Citrus Sinensis ID: 038204

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
VVQDDSACFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELHAEKMLEGSSSNLRKYDTL
cccccccEEcccHHHccccccEEEEEcccccEEEcccccccccccccccccEEEccccccccEEcccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHcccccccccccccc
ccccccccccHHHHHHcccccEEEEEcccEEEEEEccccccccccccHHHcEEEHcccHHHHHHHccccccccccccccEEEEcccccccEccccccEEccccEEEEEEccccHHHcccHHHHHHHHHHcEEEEcccHHHEEEEEccccccccEEEcccccEEEEcccccccHccccccccccccccEEEEEccccEEEEcccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHccccccEEHccc
vvqddsacfplgllekFRNLEILYLSRTSYTEIlsneghsekhvgkfsqvkhlqpyklNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIvllpsssvsfrnltdlQVWGCKELMKLVTSSTAKSLVRLRIMKVCgsramtqvvtsekdgaedeIVFSNLKaltlldldsltsfcsgnytfkfpslrdlevigcpkmkifttgelctpprvnvwygegdgecrwaNDLNVTIQELHAEKMlegsssnlrkydtl
vvqddsacfplgllekfrNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVtsstakslvrLRIMKVcgsramtqvvtsekdgaedEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIfttgelctpprVNVWYGEGDGECRWANDLNVTIQELHaekmlegsssnlrkydtl
VVQDDSACFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKAltlldldsltsFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELHAEKMLEGSSSNLRKYDTL
******ACFPLGLLEKFRNLEILYLSRTSYTEILSNEG***KHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELH******************
*VQDDSACFPLGLLEKFRNLEILYLSRTSYTEILSN**H******KFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQVVT********EIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELHAEKMLEGSSSNLRKYDTL
VVQDDSACFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELHAEKMLEGSSSNLRKYDTL
****DSACFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELHAEKMLEGSSSNLRKYDTL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VVQDDSACFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELHAEKMLEGSSSNLRKYDTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.909 0.093 0.411 6e-36
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.944 0.141 0.410 1e-35
302143647 759 unnamed protein product [Vitis vinifera] 0.893 0.299 0.423 5e-35
302143659 922 unnamed protein product [Vitis vinifera] 0.897 0.247 0.407 3e-34
359488108 1436 PREDICTED: disease resistance protein At 0.897 0.158 0.407 3e-34
357439633 1039 Rpp4 candidate [Medicago truncatula] gi| 0.858 0.209 0.406 1e-33
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.897 0.170 0.407 1e-33
296087869 1711 unnamed protein product [Vitis vinifera] 0.874 0.129 0.407 1e-33
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.901 0.097 0.370 2e-33
359488025 1781 PREDICTED: uncharacterized protein LOC10 0.874 0.124 0.407 2e-33
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  157 bits (396), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 133/236 (56%), Gaps = 5/236 (2%)

Query: 3    QDDSACFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLK 62
             D S   P  LL KF+N+  L L R S  ++L + G  ++     SQ+++L+   L D+K
Sbjct: 2218 HDTSFDSPCDLLHKFQNVHQLIL-RCSNFKVLFSFGVVDESARILSQLRYLKLDYLPDMK 2276

Query: 63   QLWKQGSKLDFIFTNLEILRVYCCQNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSST 122
            ++W Q    D    NLE L ++ C +LI L  S S  F+NL  L V+ C EL+ LVTSS 
Sbjct: 2277 EIWSQDCPTDQTLQNLETLEIWGCHSLISL-ASGSAGFQNLETLDVYNCDELLYLVTSSV 2335

Query: 123  AKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFK 182
            AKSLV L  M V     + +VV SE D  + +I+FS L+ L L  L+SL  FCS + T +
Sbjct: 2336 AKSLVHLTKMTVRECNILREVVASEADEPQGDIIFSKLENLRLYRLESLIRFCSASITIQ 2395

Query: 183  FPSLRDLEVIGCPKMKIFTTGELCTPPRVNVWYGEGDGECRWANDLNVTIQELHAE 238
            FPSL+D+EV  CP M  F+ G +  P    V +    GE RW   LN TIQ+L+ E
Sbjct: 2396 FPSLKDVEVTQCPNMMDFSRGVIRAPKLQKVCFA---GEERWVEHLNTTIQQLYKE 2448

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143647|emb|CBI22400.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143659|emb|CBI22412.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357439633|ref|XP_003590094.1| Rpp4 candidate [Medicago truncatula] gi|355479142|gb|AES60345.1| Rpp4 candidate [Medicago truncatula] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087869|emb|CBI35152.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_329000001
cc-nbs-lrr resistance protein (2359 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.56
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.47
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.04
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.91
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
KOG0617264 consensus Ras suppressor protein (contains leucine 98.45
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.42
PRK15386 426 type III secretion protein GogB; Provisional 98.4
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.39
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.37
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.25
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.25
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.24
KOG4341 483 consensus F-box protein containing LRR [General fu 98.24
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.23
PRK15386 426 type III secretion protein GogB; Provisional 98.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.21
KOG4341483 consensus F-box protein containing LRR [General fu 98.21
KOG0617264 consensus Ras suppressor protein (contains leucine 98.11
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.09
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.09
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.09
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.93
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.89
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.74
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.61
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.46
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.41
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.32
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.23
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.98
KOG0472 565 consensus Leucine-rich repeat protein [Function un 96.8
KOG0472565 consensus Leucine-rich repeat protein [Function un 96.66
PLN03150623 hypothetical protein; Provisional 96.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.0
PLN03150623 hypothetical protein; Provisional 95.95
KOG4237 498 consensus Extracellular matrix protein slit, conta 95.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.64
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.62
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.46
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.45
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.03
KOG4237498 consensus Extracellular matrix protein slit, conta 94.75
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 94.3
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 92.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 92.04
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 91.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 91.42
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 91.0
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 90.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 90.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.02
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 89.97
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 89.55
KOG2982 418 consensus Uncharacterized conserved protein [Funct 86.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 85.81
KOG2123 388 consensus Uncharacterized conserved protein [Funct 85.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 82.88
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.56  E-value=1.3e-14  Score=143.79  Aligned_cols=119  Identities=24%  Similarity=0.380  Sum_probs=86.0

Q ss_pred             ceechHHHhhCCCCcEEEEecccceEecCCCCccccccCCCCcccEEeccCCcccccccccCCccccCCCCccEEEEecC
Q 038204            7 ACFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCC   86 (254)
Q Consensus         7 ~~~P~~~~~~l~~L~~L~l~~c~l~~l~~~~~~~~~~~~~~~~L~~L~L~~~~~L~~l~~~~~~~~~~~~~L~~L~l~~C   86 (254)
                      ..+|+++  ...+|+.|++.++.++.++.       .+..+++|+.|+++++..++.+..     ...+++|++|++.+|
T Consensus       602 ~~lP~~f--~~~~L~~L~L~~s~l~~L~~-------~~~~l~~Lk~L~Ls~~~~l~~ip~-----ls~l~~Le~L~L~~c  667 (1153)
T PLN03210        602 RCMPSNF--RPENLVKLQMQGSKLEKLWD-------GVHSLTGLRNIDLRGSKNLKEIPD-----LSMATNLETLKLSDC  667 (1153)
T ss_pred             CCCCCcC--CccCCcEEECcCcccccccc-------ccccCCCCCEEECCCCCCcCcCCc-----cccCCcccEEEecCC
Confidence            3445544  35677777777776666654       234588888888888877766532     445788899999988


Q ss_pred             CCcceecCCcccccccccEEEeeccccccccccchhhccccccceeEEecCCCceeE
Q 038204           87 QNLIVLLPSSSVSFRNLTDLQVWGCKELMKLVTSSTAKSLVRLRIMKVCGSRAMTQV  143 (254)
Q Consensus        87 ~~L~~l~p~~~~~~~~L~~L~i~~C~~L~~l~~~~~~~~l~~L~~L~i~~C~~l~~i  143 (254)
                      ..+..+ |..+..+++|+.|++++|.+++.++..   .++++|+.|.+++|..++.+
T Consensus       668 ~~L~~l-p~si~~L~~L~~L~L~~c~~L~~Lp~~---i~l~sL~~L~Lsgc~~L~~~  720 (1153)
T PLN03210        668 SSLVEL-PSSIQYLNKLEDLDMSRCENLEILPTG---INLKSLYRLNLSGCSRLKSF  720 (1153)
T ss_pred             CCcccc-chhhhccCCCCEEeCCCCCCcCccCCc---CCCCCCCEEeCCCCCCcccc
Confidence            888888 555788888888888888888877542   26778888888888766544

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.64
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.6
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.47
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.47
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.47
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.45
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.44
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.38
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.37
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.36
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.36
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.36
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.36
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.35
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.34
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.31
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.3
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.3
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.29
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.26
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.25
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.21
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.2
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.2
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.04
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.04
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.03
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.02
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.02
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.02
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.0
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.99
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.99
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.98
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.98
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.98
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.97
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.93
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.93
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.93
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.92
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.91
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.9
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.89
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.87
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.86
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.85
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.84
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.84
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.82
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.8
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.8
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.77
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.72
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.71
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.47
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.45
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.43
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.42
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.39
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.39
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.38
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.37
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.22
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.18
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.89
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.79
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.77
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.67
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.13
4gt6_A394 Cell surface protein; leucine rich repeats, putati 91.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.77
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 89.38
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.64  E-value=1.4e-15  Score=130.22  Aligned_cols=178  Identities=19%  Similarity=0.228  Sum_probs=95.8

Q ss_pred             eechHHHhhCCCCcEEEEecccceEecCCCCccccccCCCCcccEEeccCCcccccccccCCccccCCCCccEEEEecCC
Q 038204            8 CFPLGLLEKFRNLEILYLSRTSYTEILSNEGHSEKHVGKFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQ   87 (254)
Q Consensus         8 ~~P~~~~~~l~~L~~L~l~~c~l~~l~~~~~~~~~~~~~~~~L~~L~L~~~~~L~~l~~~~~~~~~~~~~L~~L~l~~C~   87 (254)
                      .+|..+ .++++|++|++++|.+..++.       .++.+++|++|+++++ .++.+..    ....+++|++|++++|.
T Consensus        95 ~lp~~l-~~l~~L~~L~L~~n~l~~lp~-------~~~~l~~L~~L~Ls~n-~l~~lp~----~l~~l~~L~~L~L~~n~  161 (328)
T 4fcg_A           95 QFPDQA-FRLSHLQHMTIDAAGLMELPD-------TMQQFAGLETLTLARN-PLRALPA----SIASLNRLRELSIRACP  161 (328)
T ss_dssp             SCCSCG-GGGTTCSEEEEESSCCCCCCS-------CGGGGTTCSEEEEESC-CCCCCCG----GGGGCTTCCEEEEEEET
T ss_pred             hcChhh-hhCCCCCEEECCCCCccchhH-------HHhccCCCCEEECCCC-ccccCcH----HHhcCcCCCEEECCCCC
Confidence            466654 357888888888876665543       2445666666666554 2333311    13445566666666655


Q ss_pred             CcceecCCccc---------ccccccEEEeecccccccccc---------------------chhhccccccceeEEecC
Q 038204           88 NLIVLLPSSSV---------SFRNLTDLQVWGCKELMKLVT---------------------SSTAKSLVRLRIMKVCGS  137 (254)
Q Consensus        88 ~L~~l~p~~~~---------~~~~L~~L~i~~C~~L~~l~~---------------------~~~~~~l~~L~~L~i~~C  137 (254)
                      .+..+ |..+.         .+++|++|++++| +++.++.                     ......+++|++|++++|
T Consensus       162 ~~~~~-p~~~~~~~~~~~~~~l~~L~~L~L~~n-~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n  239 (328)
T 4fcg_A          162 ELTEL-PEPLASTDASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGC  239 (328)
T ss_dssp             TCCCC-CSCSEEEC-CCCEEESTTCCEEEEEEE-CCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTC
T ss_pred             Ccccc-ChhHhhccchhhhccCCCCCEEECcCC-CcCcchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCC
Confidence            55444 22222         2555555555554 2333321                     012334444444444444


Q ss_pred             CCceeEeecCCCCccccccccccceeecccccccceecCCCccccCCCcCeEEEeCCCCCcccCCCCCCCCC
Q 038204          138 RAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGCPKMKIFTTGELCTPP  209 (254)
Q Consensus       138 ~~l~~i~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~~~~sL~~L~i~~Cp~L~~lp~~~~~~~~  209 (254)
                      .....++.       ....+++|+.|++.+|..+..++..  ...+++|++|++++|+.+..+|......+.
T Consensus       240 ~~~~~~p~-------~~~~l~~L~~L~L~~n~~~~~~p~~--~~~l~~L~~L~L~~n~~~~~iP~~l~~L~~  302 (328)
T 4fcg_A          240 TALRNYPP-------IFGGRAPLKRLILKDCSNLLTLPLD--IHRLTQLEKLDLRGCVNLSRLPSLIAQLPA  302 (328)
T ss_dssp             TTCCBCCC-------CTTCCCCCCEEECTTCTTCCBCCTT--GGGCTTCCEEECTTCTTCCCCCGGGGGSCT
T ss_pred             cchhhhHH-------HhcCCCCCCEEECCCCCchhhcchh--hhcCCCCCEEeCCCCCchhhccHHHhhccC
Confidence            43332222       2334667777777777666666543  246677777777777777777766554444
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.35
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.28
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.25
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.22
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.19
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.12
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.12
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.11
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.1
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.09
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.04
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.01
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.85
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.84
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.73
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.71
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.58
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.49
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.23
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.15
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.99
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.95
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 95.83
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.81
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.98
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 93.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 89.3
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 88.44
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.49  E-value=2e-15  Score=124.83  Aligned_cols=140  Identities=16%  Similarity=0.137  Sum_probs=61.6

Q ss_pred             CCCcccEEeccCCcccccccccCCccccCCCCccEEEEecCCCcceecC--CcccccccccEEEeeccc-cccccccchh
Q 038204           46 KFSQVKHLQPYKLNDLKQLWKQGSKLDFIFTNLEILRVYCCQNLIVLLP--SSSVSFRNLTDLQVWGCK-ELMKLVTSST  122 (254)
Q Consensus        46 ~~~~L~~L~L~~~~~L~~l~~~~~~~~~~~~~L~~L~l~~C~~L~~l~p--~~~~~~~~L~~L~i~~C~-~L~~l~~~~~  122 (254)
                      .+++|++|++++|..++...  .......+++|++|++++|.++++-..  .....+++|+.|++++|. .+++......
T Consensus        93 ~~~~L~~L~Ls~c~~itd~~--l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l  170 (284)
T d2astb2          93 KNSNLVRLNLSGCSGFSEFA--LQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTL  170 (284)
T ss_dssp             TCTTCSEEECTTCBSCCHHH--HHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHH
T ss_pred             cCCCCcCccccccccccccc--cchhhHHHHhccccccccccccccccchhhhcccccccchhhhccccccccccccccc
Confidence            45555555555555544310  001123345555555555555432110  001123455555555543 2333222233


Q ss_pred             hccccccceeEEecCCCceeEeecCCCCccccccccccceeecccccccceecCCCccccCCCcCeEEEeCC
Q 038204          123 AKSLVRLRIMKVCGSRAMTQVVTSEKDGAEDEIVFSNLKALTLLDLDSLTSFCSGNYTFKFPSLRDLEVIGC  194 (254)
Q Consensus       123 ~~~l~~L~~L~i~~C~~l~~i~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~~~~sL~~L~i~~C  194 (254)
                      +.++++|++|++++|..+.+-      .......+++|++|++.+|.++++-.... ...+|+|+.|++.+|
T Consensus       171 ~~~~~~L~~L~L~~~~~itd~------~~~~l~~~~~L~~L~L~~C~~i~~~~l~~-L~~~~~L~~L~l~~~  235 (284)
T d2astb2         171 VRRCPNLVHLDLSDSVMLKND------CFQEFFQLNYLQHLSLSRCYDIIPETLLE-LGEIPTLKTLQVFGI  235 (284)
T ss_dssp             HHHCTTCSEEECTTCTTCCGG------GGGGGGGCTTCCEEECTTCTTCCGGGGGG-GGGCTTCCEEECTTS
T ss_pred             ccccccccccccccccCCCch------hhhhhcccCcCCEEECCCCCCCChHHHHH-HhcCCCCCEEeeeCC
Confidence            445555566666555544210      00122335556666666665554332211 234555666665555
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure