-like serine/ no no 0.826 0.474 0.370 2e-72
Q9SHI2 1101 Leucine-rich repeat recep no no 0.912 0.464 0.350 4e-71
C0LGV1 1135 LRR receptor-like serine/ no no 0.783 0.386 0.368 4e-70
Q9LVP0 1102 Probable leucine-rich rep no no 0.798 0.405 0.368 6e-69
Q9FL28 1173 LRR receptor-like serine/ no no 0.766 0.365 0.383 2e-68
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  293 bits (751), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 189/480 (39%), Positives = 269/480 (56%), Gaps = 12/480 (2%)

Query: 68  NHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSD 127
           N+C WTG++C++ G    ++L      N+ G LG    S  P     GR  NL+HLDLS 
Sbjct: 56  NYCSWTGVTCDNTGLFRVIAL------NLTG-LG-LTGSISP---WFGRFDNLIHLDLSS 104

Query: 128 NYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIE 187
           N + G I   L +L+ LE+L L SN L G IPS LG L  + +L I  N++   IP  + 
Sbjct: 105 NNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLG 164

Query: 188 NLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYS 247
           NL  LQ+L L+   + G IPS LG L R++SL L  N L GPIP+ LG+ ++LT F    
Sbjct: 165 NLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAE 224

Query: 248 NRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLG 307
           N +NG+IP E+G    L++L+L+ N L G IPS +  +  L  L L  N   G IP +L 
Sbjct: 225 NMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLA 284

Query: 308 HLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNF-LQVLDLS 366
            L  L +LDLS NNL G IP    ++++L    + +N ++GS+P  I + N  L+ L LS
Sbjct: 285 DLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLS 344

Query: 367 YNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSV 426
             +L G IP  ++   +L  L L NNS  G IP  L  L  LT L L  N L G +  S+
Sbjct: 345 GTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSI 404

Query: 427 GHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLS 486
            +LT L    ++ N + G +P EI  L+ +E ++L+ N+  G IP ++ NC+ L+ + + 
Sbjct: 405 SNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMF 464

Query: 487 NNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESL 546
            N   G IP  IG+LKEL  L L QN + G +P+ LG    ++ ++L  N L GSIP S 
Sbjct: 465 GNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSF 524
Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
356577797 1204 PREDICTED: probable LRR receptor-like se 0.912 0.424 0.405 8e-93
224110038 964 predicted protein [Populus trichocarpa] 0.9 0.522 0.425 9e-92
224065673 964 predicted protein [Populus trichocarpa] 0.907 0.526 0.420 3e-90
224110020 1048 predicted protein [Populus trichocarpa] 0.930 0.497 0.400 1e-87
299470286 1527 LRR-GTPase of the ROCO family [Ectocarpu 0.751 0.275 0.440 1e-85
3894393 1016 Hcr2-5D [Solanum lycopersicum var. ceras 0.873 0.481 0.417 2e-85
3894383 968 disease resistance protein [Solanum lyco 0.866 0.501 0.409 2e-85
3894387 944 Hcr2-0B [Solanum lycopersicum] 0.866 0.513 0.403 7e-84
1184075 1112 Cf-2.1 [Solanum pimpinellifolium] gi|603 0.862 0.434 0.400 1e-83
60327196 1112 Cf-2.3 [Solanum pimpinellifolium] 0.862 0.434 0.400 1e-83
>gi|356577797|ref|XP_003557009.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
 Score =  347 bits (891), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 217/535 (40%), Positives = 318/535 (59%), Gaps = 24/535 (4%)

Query: 28  SVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHCKWTGISCNSAGSVTGVS 87
           S  AS A  LL     L+ ++      W      SGN   N C W GI+C+   SV+ ++
Sbjct: 31  SEIASEANALLKWKSSLDNQSRASLSSW------SGN---NPCIWLGIACDEFNSVSNIN 81

Query: 88  LLLYENDNIKGELGRFNFSCFPNLKKMGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENL 147
           L    N  ++G L   NFS  PN+         + L++S N + G I P +G LSKL  L
Sbjct: 82  L---TNVGLRGTLQNLNFSLLPNI---------LTLNMSHNSLNGTIPPQIGSLSKLARL 129

Query: 148 NLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIP 207
           +LS N L G IPST+G+L+ L  L+   N ++ +IP  I NL  L  + L +N++ GSIP
Sbjct: 130 DLSDNFLSGEIPSTIGNLSNLYYLSFYDNSLSGAIPSSIGNLVNLDSMILHKNKLSGSIP 189

Query: 208 STLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVL 267
             +G+L +L  L +  NEL GPIP+S+G+L  +    +Y N+++GSIP  IGN + L  L
Sbjct: 190 FIIGNLSKLSVLSIYSNELTGPIPTSIGNLVNMDSLLLYENKLSGSIPFTIGNLSKLSGL 249

Query: 268 DLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIP 327
            +S N+L GPIP++I NLVNL ++ L  N  +G IP  +G+L++L+ L +  N L GPIP
Sbjct: 250 YISLNELTGPIPASIGNLVNLEAMRLFKNKLSGSIPFNIGNLSKLSKLSIHSNELTGPIP 309

Query: 328 SSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSL 387
           +S+G+L  L +  +H N+++GSIP  IGN +   VL +S+N+L GPIP++I +LV+L SL
Sbjct: 310 ASIGNLVNLDSMILHKNKLSGSIPFIIGNLSKFSVLSISFNELTGPIPASIGNLVHLDSL 369

Query: 388 FLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIP 447
            L  N  +G IP T+G+L++L+ L +S N L GPIP+S+G+L  L    +  N+++GSIP
Sbjct: 370 LLEENKLSGSIPFTIGNLSKLSGLYISLNELTGPIPASIGNLVNLEAMRLFKNKLSGSIP 429

Query: 448 LEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYL 507
             IGNL  +  + + +N+L GPIP  + N   L +L L  N LSGSIP  IG L +L  L
Sbjct: 430 FTIGNLSKLSKLSIHSNELTGPIPASIGNLVHLDSLLLEENKLSGSIPFTIGNLSKLSVL 489

Query: 508 DLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIP---ESLRKVPSLCVDGNNF 559
            +S N + G IPS +G + ++  +    N L G IP     L  + SL +  NNF
Sbjct: 490 SISLNELTGSIPSTIGNLSNVRELFFIGNELGGKIPIEMSMLTALESLQLADNNF 544

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224110038|ref|XP_002333164.1| predicted protein [Populus trichocarpa] gi|222835017|gb|EEE73466.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224065673|ref|XP_002301914.1| predicted protein [Populus trichocarpa] gi|222843640|gb|EEE81187.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110020|ref|XP_002333160.1| predicted protein [Populus trichocarpa] gi|222835013|gb|EEE73462.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|299470286|emb|CBN79590.1| LRR-GTPase of the ROCO family [Ectocarpus siliculosus] Back     alignment and taxonomy information
>gi|3894393|gb|AAC78596.1| Hcr2-5D [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
>gi|3894383|gb|AAC78591.1| disease resistance protein [Solanum lycopersicum var. cerasiforme] Back     alignment and taxonomy information
>gi|3894387|gb|AAC78593.1| Hcr2-0B [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|1184075|gb|AAC15779.1| Cf-2.1 [Solanum pimpinellifolium] gi|60327192|gb|AAX19019.1| Cf-2.1 [Solanum pimpinellifolium] gi|1587673|prf||2207203A Cf-2 gene Back     alignment and taxonomy information
>gi|60327196|gb|AAX19021.1| Cf-2.3 [Solanum pimpinellifolium] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query560
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.923 0.461 0.351 4.5e-74
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.917 0.411 0.351 1.2e-71
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.828 0.370 0.370 3.3e-71
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.787 0.386 0.359 9.9e-68
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.848 0.486 0.347 2.1e-67
TAIR|locus:2182855 967 ERL2 "ERECTA-like 2" [Arabidop 0.892 0.517 0.328 5e-67
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.862 0.462 0.335 1.1e-65
TAIR|locus:2167948 966 ERL1 "ERECTA-like 1" [Arabidop 0.837 0.485 0.336 1.7e-65
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.835 0.416 0.348 7.8e-65
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.832 0.427 0.336 1.4e-64
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 752 (269.8 bits), Expect = 4.5e-74, P = 4.5e-74
 Identities = 190/541 (35%), Positives = 266/541 (49%)

Query:    28 SVTASAAAGLLSSPIQLERKALLGTGWWVNNGATSGNYTSNHC-KWTGISCNSAGSVTGV 86
             S T + A  LL         + L +  WV++  T+   TS  C  W G+SCNS GS+  +
Sbjct:    28 SATIAEANALLKWKSTFTNSSKLSS--WVHDANTN---TSFSCTSWYGVSCNSRGSIEEL 82

Query:    87 SLLLYENDNIKGELGRFNFSCFPNLK---------------KMGRLRNLVHLDLSDNYIE 131
             +L    N  I+G    F F    NL                + G L  L++ DLS N++ 
Sbjct:    83 NLT---NTGIEGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLT 139

Query:   132 GYILPTLGHXXXXXXXXXXXXXXDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNF 191
             G I P+LG+                 IPS LG++  +T LA++ N++  SIP  + NL  
Sbjct:   140 GEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKN 199

Query:   192 LQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRIN 251
             L VL L  N + G IP  LG+++ +  L LS N+L G IPS+LG+L  L    +Y N + 
Sbjct:   200 LMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLT 259

Query:   252 GSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNR 311
             G IP EIGN   +  L LS NKL G IPS++ NL NLT L L  N  TG IP  LG++  
Sbjct:   260 GVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIES 319

Query:   312 LTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLE 371
             +  L+LS N L G IPSS+G+L  LT   ++ N + G IP E+GN   +  L L+ NKL 
Sbjct:   320 MIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLT 379

Query:   372 GPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQ 431
             G IPS+  +L NLT L+L  N  TG IP  LG++  + +LDLS N L G +P S G+ T+
Sbjct:   380 GSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTK 439

Query:   432 LTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQXXXXXXXXXXXXXXXXXX 491
             L +  +  N ++G+IP  + N  H+  + L  N   G  P                    
Sbjct:   440 LESLYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLE 499

Query:   492 XXIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPS 551
               IP  +   K L       N   G I    G  P ++ ++   N  +G I  +  K P 
Sbjct:   500 GPIPKSLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPK 559

Query:   552 L 552
             L
Sbjct:   560 L 560
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182855 ERL2 "ERECTA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_395000005
hypothetical protein (964 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-81
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-45
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  272 bits (698), Expect = 4e-81
 Identities = 186/530 (35%), Positives = 268/530 (50%), Gaps = 43/530 (8%)

Query: 61  TSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKKM------ 114
           ++ N +++ C W GI+CN++  V  + L      NI G++    F   P ++ +      
Sbjct: 49  SNWNSSADVCLWQGITCNNSSRVVSIDL---SGKNISGKISSAIFR-LPYIQTINLSNNQ 104

Query: 115 --------------------------------GRLRNLVHLDLSDNYIEGYILPTLGHLS 142
                                           G + NL  LDLS+N + G I   +G  S
Sbjct: 105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFS 164

Query: 143 KLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEI 202
            L+ L+L  N L G IP++L +LT L  L +ASNQ+   IP E+  +  L+ + L  N +
Sbjct: 165 SLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNL 224

Query: 203 GGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFN 262
            G IP  +G L  L  LDL  N L GPIPSSLG+L  L +  +Y N+++G IP  I +  
Sbjct: 225 SGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQ 284

Query: 263 FLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNL 322
            L  LDLS N L G IP  +  L NL  L L +N+ TG IP  L  L RL  L L  N  
Sbjct: 285 KLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKF 344

Query: 323 VGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLV 382
            G IP ++G    LT  D+ +N + G IP  + +   L  L L  N LEG IP ++ +  
Sbjct: 345 SGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACR 404

Query: 383 NLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRI 442
           +L  + L +NS +G +PS    L  +  LD+S NNL G I S    +  L    +  N+ 
Sbjct: 405 SLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKF 464

Query: 443 NGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLK 502
            G +P   G+ K +E++ L  N+  G +P +L + S L  L LS N LSG IP E+   K
Sbjct: 465 FGGLPDSFGS-KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCK 523

Query: 503 ELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSL 552
           +L  LDLS N ++G+IP+   E+P +  ++L  N L G IP++L  V SL
Sbjct: 524 KLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESL 573

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 560
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PLN03150623 hypothetical protein; Provisional 99.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
PLN03150623 hypothetical protein; Provisional 99.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.15
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.39
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.01
PRK15386 426 type III secretion protein GogB; Provisional 97.93
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PRK15386 426 type III secretion protein GogB; Provisional 97.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.75
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.74
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.67
KOG4341483 consensus F-box protein containing LRR [General fu 97.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.41
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.39
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.37
KOG4341483 consensus F-box protein containing LRR [General fu 97.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.12
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.84
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.79
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.48
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.32
KOG4308 478 consensus LRR-containing protein [Function unknown 95.66
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.05
KOG4308 478 consensus LRR-containing protein [Function unknown 94.69
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.7
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.03
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.61
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.72
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.86
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.17
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.07
smart0037026 LRR Leucine-rich repeats, outliers. 87.07
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.8e-63  Score=563.10  Aligned_cols=510  Identities=35%  Similarity=0.549  Sum_probs=328.3

Q ss_pred             HHHHHHHcCCCCC--CCCC-CCCCCCCCCccccceecCCCCCeEEEeccccCCCCceeecCCCCccccccccc-------
Q 038187           44 LERKALLGTGWWV--NNGA-TSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFNFSCFPNLKK-------  113 (560)
Q Consensus        44 ~~~~~ll~~~~~~--~~~~-~~~~~~~~~C~w~gv~C~~~~~v~~l~l~~~~~~~~~~~~~~~~~~~~~~~~~-------  113 (560)
                      .|+.||+.++...  +.+. .+|+.+.|||.|.||+|+..++|+.++++   ++.+.|.+++ .+..++.++.       
T Consensus        29 ~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~---~~~i~~~~~~-~~~~l~~L~~L~Ls~n~  104 (968)
T PLN00113         29 EELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSSRVVSIDLS---GKNISGKISS-AIFRLPYIQTINLSNNQ  104 (968)
T ss_pred             HHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCCCCcEEEEEec---CCCccccCCh-HHhCCCCCCEEECCCCc
Confidence            6888888775433  2222 34555678999999999888899999998   6666665544 3322222110       


Q ss_pred             ---------cCCCCCccEEECcCCCCCCcCccccCCCCCCCEEECCCCCCCCCCCcCCCCCCCCCEEeCcCCcCCcCCcc
Q 038187          114 ---------MGRLRNLVHLDLSDNYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPL  184 (560)
Q Consensus       114 ---------l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~  184 (560)
                               +..+++|++|++++|.+++.+|.  +.+++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|.
T Consensus       105 ~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~  182 (968)
T PLN00113        105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN  182 (968)
T ss_pred             cCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCCh
Confidence                     22445555555555555443332  2344455555555555555555555555555555555555555555


Q ss_pred             cCCCCCCCCEEEcccCCCCccCccccCCCCCCCEEeCCCCcccccCCccccCCCCCCEEEeecCcCCccCcccccCCCCC
Q 038187          185 EIENLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFL  264 (560)
Q Consensus       185 ~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L  264 (560)
                      .+.++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|
T Consensus       183 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  262 (968)
T PLN00113        183 SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNL  262 (968)
T ss_pred             hhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCC
Confidence            55555555555555555554555555555555555555555554455555555555555555555444444444444445


Q ss_pred             CEEECcCC------------------------CCcCCccccccCCCCCCEEECcCCCCccccCcccCCCCCCCEEEccCC
Q 038187          265 QVLDLSYN------------------------KLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGN  320 (560)
Q Consensus       265 ~~L~L~~n------------------------~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n  320 (560)
                      ++|++++|                        .+.+.+|..+.++++|+.|++++|.+.+..|..+..+++|+.|++++|
T Consensus       263 ~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n  342 (968)
T PLN00113        263 QYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSN  342 (968)
T ss_pred             CEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCC
Confidence            55555444                        444444444444455555555555554444444555555555555555


Q ss_pred             cCcccCCccccCCCCCCEEEccCCcccccCCcCccCCCCCCEEEeecCcCcCCCchhccCCCCCCEEeccCCcccccCcc
Q 038187          321 NLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPS  400 (560)
Q Consensus       321 ~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~  400 (560)
                      .+.+.+|..++.+++|+.|++++|++.+.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++.+|.
T Consensus       343 ~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~  422 (968)
T PLN00113        343 KFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS  422 (968)
T ss_pred             CCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECCh
Confidence            55555555555555555555555555555555555555555555555555556666666667777777777777766666


Q ss_pred             cccCCCCCCEEECcCCcccccCCccccCCCCCCEEEccCCcCcccCCccccCCCCCCeeecccCcccccCchhhhcCCCC
Q 038187          401 TLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSRL  480 (560)
Q Consensus       401 ~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L  480 (560)
                      .+..+++|+.|++++|.+++.+|..+..+++|+.|++++|++.+.+|..+ ..++|+.|++++|++++.+|..+..+++|
T Consensus       423 ~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L  501 (968)
T PLN00113        423 EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSEL  501 (968)
T ss_pred             hHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhcc
Confidence            67777777777777777777777666677777777777777777666654 34778888888888888888889999999


Q ss_pred             CeeeCccCcccccChhhhhcCcCCCeeeCcCCcCccccCccCCCCCCCCEEeCCCCcCccccCccCCCCCCee---eecc
Q 038187          481 RALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLC---VDGN  557 (560)
Q Consensus       481 ~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~ls~n~l~~~ip~~~~~l~~l~---l~~n  557 (560)
                      +.|++++|++++.+|..+.++++|+.|++++|.++|.+|..+..+++|+.||+++|+++|.+|..+.++++|.   +++|
T Consensus       502 ~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N  581 (968)
T PLN00113        502 MQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHN  581 (968)
T ss_pred             CEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999877765554   8988


Q ss_pred             cCC
Q 038187          558 NFE  560 (560)
Q Consensus       558 ~~~  560 (560)
                      +++
T Consensus       582 ~l~  584 (968)
T PLN00113        582 HLH  584 (968)
T ss_pred             cce
Confidence            864

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-40
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-37
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-40
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-37
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-21
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 5e-12
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-12
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-12
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-11
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-11
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-10
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-10
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 8e-09
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 2e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-05
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 8e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 9e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-04
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 4e-04
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 5e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-04
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  162 bits (409), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 153/522 (29%), Positives = 226/522 (43%), Gaps = 58/522 (11%)
Query: 79  SAGSVTGVSLLLYENDNIKGELGRFNFSC--FPNLKKMGRLRNLVHLDLSDNYIEGYILP 136
           SA S++G +++ +   +  GEL     S         + R  NL  LD+S N     I P
Sbjct: 156 SANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGI-P 214
Query: 137 TLGHXXXXXXXXXXXXXXDGNIPSTLGHLTRLTTLAIASNQINSSIP-LEIENLNFLQVL 195
            LG                G+    +   T L  L I+SNQ    IP L +++L   Q L
Sbjct: 215 FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSL---QYL 271
Query: 196 DLSRNEIGGSIPSTL-GHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSI 254
            L+ N+  G IP  L G    L  LDLS N   G +P   G  + L    + SN  +G +
Sbjct: 272 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 331
Query: 255 PLE-IGNFNFLQVLDLSYNKLEGPIPSTIANLV--------------------------- 286
           P++ +     L+VLDLS+N+  G +P ++ NL                            
Sbjct: 332 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 391
Query: 287 NLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNRI 346
            L  L+L NN  TG IP TL + + L SL LS N L G IPSS+G L++L    +  N +
Sbjct: 392 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML 451
Query: 347 NGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIPSTLGHLN 406
            G IP E+     L+ L L +N L G IPS +++  NL  + L NN  TG IP  +G L 
Sbjct: 452 EGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLE 511
Query: 407 RLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGN---------LKHVE 457
            L  L LS N+  G IP+ +G    L   D+++N  NG+IP  +           +    
Sbjct: 512 NLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKR 571
Query: 458 DVYLFNNKLDGPIPPQXXXXXXXXXXXXXXXXXXXXIPSEIGKL-------------KEL 504
            VY+ N+ +                            P  I                  +
Sbjct: 572 YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM 631
Query: 505 YYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESL 546
            +LD+S N ++G IP ++G +P +  +NL  N++ GSIP+ +
Sbjct: 632 MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEV 673
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query560
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-131
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-125
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-123
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-122
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-67
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-81
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-77
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-77
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-80
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-73
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-71
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-63
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-73
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-71
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-56
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-69
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-68
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-66
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-59
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-47
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-59
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-55
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-54
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-58
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-57
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-57
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-56
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-48
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-52
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-49
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-35
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-48
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-47
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-46
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-43
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-43
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-42
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-44
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-42
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-39
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-42
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-42
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-41
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-42
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-40
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-40
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-41
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-38
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-36
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-40
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-40
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-34
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-39
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-39
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-37
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-35
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-30
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-32
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-31
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-31
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-32
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-23
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-31
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-28
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-28
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-26
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-31
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-29
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-25
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-29
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-29
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-29
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  400 bits (1030), Expect = e-131
 Identities = 155/524 (29%), Positives = 247/524 (47%), Gaps = 39/524 (7%)

Query: 66  TSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGELGRFN--FSCFPNLKK---------- 113
             N C + G++C     VT + L    +  +       +        L+           
Sbjct: 36  NKNPCTFDGVTCRD-DKVTSIDLS---SKPLNVGFSAVSSSLLSLTGLESLFLSNSHING 91

Query: 114 ----MGRLRNLVHLDLSDNYIEGYI--LPTLGHLSKLENLNLSSNALDGNIP-STLGHLT 166
                    +L  LDLS N + G +  L +LG  S L+ LN+SSN LD     S    L 
Sbjct: 92  SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLN 151

Query: 167 RLTTLAIASNQINSSIPLEIE---NLNFLQVLDLSRNEIGGSIPSTLGHLKRLRSLDLSL 223
            L  L +++N I+ +  +          L+ L +S N+I G +   +     L  LD+S 
Sbjct: 152 SLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSS 209

Query: 224 NELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIA 283
           N     IP  LG  + L   +I  N+++G     I     L++L++S N+  GPIP    
Sbjct: 210 NNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--L 266

Query: 284 NLVNLTSLFLCNNSQTGFIPSTL-GHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMH 342
            L +L  L L  N  TG IP  L G  + LT LDLSGN+  G +P   G  + L +  + 
Sbjct: 267 PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALS 326

Query: 343 SNRINGSIPLE-IGNFNFLQVLDLSYNKLEGPIPSTIASL-VNLTSLFLCNNSQTGFIPS 400
           SN  +G +P++ +     L+VLDLS+N+  G +P ++ +L  +L +L L +N+ +G I  
Sbjct: 327 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP 386

Query: 401 TLGH--LNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVED 458
            L     N L  L L  N   G IP ++ + ++L +  +  N ++G+IP  +G+L  + D
Sbjct: 387 NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 446

Query: 459 VYLFNNKLDGPIPPQLLNCSRLRALSLSNNLLSGSIPSEIGKLKELYYLDLSQNFINGKI 518
           + L+ N L+G IP +L+    L  L L  N L+G IPS +     L ++ LS N + G+I
Sbjct: 447 LKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEI 506

Query: 519 PSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSLCV---DGNNF 559
           P  +G + ++  + L  N+  G+IP  L    SL     + N F
Sbjct: 507 PKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLF 550
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.98
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.0
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.82
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-69  Score=597.86  Aligned_cols=513  Identities=30%  Similarity=0.485  Sum_probs=370.8

Q ss_pred             cHHHHHHHHcCCCCCC--CCCCCCCCCCCCccccceecCCCCCeEEEeccccCCCCceee---cCCCCcccccc------
Q 038187           42 IQLERKALLGTGWWVN--NGATSGNYTSNHCKWTGISCNSAGSVTGVSLLLYENDNIKGE---LGRFNFSCFPN------  110 (560)
Q Consensus        42 ~~~~~~~ll~~~~~~~--~~~~~~~~~~~~C~w~gv~C~~~~~v~~l~l~~~~~~~~~~~---~~~~~~~~~~~------  110 (560)
                      .+.||+||+++|....  ....+|..+.|||.|.||+|+ .++|+.++++   +..+.|.   +++ .+..+..      
T Consensus        10 ~~~~~~all~~k~~~~~~~~l~~W~~~~~~C~w~gv~C~-~~~v~~L~L~---~~~l~g~~~~l~~-~l~~L~~L~~l~~   84 (768)
T 3rgz_A           10 LYREIHQLISFKDVLPDKNLLPDWSSNKNPCTFDGVTCR-DDKVTSIDLS---SKPLNVGFSAVSS-SLLSLTGLESLFL   84 (768)
T ss_dssp             HHHHHHHHHHHHTTCSCTTSSTTCCTTSCGGGSTTEEEE-TTEEEEEECT---TSCCCEEHHHHHH-HTTTCTTCCEEEC
T ss_pred             CHHHHHHHHHHHhhCCCcccccCCCCCCCCcCCcceEEC-CCcEEEEECC---CCCcCCccCccCh-hHhccCcccccCC
Confidence            4679999998876443  223455567899999999998 7899999998   6667776   432 1111110      


Q ss_pred             --------ccccCCCCCccEEECcCCCCCCcCcc--ccCCCCCCCEEECCCCCCCCCCCcCC------------------
Q 038187          111 --------LKKMGRLRNLVHLDLSDNYIEGYILP--TLGHLSKLENLNLSSNALDGNIPSTL------------------  162 (560)
Q Consensus       111 --------~~~l~~l~~L~~L~L~~n~l~~~~~~--~l~~l~~L~~L~L~~n~~~~~~~~~~------------------  162 (560)
                              ...+.++++|++|++++|.+.+.+|.  .++++++|++|++++|.+.+.+|..+                  
T Consensus        85 ~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~  164 (768)
T 3rgz_A           85 SNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSIS  164 (768)
T ss_dssp             TTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCE
T ss_pred             cCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccC
Confidence                    02345555555555555555554444  44444444444444444333333221                  


Q ss_pred             --------------------------------CCCCCCCEEeCcCCcCCcCCcccCCCCCCCCEEEcccCCCCccCcccc
Q 038187          163 --------------------------------GHLTRLTTLAIASNQINSSIPLEIENLNFLQVLDLSRNEIGGSIPSTL  210 (560)
Q Consensus       163 --------------------------------~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l  210 (560)
                                                      ..+++|++|++++|.+.+.+|. ++++++|++|++++|.+++.+|..+
T Consensus       165 ~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l  243 (768)
T 3rgz_A          165 GANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI  243 (768)
T ss_dssp             EETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT
T ss_pred             CcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH
Confidence                                            2233344444444444433333 5555555555555555555444444


Q ss_pred             CCCCCCCEEeCCC----------------------CcccccCCccccCC-CCCCEEEeecCcCCccCcccccCCCCCCEE
Q 038187          211 GHLKRLRSLDLSL----------------------NELVGPIPSSLGHL-TELTFFNIYSNRINGSIPLEIGNFNFLQVL  267 (560)
Q Consensus       211 ~~l~~L~~L~L~~----------------------n~l~~~~~~~l~~l-~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L  267 (560)
                      ..+++|++|++++                      |.+++.+|..+... ++|++|++++|.+++.+|..++.+++|++|
T Consensus       244 ~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L  323 (768)
T 3rgz_A          244 STCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESL  323 (768)
T ss_dssp             TTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEE
T ss_pred             hcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEE
Confidence            4444444444443                      33444555555553 777777777777777777777777777777


Q ss_pred             ECcCCCCcCCcccc-ccCCCCCCEEECcCCCCccccCcc-------------------------cCC--CCCCCEEEccC
Q 038187          268 DLSYNKLEGPIPST-IANLVNLTSLFLCNNSQTGFIPST-------------------------LGH--LNRLTSLDLSG  319 (560)
Q Consensus       268 ~L~~n~l~~~~~~~-l~~l~~L~~L~l~~n~~~~~~~~~-------------------------l~~--l~~L~~L~l~~  319 (560)
                      ++++|.+.+.+|.. +..+++|++|++++|.+++.+|..                         +..  +++|++|++++
T Consensus       324 ~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~  403 (768)
T 3rgz_A          324 ALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN  403 (768)
T ss_dssp             ECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCS
T ss_pred             ECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCC
Confidence            77777776666654 666666666666666655444443                         333  55677777777


Q ss_pred             CcCcccCCccccCCCCCCEEEccCCcccccCCcCccCCCCCCEEEeecCcCcCCCchhccCCCCCCEEeccCCcccccCc
Q 038187          320 NNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIASLVNLTSLFLCNNSQTGFIP  399 (560)
Q Consensus       320 n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~  399 (560)
                      |.+.+.+|..++.+++|++|++++|.+++.+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+++.+|
T Consensus       404 n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p  483 (768)
T 3rgz_A          404 NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP  483 (768)
T ss_dssp             SEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             CccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCC
Confidence            77777778888888888888888888888888888888899999999999888888888889999999999999998888


Q ss_pred             ccccCCCCCCEEECcCCcccccCCccccCCCCCCEEEccCCcCcccCCccccCCCCCCeeecccCcccccCchhhhc---
Q 038187          400 STLGHLNRLTSLDLSGNNLVGPIPSSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLN---  476 (560)
Q Consensus       400 ~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~---  476 (560)
                      ..+..+++|++|++++|++++.+|.+++.+++|++|++++|++++.+|..+..+++|++|++++|+++|.+|..+..   
T Consensus       484 ~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~  563 (768)
T 3rgz_A          484 SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG  563 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTT
T ss_pred             HHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccc
Confidence            88999999999999999999899999999999999999999999999999999999999999999988877765432   


Q ss_pred             -------------------------------------------------------------------CCCCCeeeCccCc
Q 038187          477 -------------------------------------------------------------------CSRLRALSLSNNL  489 (560)
Q Consensus       477 -------------------------------------------------------------------~~~L~~L~Ls~n~  489 (560)
                                                                                         +++|+.||+++|+
T Consensus       564 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~  643 (768)
T 3rgz_A          564 KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM  643 (768)
T ss_dssp             CBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSC
T ss_pred             hhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCc
Confidence                                                                               4678899999999


Q ss_pred             ccccChhhhhcCcCCCeeeCcCCcCccccCccCCCCCCCCEEeCCCCcCccccCccCCCCCCe---eeecccCC
Q 038187          490 LSGSIPSEIGKLKELYYLDLSQNFINGKIPSQLGEIPSIDTVNLCTNNLYGSIPESLRKVPSL---CVDGNNFE  560 (560)
Q Consensus       490 l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~ls~n~l~~~ip~~~~~l~~l---~l~~n~~~  560 (560)
                      ++|.+|.+++++++|+.|+|++|+++|.+|..++.+++|+.|||++|+++|.||..++++++|   ++++|+++
T Consensus       644 l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~  717 (768)
T 3rgz_A          644 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS  717 (768)
T ss_dssp             CBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEE
T ss_pred             ccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCccc
Confidence            999999999999999999999999999999999999999999999999999999987766555   49999863
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 560
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-23
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-12
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-12
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 6e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 6e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score =  102 bits (254), Expect = 3e-24
 Identities = 81/393 (20%), Positives = 143/393 (36%), Gaps = 51/393 (12%)

Query: 141 LSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLE-IENLNFLQVLDLSR 199
           L++     L    +   +  +   L ++TTL      I S   ++ +E LN L  ++ S 
Sbjct: 21  LAEKMKTVLGKTNVTDTV--SQTDLDQVTTLQADRLGIKS---IDGVEYLNNLTQINFSN 75

Query: 200 NEIGGSIPSTLGHLKRLRSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIG 259
           N++    P  L +L +L  + ++ N++    P             +       +    + 
Sbjct: 76  NQLTDITP--LKNLTKLVDILMNNNQIADITP----LANLTNLTGLTLFNNQITDIDPLK 129

Query: 260 NFNFLQVLDLSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSG 319
           N   L  L+LS N +      +    +   S              T              
Sbjct: 130 NLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLD-------I 182

Query: 320 NNLVGPIPSSMGHLARLTTFDMHSNRINGSIPLEIGNFNFLQVLDLSYNKLEGPIPSTIA 379
           ++      S +  L  L +    +N+I+   P  +G    L  L L+ N+L+     T+A
Sbjct: 183 SSNKVSDISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI--GTLA 238

Query: 380 SLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIP---------------- 423
           SL NLT L L NN  +   P  L  L +LT L L  N +    P                
Sbjct: 239 SLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQ 296

Query: 424 ----SSVGHLTQLTTFDMHSNRINGSIPLEIGNLKHVEDVYLFNNKLDGPIPPQLLNCSR 479
               S + +L  LT   ++ N I+   P  + +L  ++ ++  NNK+       L N + 
Sbjct: 297 LEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSDV--SSLANLTN 352

Query: 480 LRALSLSNNLLSGSIPSEIGKLKELYYLDLSQN 512
           +  LS  +N +S   P  +  L  +  L L+  
Sbjct: 353 INWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query560
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.47
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.97
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.53
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.41
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=3.2e-38  Score=309.44  Aligned_cols=290  Identities=28%  Similarity=0.423  Sum_probs=174.6

Q ss_pred             CccHHHHHHHHcCCCCCC--CCCCCCCCCCCCcc--ccceecCCC---CCeEEEeccccCCCCcee--ecCCCCcccccc
Q 038187           40 SPIQLERKALLGTGWWVN--NGATSGNYTSNHCK--WTGISCNSA---GSVTGVSLLLYENDNIKG--ELGRFNFSCFPN  110 (560)
Q Consensus        40 ~~~~~~~~~ll~~~~~~~--~~~~~~~~~~~~C~--w~gv~C~~~---~~v~~l~l~~~~~~~~~~--~~~~~~~~~~~~  110 (560)
                      -|.+.||+||+++|....  ....+|+.+.|||.  |.||+|+..   +||++++++   +.++.|  .+|+ .      
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~---~~~l~g~~~lp~-~------   71 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLS---GLNLPKPYPIPS-S------   71 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEE---CCCCSSCEECCG-G------
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECC---CCCCCCCCCCCh-H------
Confidence            488999999999875433  23456667889995  999999853   378888887   555554  2333 2      


Q ss_pred             ccccCCCCCccEEECcC-CCCCCcCccccCCCCCCCEEECCCCCCCCCCCcCCCCCCCCCEEeCcCCcCCcCCcccCCCC
Q 038187          111 LKKMGRLRNLVHLDLSD-NYIEGYILPTLGHLSKLENLNLSSNALDGNIPSTLGHLTRLTTLAIASNQINSSIPLEIENL  189 (560)
Q Consensus       111 ~~~l~~l~~L~~L~L~~-n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l  189 (560)
                         ++++++|++|+|++ |++.|.+|+.|+++++|++|+|++|.+.+..+..+..+.+|++++++.|.+.+.+|..+.++
T Consensus        72 ---l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l  148 (313)
T d1ogqa_          72 ---LANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSL  148 (313)
T ss_dssp             ---GGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGC
T ss_pred             ---HhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccC
Confidence               56666666666664 55666666666666666666666666666555556666666666666666655666666666


Q ss_pred             CCCCEEEcccCCCCccCccccCCCCCC-CEEeCCCCcccccCCccccCCCCCCEEEeecCcCCccCcccccCCCCCCEEE
Q 038187          190 NFLQVLDLSRNEIGGSIPSTLGHLKRL-RSLDLSLNELVGPIPSSLGHLTELTFFNIYSNRINGSIPLEIGNFNFLQVLD  268 (560)
Q Consensus       190 ~~L~~L~l~~n~~~~~~~~~l~~l~~L-~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~  268 (560)
                      ++|+++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..+..+ .+++..+...+.+|..+..++.++.++
T Consensus       149 ~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~  227 (313)
T d1ogqa_         149 PNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIH  227 (313)
T ss_dssp             TTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEE
T ss_pred             cccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccc
Confidence            666666666666665566555555544 556666666665555555544333 455555555555555555555555555


Q ss_pred             CcCCCCcCCccccccCCCCCCEEECcCCCCccccCcccCCCCCCCEEEccCCcCcccCCccccCCCCCCEEEccCCc
Q 038187          269 LSYNKLEGPIPSTIANLVNLTSLFLCNNSQTGFIPSTLGHLNRLTSLDLSGNNLVGPIPSSMGHLARLTTFDMHSNR  345 (560)
Q Consensus       269 L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~  345 (560)
                      ++++.+.+.++ .+..+++|+.|++++|+++|.+|+.++++++|++|++++|+++|.+|. ++.+++|+.+++++|+
T Consensus       228 ~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         228 LAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             ccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            55555554333 344455555555555555555555555555555555555555555553 3445555555555554
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure