Citrus Sinensis ID: 038230


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MNIFNLLLPTRRGVGAVMKGCRATCYSFFHSSPETTVEVQSQEQEVVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKSLA
cccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccccccccccccccccHHHHHccccccccccccccccccccccccccEEEccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHccccEEEccccccccccHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccHHHHHHHHHccccccccEEEcccccHHHHHHccccccccccHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHHccc
ccEEEEccccHHHHcccccEEEEcccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEcEEEEEccccccccccEEEEEEEEEEcccHHHHHHHHHHHHHHccccEccccccEccEEEEEEEccccEEccccEEccHHHHHcHHHHHHHHHHccccEcccccEcHHHHHccccccccccccccccccccccEEEEEEEccccccHHHHHccHHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHHHcHcccccccEEEEEcccHHHHHHHHHccccEEEEccccccccHHHHHHHHcccEEEEEccccccccHHcccccccccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHHHccccEEEcccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHHccc
mnifnlllptrrgvgavmkgcratcysffhsspettveVQSQEQEVVIAMGSNVGDRLCNFNEALQLMKKLGVnitrhgclyetepayvtdqprflnsavrgvtklgphELLGVLKKIEKDmgrtngirhgprpidldilfygrfsihsdtltvpheriwerpfvVAPLLDLlgssvesdtklggesligkegmkrvLPIGNLLWDWSLKTSVMGIlnltpdsfsdggkfqSVEAAVSQVRLMISEgadmidigaqstrpmatKISAEKELERLIPVLEAVltmpemegklvsVDTFYSKVASEAvgkgahivndvsagqldpdmYKVVAGLKVPYVamhmrgdpstmqneenlqydDVCKQVASELYSKVRDaelsgipawriiidpglgfskkaEHNLDILLGLaashapiligpsrkRFLGeicnrpsaderdpatIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKSLA
mnifnlllptrrgVGAVMKGCRATCYSFFHSSPETTVEVQSQEQEVVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMgrtngirhgprpIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGssvesdtklggesligkegmkrVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNRpsaderdpATIASITAGVLGGANIVRVHNIrdnldavklcdsmltrrksla
MNIFNLLLPTRRGVGAVMKGCRATCYSFFHSSPettvevqsqeqevvIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKSLA
**IFNLLLPTRRGVGAVMKGCRATCYSFFHSSPETTVEV***EQEVVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIG***************ELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHM************LQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNR********ATIASITAGVLGGANIVRVHNIRDNLDAVKLCDS*********
*********************************************VVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKL*********GMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRR****
MNIFNLLLPTRRGVGAVMKGCRATCYSFFHSS*********QEQEVVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKSLA
*NIFNLLLPTRRGVGAVMKGCRATCYSFFHSS**TT**VQSQEQEVVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIFNLLLPTRRGVGAVMKGCRATCYSFFHSSPETTVEVQSQEQEVVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKSLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query480 2.2.26 [Sep-21-2011]
P29251740 Folic acid synthesis prot N/A no 0.918 0.595 0.409 1e-87
Q4LB35733 Folic acid synthesis prot yes no 0.862 0.564 0.383 2e-71
P53848824 Folic acid synthesis prot yes no 0.918 0.535 0.307 9e-60
P73248289 Dihydropteroate synthase N/A no 0.556 0.923 0.419 5e-57
Q54YD9657 Folic acid synthesis prot yes no 0.614 0.449 0.359 3e-56
P0AC15282 Dihydropteroate synthase yes no 0.537 0.914 0.396 5e-48
P0AC13282 Dihydropteroate synthase N/A no 0.537 0.914 0.396 5e-48
P0AC14282 Dihydropteroate synthase yes no 0.537 0.914 0.396 5e-48
P28822285 Dihydropteroate synthase yes no 0.533 0.898 0.400 1e-46
O05701267 Dihydropteroate synthase yes no 0.516 0.928 0.396 2e-45
>sp|P29251|FOL1_PNECA Folic acid synthesis protein fol1 OS=Pneumocystis carinii GN=fol1 PE=1 SV=1 Back     alignment and function desciption
 Score =  323 bits (829), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 190/464 (40%), Positives = 270/464 (58%), Gaps = 23/464 (4%)

Query: 27  SFFHSSPETTVEVQSQEQEVVIAMGSNVGDRLCNFNEALQLMKKLGVNITRHGCLYETEP 86
           S F S+     E     + V I++GSN+G+R+    +A++ M   G+ + +   LYE++P
Sbjct: 277 SCFSSNNYIKSENSIDNEAVYISLGSNLGNRIKFILDAIEKMSIKGIKVLKTSMLYESKP 336

Query: 87  AYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEKDMGRTNGIRHGPRPIDLDILFYGRFS 146
            Y  DQP F N+  +  T L P +LL  L+ IEK++GR   I  GPR IDLDI+FYGR  
Sbjct: 337 MYFKDQPAFYNAVCKVQTSLHPEQLLFELQLIEKELGRVKVIDKGPRCIDLDIVFYGRKI 396

Query: 147 IHSDTLTVPHERIWERPFVVAPLLDLLGSSVESDTKLGGESLIGK---EGMKRVLPI--G 201
           I+S++L +PH R+ ER FV+ PLLD+ G  V   T L   S   K     +K VLP    
Sbjct: 397 INSESLIIPHPRVLERSFVLKPLLDISGDLVHPVTGLSIASYFEKIVDHDIKPVLPFLYK 456

Query: 202 NLLWDWSLK-----TSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQ 256
           N   D+S +     T +M ILNLTPDSF DGG   S ++ +  V   I+ GA +IDIG Q
Sbjct: 457 NKSIDFSFRSYKAPTYIMAILNLTPDSFFDGG-IHSYDSVLIDVEKFINAGATIIDIGGQ 515

Query: 257 STRPMATKISAEKELERLIPVLEAVL-TMPEMEGKLVSVDTFYSKVASEAVGKGAHIVND 315
           STRP +  I  E+E+ R+IP ++ +  T P++   L+S+DTF S+VA +AV  GA +VND
Sbjct: 516 STRPGSYIIPLEEEIFRVIPAIKYLQKTYPDI---LISIDTFRSEVAEQAVKAGASLVND 572

Query: 316 VSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAE 375
           +S G+ DP M+  VA LKVP   MHMRG+   M N  +    D+ +Q+  EL   +  AE
Sbjct: 573 ISGGRYDPKMFNTVARLKVPICIMHMRGNFLNMDNLTDYG-TDIIEQITIELEKLLNSAE 631

Query: 376 LSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHA-------PILIGPSRKRFLGEICN 428
            SGIP W II+DPGLGFSK    N+++L       +       P L+GPSRKRF G I  
Sbjct: 632 KSGIPRWNIILDPGLGFSKTLHQNIELLRRFNELKSKNCFNGLPWLLGPSRKRFTGFITG 691

Query: 429 RPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSM 472
                +R   T+A++ A + GG +I+RVH++ +     K+ D++
Sbjct: 692 DNMPKDRIWGTVAAVVASISGGCDIIRVHDVYEMYKISKMSDAI 735




Catalyzes three sequential steps of tetrahydrofolate biosynthesis.
Pneumocystis carinii (taxid: 4754)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 5
>sp|Q4LB35|FOL1_SCHPO Folic acid synthesis protein fol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol1 PE=1 SV=2 Back     alignment and function description
>sp|P53848|FOL1_YEAST Folic acid synthesis protein FOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL1 PE=1 SV=2 Back     alignment and function description
>sp|P73248|DHPS_SYNY3 Dihydropteroate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=folP PE=3 SV=1 Back     alignment and function description
>sp|Q54YD9|FOL1_DICDI Folic acid synthesis protein FOL1 OS=Dictyostelium discoideum GN=fol1 PE=3 SV=1 Back     alignment and function description
>sp|P0AC15|DHPS_SHIFL Dihydropteroate synthase OS=Shigella flexneri GN=folP PE=3 SV=1 Back     alignment and function description
>sp|P0AC13|DHPS_ECOLI Dihydropteroate synthase OS=Escherichia coli (strain K12) GN=folP PE=1 SV=1 Back     alignment and function description
>sp|P0AC14|DHPS_ECOL6 Dihydropteroate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=folP PE=3 SV=1 Back     alignment and function description
>sp|P28822|DHPS_BACSU Dihydropteroate synthase OS=Bacillus subtilis (strain 168) GN=sul PE=3 SV=2 Back     alignment and function description
>sp|O05701|DHPS_STAAU Dihydropteroate synthase OS=Staphylococcus aureus GN=folP PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
297738107482 unnamed protein product [Vitis vinifera] 0.979 0.975 0.762 0.0
225423430509 PREDICTED: folic acid synthesis protein 0.954 0.899 0.762 0.0
224099000480 predicted protein [Populus trichocarpa] 0.933 0.933 0.780 0.0
238684536512 dihydropterin pyrophosphokinase-dihydrop 0.993 0.931 0.688 0.0
356499917523 PREDICTED: folic acid synthesis protein 0.995 0.913 0.687 0.0
449467235506 PREDICTED: folic acid synthesis protein 0.987 0.936 0.698 0.0
449524504506 PREDICTED: folic acid synthesis protein 0.987 0.936 0.696 0.0
356498014 581 PREDICTED: LOW QUALITY PROTEIN: folic ac 0.993 0.820 0.687 0.0
1934972515 dihydropterin pyrophosphokinase /dihydro 0.943 0.879 0.714 0.0
357487651515 Dihydropteroate synthase [Medicago trunc 0.983 0.916 0.677 0.0
>gi|297738107|emb|CBI27308.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/492 (76%), Positives = 429/492 (87%), Gaps = 22/492 (4%)

Query: 1   MNIFNLLLPTRRGVGAVMKGCRATCYSFFHSSPETTVEVQSQEQEVVIAMGSNVGDRLCN 60
           MNIF  L  TR G    MK CRATC S  HSS  T+VEV SQ+QEVVIA+GSNVG+R+ N
Sbjct: 1   MNIFKQLASTRCGFNGGMKSCRATCVSLLHSSSGTSVEVHSQDQEVVIALGSNVGNRVDN 60

Query: 61  FNEALQLMKKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEK 120
           FNEALQLMKK G++ITRHGCLYETEP YVTDQP FLNSAVRG+TKLGPHELL VLKKIEK
Sbjct: 61  FNEALQLMKKSGMHITRHGCLYETEPVYVTDQPLFLNSAVRGITKLGPHELLRVLKKIEK 120

Query: 121 DMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVESD 180
           DMGRT+GIR+GPRPIDLDILFYG+F ++S+ LT+PHERIWERPFV+APL+D++GS++ESD
Sbjct: 121 DMGRTDGIRYGPRPIDLDILFYGKFRVNSEILTIPHERIWERPFVMAPLMDVMGSAMESD 180

Query: 181 TKLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQV 240
           T           G+KRVLP GN+LWDWSLKTS+MGILNLTPDSFSDGGKFQSVEAAVSQV
Sbjct: 181 TN----------GLKRVLPTGNVLWDWSLKTSMMGILNLTPDSFSDGGKFQSVEAAVSQV 230

Query: 241 RLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSK 300
           RLMI EGAD+IDIGAQSTRPMA+++SA++EL+RLIPVL+AVL MPE+EGKL+SVDTF+S+
Sbjct: 231 RLMILEGADIIDIGAQSTRPMASRLSAQEELDRLIPVLDAVLKMPEVEGKLLSVDTFHSE 290

Query: 301 VASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVC 360
           VASEA+GKGAHIVNDVSAGQLDP+M  VVA LKVPYVAMHMRG+PSTMQN ENLQYD+VC
Sbjct: 291 VASEAIGKGAHIVNDVSAGQLDPNMLDVVASLKVPYVAMHMRGNPSTMQNSENLQYDNVC 350

Query: 361 KQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLG------------LAA 408
           +QVASELY +VRDAELSGIPAWRIIIDPG+GFSK  EHNLDIL+G            LA 
Sbjct: 351 EQVASELYLRVRDAELSGIPAWRIIIDPGIGFSKNTEHNLDILMGLPNIRMELAGKSLAL 410

Query: 409 SHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKL 468
           SHAP+LIGPSRKRFLG+IC RP+A ERDPATIA++TAGVLGGANIVR HN++DNLDAVKL
Sbjct: 411 SHAPMLIGPSRKRFLGDICARPAAAERDPATIAAVTAGVLGGANIVRAHNVKDNLDAVKL 470

Query: 469 CDSMLTRRKSLA 480
           CD+M+ R +S A
Sbjct: 471 CDAMVKRERSQA 482




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225423430|ref|XP_002273643.1| PREDICTED: folic acid synthesis protein fol1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224099000|ref|XP_002311349.1| predicted protein [Populus trichocarpa] gi|222851169|gb|EEE88716.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|238684536|gb|ACR54435.1| dihydropterin pyrophosphokinase-dihydropteroate synthase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356499917|ref|XP_003518782.1| PREDICTED: folic acid synthesis protein fol1-like [Glycine max] Back     alignment and taxonomy information
>gi|449467235|ref|XP_004151330.1| PREDICTED: folic acid synthesis protein fol1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449524504|ref|XP_004169262.1| PREDICTED: folic acid synthesis protein fol1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356498014|ref|XP_003517850.1| PREDICTED: LOW QUALITY PROTEIN: folic acid synthesis protein fol1-like [Glycine max] Back     alignment and taxonomy information
>gi|1934972|emb|CAA69903.1| dihydropterin pyrophosphokinase /dihydropteroate synthase [Pisum sativum] Back     alignment and taxonomy information
>gi|357487651|ref|XP_003614113.1| Dihydropteroate synthase [Medicago truncatula] gi|355515448|gb|AES97071.1| Dihydropteroate synthase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
UNIPROTKB|O04862515 O04862 "Dihydropterin pyrophos 0.618 0.576 0.747 1.9e-179
TAIR|locus:2026471484 AT1G69190 [Arabidopsis thalian 0.631 0.626 0.658 8.5e-162
ASPGD|ASPL0000000767434 AN6032 [Emericella nidulans (t 0.814 0.900 0.408 2.1e-68
POMBASE|SPBC1734.03733 SPBC1734.03 "trifunctional dih 0.862 0.564 0.385 1.2e-67
DICTYBASE|DDB_G0278283657 fol1 "dihydro-6-hydroxymethylp 0.312 0.228 0.404 3.6e-62
CGD|CAL0000317788 FOL1 [Candida albicans (taxid: 0.318 0.194 0.431 4.8e-62
UNIPROTKB|G4MSK9577 MGG_01474 "Folic acid synthesi 0.487 0.405 0.407 6.1e-60
SGD|S000005200824 FOL1 "Multifunctional enzyme o 0.314 0.183 0.381 3.4e-53
TIGR_CMR|CHY_2383294 CHY_2383 "dihydropteroate synt 0.522 0.853 0.423 8.3e-51
TIGR_CMR|GSU_1808303 GSU_1808 "dihydropteroate synt 0.552 0.874 0.405 1.6e-47
UNIPROTKB|O04862 O04862 "Dihydropterin pyrophosphokinase /dihydropteroate synthase" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
 Score = 1170 (416.9 bits), Expect = 1.9e-179, Sum P(2) = 1.9e-179
 Identities = 231/309 (74%), Positives = 270/309 (87%)

Query:   182 KLGGESLIGKEGMKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVR 241
             KLGGESLIG+EGM RV+P+ N L DWS +T VMGILNLTPDSFSDGG FQSV++AVSQ R
Sbjct:   201 KLGGESLIGEEGMYRVMPVANGLLDWSRRTLVMGILNLTPDSFSDGGNFQSVKSAVSQAR 260

Query:   242 LMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKV 301
             LMISEGAD+IDIGAQSTRPMA++ISAE+EL RLIPVLEAV+++PE+EGKL+SVDTFYS+V
Sbjct:   261 LMISEGADIIDIGAQSTRPMASRISAEEELGRLIPVLEAVMSIPEVEGKLISVDTFYSEV 320

Query:   302 ASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCK 361
             A EAV KGAHI+NDVSAG+LD  M+KV+A L VPYVAMHMRGDPSTMQ+ ENL+YD+VCK
Sbjct:   321 ALEAVRKGAHIINDVSAGKLDASMFKVMAELDVPYVAMHMRGDPSTMQDSENLKYDNVCK 380

Query:   362 QVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLG------------LAAS 409
              ++SELYS+VR+AE+SGIPAWRII+DPG+GFSKK E NL  L G            LA S
Sbjct:   381 DISSELYSRVREAEISGIPAWRIIMDPGIGFSKKTEDNLAALTGIPDIREEISKRSLAIS 440

Query:   410 HAPILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLC 469
             HAPILIGPSRKRFLGEIC+RPSA +RDPATIAS+TAGVL GANIVRVHN++DNLDAVKLC
Sbjct:   441 HAPILIGPSRKRFLGEICSRPSAVDRDPATIASVTAGVLCGANIVRVHNVKDNLDAVKLC 500

Query:   470 DSMLTRRKS 478
             D++L ++ S
Sbjct:   501 DAILKQKSS 509


GO:0000287 "magnesium ion binding" evidence=IDA
GO:0003848 "2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity" evidence=IDA
GO:0004156 "dihydropteroate synthase activity" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0046656 "folic acid biosynthetic process" evidence=IDA
TAIR|locus:2026471 AT1G69190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000000767 AN6032 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPBC1734.03 SPBC1734.03 "trifunctional dihydropteroatesynthase/2-amino-4-hydroxy-6-hydro xymethyldihydropteridinediphosphokinase/dihydroneopterin aldolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278283 fol1 "dihydro-6-hydroxymethylpterin pyrophosphokinase (HPPK)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0000317 FOL1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|G4MSK9 MGG_01474 "Folic acid synthesis protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
SGD|S000005200 FOL1 "Multifunctional enzyme of the folic acid biosynthesis pathway" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2383 CHY_2383 "dihydropteroate synthase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1808 GSU_1808 "dihydropteroate synthase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O84619FOLKP_CHLTR2, ., 5, ., 1, ., 1, 50.30760.84370.9yesno
Q9Z7E8FOLKP_CHLPN2, ., 5, ., 1, ., 1, 50.31480.86870.9266yesno
P82602FOLKP_CHLMU2, ., 5, ., 1, ., 1, 50.30220.84790.9044yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.6LOW CONFIDENCE prediction!
3rd Layer2.7.6.3LOW CONFIDENCE prediction!
4th Layer2.5.1.150.737
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00030018001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (483 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00006492001
SubName- Full=Chromosome undetermined scaffold_171, whole genome shotgun sequence; (536 aa)
    0.990
GSVIVG00005777001
SubName- Full=Chromosome chr3 scaffold_158, whole genome shotgun sequence; (214 aa)
     0.975
GSVIVG00025328001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (570 aa)
    0.955
GSVIVG00018404001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (832 aa)
      0.899
GSVIVG00014567001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (193 aa)
      0.825
GSVIVG00030640001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (141 aa)
      0.805
GSVIVG00001276001
SubName- Full=Chromosome undetermined scaffold_114, whole genome shotgun sequence; (290 aa)
      0.761
GSVIVG00024726001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (594 aa)
      0.739
GSVIVG00000640001
RecName- Full=DNA topoisomerase 2; EC=5.99.1.3; (661 aa)
       0.737
GSVIVG00036343001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (184 aa)
      0.710

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
cd00739257 cd00739, DHPS, DHPS subgroup of Pterin binding enz 1e-119
cd00423258 cd00423, Pterin_binding, Pterin binding enzymes 3e-98
TIGR01496257 TIGR01496, DHPS, dihydropteroate synthase 4e-98
COG0294274 COG0294, FolP, Dihydropteroate synthase and relate 2e-83
pfam00809210 pfam00809, Pterin_bind, Pterin binding enzyme 3e-80
PRK11613282 PRK11613, folP, dihydropteroate synthase; Provisio 1e-65
cd00483128 cd00483, HPPK, 7,8-dihydro-6-hydroxymethylpterin-p 1e-53
pfam01288127 pfam01288, HPPK, 7,8-dihydro-6-hydroxymethylpterin 2e-51
COG0801160 COG0801, FolK, 7,8-dihydro-6-hydroxymethylpterin-p 2e-44
TIGR01498129 TIGR01498, folK, 2-amino-4-hydroxy-6-hydroxymethyl 4e-40
PRK13753279 PRK13753, PRK13753, dihydropteroate synthase; Prov 4e-28
PRK10239159 PRK10239, PRK10239, 2-amino-4-hydroxy-6-hydroxymet 9e-18
PRK14092163 PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymet 2e-17
>gnl|CDD|238380 cd00739, DHPS, DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
 Score =  349 bits (898), Expect = e-119
 Identities = 128/263 (48%), Positives = 170/263 (64%), Gaps = 9/263 (3%)

Query: 211 TSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKE 270
           T +MGILN+TPDSFSDGG+F S++ AV+    MI+EGAD+IDIG +STRP A  +S E+E
Sbjct: 1   TQIMGILNVTPDSFSDGGRFLSLDKAVAHAEKMIAEGADIIDIGGESTRPGADPVSVEEE 60

Query: 271 LERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVA 330
           LER+IPVLEA+         L+SVDTF ++VA  A+  GA I+NDVS G  DP M +V A
Sbjct: 61  LERVIPVLEALR---GELDVLISVDTFRAEVARAALEAGADIINDVSGGSDDPAMLEVAA 117

Query: 331 GLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGL 390
               P V MHMRG P TMQ   N  Y+DV  +V S L +++  AE +G+   RII+DPG+
Sbjct: 118 EYGAPLVLMHMRGTPKTMQE--NPYYEDVVDEVLSFLEARLEAAESAGVARNRIILDPGI 175

Query: 391 GFSKKAEHNLDILLGLA---ASHAPILIGPSRKRFLGEICNRPSADERDPATIASITAGV 447
           GF K  EHNL++L  L        P+L+G SRK F+G +  R    +RD  T+A      
Sbjct: 176 GFGKTPEHNLELLRRLDELKQLGLPVLVGASRKSFIGALLGRE-PKDRDWGTLALSALAA 234

Query: 448 LGGANIVRVHNIRDNLDAVKLCD 470
             GA+IVRVH+++   DA+K+ D
Sbjct: 235 ANGADIVRVHDVKATRDALKVAD 257


DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS. Sulfonamide drugs, which are substrate analogs of pABA, target DHPS. Length = 257

>gnl|CDD|238242 cd00423, Pterin_binding, Pterin binding enzymes Back     alignment and domain information
>gnl|CDD|233439 TIGR01496, DHPS, dihydropteroate synthase Back     alignment and domain information
>gnl|CDD|223371 COG0294, FolP, Dihydropteroate synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|216130 pfam00809, Pterin_bind, Pterin binding enzyme Back     alignment and domain information
>gnl|CDD|183230 PRK11613, folP, dihydropteroate synthase; Provisional Back     alignment and domain information
>gnl|CDD|238269 cd00483, HPPK, 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) Back     alignment and domain information
>gnl|CDD|216414 pfam01288, HPPK, 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) Back     alignment and domain information
>gnl|CDD|223872 COG0801, FolK, 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213631 TIGR01498, folK, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase Back     alignment and domain information
>gnl|CDD|184303 PRK13753, PRK13753, dihydropteroate synthase; Provisional Back     alignment and domain information
>gnl|CDD|182325 PRK10239, PRK10239, 2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|172582 PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 480
KOG2544711 consensus Dihydropteroate synthase/7,8-dihydro-6-h 100.0
PRK11613282 folP dihydropteroate synthase; Provisional 100.0
PRK13753279 dihydropteroate synthase; Provisional 100.0
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 100.0
TIGR01496257 DHPS dihydropteroate synthase. This model represen 100.0
cd00423258 Pterin_binding Pterin binding enzymes. This family 100.0
COG0294274 FolP Dihydropteroate synthase and related enzymes 100.0
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 100.0
COG0801160 FolK 7,8-dihydro-6-hydroxymethylpterin-pyrophospho 100.0
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 100.0
PRK14092163 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 100.0
PRK10239159 2-amino-4-hydroxy-6-hydroxymethyldihyropteridine p 100.0
cd00740252 MeTr MeTr subgroup of pterin binding enzymes. This 100.0
TIGR01498127 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteri 100.0
cd00483128 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophospho 100.0
TIGR00284 499 dihydropteroate synthase-related protein. This pro 100.0
PF01288127 HPPK: 7,8-dihydro-6-hydroxymethylpterin-pyrophosph 100.0
TIGR02082 1178 metH 5-methyltetrahydrofolate--homocysteine methyl 100.0
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 99.97
PRK04165 450 acetyl-CoA decarbonylase/synthase complex subunit 99.93
COG1410 842 MetH Methionine synthase I, cobalamin-binding doma 99.86
PRK04452319 acetyl-CoA decarbonylase/synthase complex subunit 99.79
PRK00979308 tetrahydromethanopterin S-methyltransferase subuni 99.78
TIGR00381389 cdhD CO dehydrogenase/acetyl-CoA synthase, delta s 99.55
COG1456 467 CdhE CO dehydrogenase/acetyl-CoA synthase gamma su 99.31
PF03599 386 CdhD: CO dehydrogenase/acetyl-CoA synthase delta s 99.12
PF02007296 MtrH: Tetrahydromethanopterin S-methyltransferase 98.76
PRK14047310 putative methyltransferase; Provisional 98.47
TIGR01114314 mtrH N5-methyltetrahydromethanopterin:coenzyme M m 98.37
COG2069403 CdhD CO dehydrogenase/acetyl-CoA synthase delta su 97.98
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 97.97
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 97.85
PRK02048 611 4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha 97.78
PF04551359 GcpE: GcpE protein; InterPro: IPR004588 This prote 97.77
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 97.76
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 97.75
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 97.74
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 97.73
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 97.65
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.64
PLN02925 733 4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha 97.57
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 97.55
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 97.52
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 97.52
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 97.5
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 97.49
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.47
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 97.4
PLN02591250 tryptophan synthase 97.38
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 97.38
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.37
PRK00694 606 4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha 97.33
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.33
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 97.31
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 97.17
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 97.14
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 97.13
PRK12331 448 oxaloacetate decarboxylase; Provisional 97.09
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 97.09
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 97.07
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 97.03
PRK14041 467 oxaloacetate decarboxylase; Provisional 97.01
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesi 97.0
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 96.98
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.93
PRK14040 593 oxaloacetate decarboxylase; Provisional 96.87
PRK09282 592 pyruvate carboxylase subunit B; Validated 96.86
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 96.83
PF00682237 HMGL-like: HMGL-like of this family is not conserv 96.79
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 96.79
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 96.78
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 96.65
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 96.61
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 96.59
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 96.58
TIGR03586327 PseI pseudaminic acid synthase. 96.57
PLN03228 503 methylthioalkylmalate synthase; Provisional 96.57
PLN02746347 hydroxymethylglutaryl-CoA lyase 96.54
COG1962313 MtrH Tetrahydromethanopterin S-methyltransferase, 96.53
PRK12330 499 oxaloacetate decarboxylase; Provisional 96.52
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 96.51
PRK12581 468 oxaloacetate decarboxylase; Provisional 96.49
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 96.43
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 96.34
PRK00915 513 2-isopropylmalate synthase; Validated 96.27
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.23
COG0821 361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 96.2
PRK09389 488 (R)-citramalate synthase; Provisional 95.9
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 95.83
PRK07094323 biotin synthase; Provisional 95.67
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 95.65
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 95.43
PLN03033290 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 95.4
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 95.37
PRK12999 1146 pyruvate carboxylase; Reviewed 95.33
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 95.27
cd00465306 URO-D_CIMS_like The URO-D_CIMS_like protein superf 95.26
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 94.93
PRK14042 596 pyruvate carboxylase subunit B; Provisional 94.89
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 94.82
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 94.74
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 94.61
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 94.61
PLN02389379 biotin synthase 94.61
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 94.56
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.43
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 94.38
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 94.21
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.18
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 94.18
PLN02321 632 2-isopropylmalate synthase 94.18
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 94.17
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 94.06
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 93.95
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 93.94
PRK06252339 methylcobalamin:coenzyme M methyltransferase; Vali 93.87
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 93.81
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 93.6
cd03465330 URO-D_like The URO-D _like protein superfamily inc 93.53
PRK06256336 biotin synthase; Validated 93.46
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 93.17
PRK15108345 biotin synthase; Provisional 93.11
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 92.99
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 92.98
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 92.94
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 92.92
TIGR00190423 thiC thiamine biosynthesis protein ThiC. The thiC 92.9
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 92.86
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 92.82
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.77
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 92.77
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 92.57
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 92.48
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 92.45
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 92.28
PLN02274505 inosine-5'-monophosphate dehydrogenase 92.21
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 92.19
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 92.15
PTZ00413398 lipoate synthase; Provisional 92.07
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 92.04
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 91.97
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 91.8
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 91.79
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 91.7
TIGR01463340 mtaA_cmuA methyltransferase, MtaA/CmuA family. Thi 91.69
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 91.68
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 91.65
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 91.58
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 91.45
cd00717335 URO-D Uroporphyrinogen decarboxylase (URO-D) is a 91.18
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 91.18
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 91.11
cd03307326 Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, al 91.01
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 90.96
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 90.94
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 90.84
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 90.81
PRK09613 469 thiH thiamine biosynthesis protein ThiH; Reviewed 90.77
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 90.68
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 90.66
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 90.58
PRK12331448 oxaloacetate decarboxylase; Provisional 90.56
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 90.55
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 90.51
PRK13352431 thiamine biosynthesis protein ThiC; Provisional 90.38
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 90.35
PLN02433345 uroporphyrinogen decarboxylase 90.31
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 90.31
PLN02424332 ketopantoate hydroxymethyltransferase 90.28
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 90.26
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 90.22
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 90.17
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 90.16
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 90.14
PRK05481289 lipoyl synthase; Provisional 90.07
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synth 90.01
PLN02417280 dihydrodipicolinate synthase 90.0
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 89.79
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 89.53
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 89.46
PRK13210284 putative L-xylulose 5-phosphate 3-epimerase; Revie 89.37
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 89.33
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 89.32
PRK04147293 N-acetylneuraminate lyase; Provisional 89.26
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 89.24
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 89.14
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 89.08
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 89.02
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 89.0
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 88.94
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 88.79
TIGR00542279 hxl6Piso_put hexulose-6-phosphate isomerase, putat 88.61
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.52
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 88.49
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 88.38
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 88.34
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 88.33
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 88.33
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 88.2
PRK12928290 lipoyl synthase; Provisional 88.18
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 88.16
PRK04326330 methionine synthase; Provisional 87.83
PRK13523337 NADPH dehydrogenase NamA; Provisional 87.79
TIGR00510302 lipA lipoate synthase. The family shows strong seq 87.75
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 87.69
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 87.65
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 87.65
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 87.65
TIGR01464338 hemE uroporphyrinogen decarboxylase. This model re 87.58
PRK14024241 phosphoribosyl isomerase A; Provisional 87.58
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 87.56
PRK08444353 hypothetical protein; Provisional 87.53
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 87.17
PRK00115346 hemE uroporphyrinogen decarboxylase; Validated 86.86
PRK12755353 phospho-2-dehydro-3-deoxyheptonate aldolase; Provi 86.7
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 86.65
TIGR02631 382 xylA_Arthro xylose isomerase, Arthrobacter type. T 86.63
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 86.6
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 86.5
TIGR00970 564 leuA_yeast 2-isopropylmalate synthase, yeast type. 86.41
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 86.29
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 86.07
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 85.99
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 85.86
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 85.78
cd03309321 CmuC_like CmuC_like. Proteins similar to the putat 85.75
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 85.44
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 85.26
PRK12581468 oxaloacetate decarboxylase; Provisional 85.19
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 85.19
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 85.19
PRK03170292 dihydrodipicolinate synthase; Provisional 84.93
PRK08508279 biotin synthase; Provisional 84.92
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 84.9
cd02812219 PcrB_like PcrB_like proteins. One member of this f 84.86
PLN02520 529 bifunctional 3-dehydroquinate dehydratase/shikimat 84.79
PLN02428349 lipoic acid synthase 84.76
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 84.41
PRK08227264 autoinducer 2 aldolase; Validated 84.23
PRK09261349 phospho-2-dehydro-3-deoxyheptonate aldolase; Valid 84.2
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 84.1
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 83.98
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 83.93
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 83.9
PRK07360371 FO synthase subunit 2; Reviewed 83.82
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 83.79
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 83.74
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 83.67
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 83.49
cd07942284 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and 83.42
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 83.33
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 83.32
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 83.29
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 83.22
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 82.94
PF01208343 URO-D: Uroporphyrinogen decarboxylase (URO-D); Int 82.88
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 82.81
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 82.53
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 82.38
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 82.27
PRK01060281 endonuclease IV; Provisional 82.16
COG1831285 Predicted metal-dependent hydrolase (urease superf 82.13
PRK01261229 aroD 3-dehydroquinate dehydratase; Provisional 81.78
PRK08575326 5-methyltetrahydropteroyltriglutamate--homocystein 81.77
KOG0623541 consensus Glutamine amidotransferase/cyclase [Amin 81.6
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 81.52
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 81.45
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 81.43
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 81.41
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 81.35
KOG0369 1176 consensus Pyruvate carboxylase [Energy production 81.24
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 81.18
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 81.06
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 81.02
cd03308378 CmuA_CmuC_like CmuA_CmuC_like: uncharacterized pro 80.89
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 80.7
cd01321345 ADGF Adenosine deaminase-related growth factors (A 80.53
PF14385164 DUF4416: Domain of unknown function (DUF4416) 80.48
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 80.41
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 80.24
>KOG2544 consensus Dihydropteroate synthase/7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase/Dihydroneopterin aldolase [Coenzyme transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=1.9e-111  Score=856.62  Aligned_cols=436  Identities=64%  Similarity=1.040  Sum_probs=409.1

Q ss_pred             ccceeEEEEeCCCcccHHHHHHHHHHHHHhc-CCcEEEeeCcEEeCCCCCCCCccceeeeeeeccCCCHHHHHHHHHHHH
Q 038230           41 SQEQEVVIAMGSNVGDRLCNFNEALQLMKKL-GVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIE  119 (480)
Q Consensus        41 ~~~~~~~l~LGSN~gd~~~~i~~A~~~L~~~-~~~i~~~S~~y~T~P~g~~~q~~F~N~v~~~~T~l~p~~Ll~~lk~IE  119 (480)
                      .+..++||++|||+||+.+||+.|++.|.+. ++.+...|++|||+|+++.+||.|+|+++.++|.|+|.+||+.||.||
T Consensus       248 tqnk~a~lafGSNIGdrf~~iq~AL~~L~k~~gi~v~~~S~lyEtePmy~kDQp~FlNg~v~~eT~l~P~eLL~~ckkIE  327 (711)
T KOG2544|consen  248 TQNKRAFLAFGSNIGDRFNNIQEALQRLMKEKGIKVTRHSCLYETEPMYVKDQPRFLNGAVRGETKLTPHELLKVCKKIE  327 (711)
T ss_pred             ccceeEEEEeccchhHHHHHHHHHHHHHHHhccEEEeeeccccccCCceecCCchhhcceEEEEeecCHHHHHHHHHHHH
Confidence            3456799999999999999999999888766 889999999999999999999999999999999999999999999999


Q ss_pred             HHcCCCCCCCCCCCccchhhcccCCeeeeCCCccccccccccchhhhhhhhhhhCCCccc--c-----------ccccCC
Q 038230          120 KDMGRTNGIRHGPRPIDLDILFYGRFSIHSDTLTVPHERIWERPFVVAPLLDLLGSSVES--D-----------TKLGGE  186 (480)
Q Consensus       120 ~~~GR~r~~~~~~r~iDiDIl~~~~~~~~~~~l~iPHp~~~~R~fVl~pl~el~~~~~~p--~-----------~~~~~~  186 (480)
                      ++|||.+..+||||+|||||++||+.++..+.|+|||+++|||.|||.||.||.++.+|+  .           +.++++
T Consensus       328 ~emgR~k~i~~GPR~iDLDIv~yg~~~i~se~L~IPH~rl~ER~FVL~PL~~L~~~~vh~h~lt~~p~~l~qa~dkl~~e  407 (711)
T KOG2544|consen  328 EEMGRVKGIRYGPRPIDLDIVFYGKDIIVSEKLIIPHERLWERTFVLAPLVDLLGDVVHWHSLTAHPGGLFQAWDKLGGE  407 (711)
T ss_pred             HHhhhhhccccCCCccceeEEEecceeeeeccccCCchhhhhchhhHHHHHHhcCccccccccccCchHHHHHHHhcCCc
Confidence            999999999999999999999999999999999999999999999999999999976543  3           234444


Q ss_pred             ccccccC-ccccccccccccCCCCCcEEEEEEecCCCCCCCCCccCCHHHHHHHHHHHHHcCCCEEEeCCCCCCCCCCCC
Q 038230          187 SLIGKEG-MKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKI  265 (480)
Q Consensus       187 ~~~q~~~-i~r~~~~~~~~~~~~~~~~imGIlN~tpDSFsdgg~~~~~e~a~~~A~~~v~~GAdiIDIG~eStrP~a~~v  265 (480)
                      ..+...+ +.|++++++..+++..++.+|||+|+|||||||||+|.+.+.++.+++.|+.+||+||||||+||||++.++
T Consensus       408 ~~l~~~Gv~~R~l~~gd~~~~~~n~t~vMgIlN~TPDSFSDGGkf~~ids~l~~v~smi~dga~IiDiGgqSTrP~a~~i  487 (711)
T KOG2544|consen  408 SLLGRDGVIQRVLPIGDTLWDFSNKTYVMGILNLTPDSFSDGGKFQSIDSALSRVRSMISDGADIIDIGGQSTRPMASRI  487 (711)
T ss_pred             cccccCCceeEEeeccchhhhhcCcceEEEEEecCCcccCCCCccccHHHHHHHHHHHhcCCceEEeecCccCCCCcccc
Confidence            4443344 689999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHcCCcCCCCeEEEeCCCHHHHHHHHHcCCCEEecCCCCCCCchHHHHHHhcCCCEEEEcCCCCC
Q 038230          266 SAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDP  345 (480)
Q Consensus       266 ~~~eE~~rl~~vi~~l~~~~~~~~~pISIDT~~~~v~~aaL~~G~~iINdVsg~~~d~~m~~l~~~~~~~vVlmh~~g~p  345 (480)
                      |.+||++|+.|+|+++++......++||||||+.+|+++|+++||||||||+|+..|++|.+++++.++++++||++|+|
T Consensus       488 S~eEEirR~iP~ikavR~~~e~~~v~iSiDTy~S~VAkeAI~~GadIiNDvsgG~~D~nM~~vvAe~~vpy~imHmRGdp  567 (711)
T KOG2544|consen  488 SSEEEIRRLIPVIKAVRGMTEMPQVLISIDTYNSEVAKEAIKNGADIINDVSGGLLDENMHKVVAESEVPYMIMHMRGDP  567 (711)
T ss_pred             chHHHHHHHhHHHHHHhcccccCceeEEEechhhHHHHHHHhccchheeccccccCchhhHHHHhhcCCCEEEEeccCCh
Confidence            99999999999999999765456799999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccccccchhhHHHHHHHHHHHHHHHHHHCCCCCCCEEEecCCCCccChhHHHHHHHhc------------ccCCCcE
Q 038230          346 STMQNEENLQYDDVCKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGL------------AASHAPI  413 (480)
Q Consensus       346 ~~~~~~~~~~~~~v~~ev~~~l~~~i~~a~~~Gi~~~~IilDPgiGf~k~~~~~~~~lr~l------------~~~g~Pi  413 (480)
                      .||+...++.|.++++++..++.+++++|...||++|+|++|||+||+|+..||+.++.++            .....|+
T Consensus       568 ~TM~~l~~ye~~di~kdVa~El~eRv~~A~~sGv~rw~ImiDPG~GFaKt~kqnl~ii~~lp~i~e~mak~~i~l~h~pi  647 (711)
T KOG2544|consen  568 CTMQNLENYEYFDICKDVAQELYERVRKAELSGVPRWRIMIDPGIGFAKTWKQNLDIIMHLPKIREEMAKVSINLSHAPI  647 (711)
T ss_pred             HHHHHHhhhhHhHHHHHHHHHHHHHHHHHHHcCCcceEEEecCCcccccChhhhhhHhhhchhhHHHhcccceecccCce
Confidence            9999999999999999999999999999999999999999999999999999999999965            2348899


Q ss_pred             EEeeccccccccccCCCCcCcccHHHHHHHHHHHHcCCcEEEcCChHHHHHHHHHHHHHHhhh
Q 038230          414 LIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRR  476 (480)
Q Consensus       414 l~G~SrKsfi~~v~g~~~~~~r~~~t~a~~~~a~~~Ga~IlRvHdV~e~~~al~~~~ai~~~~  476 (480)
                      |+|.|||+|+|.++|.+++.+|+++|.|+.+.++..|++|+|||||+++.+++++++||++..
T Consensus       648 L~GPSRK~F~G~itgd~~akdRd~aT~A~Vta~Il~Ga~ivRVHdvk~~ska~kladAi~r~~  710 (711)
T KOG2544|consen  648 LLGPSRKRFLGDITGDPEAKDRDAATVACVTAGILFGANIVRVHDVKNNSKAAKLADAIYRGL  710 (711)
T ss_pred             eeCcccccccccccCCCChhhhcchhhhhhhhhhccCcceEEEeechhhhHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999999999999999998653



>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>COG0294 FolP Dihydropteroate synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>COG0801 FolK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase [Coenzyme metabolism] Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>PRK14092 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Back     alignment and domain information
>PRK10239 2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase; Provisional Back     alignment and domain information
>cd00740 MeTr MeTr subgroup of pterin binding enzymes Back     alignment and domain information
>TIGR01498 folK 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Back     alignment and domain information
>cd00483 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PF01288 HPPK: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK); InterPro: IPR000550 All organisms require reduced folate cofactors for the synthesis of a variety of metabolites Back     alignment and domain information
>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional Back     alignment and domain information
>COG1410 MetH Methionine synthase I, cobalamin-binding domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional Back     alignment and domain information
>PRK00979 tetrahydromethanopterin S-methyltransferase subunit H; Provisional Back     alignment and domain information
>TIGR00381 cdhD CO dehydrogenase/acetyl-CoA synthase, delta subunit Back     alignment and domain information
>COG1456 CdhE CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) [Energy production and conversion] Back     alignment and domain information
>PF03599 CdhD: CO dehydrogenase/acetyl-CoA synthase delta subunit; InterPro: IPR016041 This entry represents a conserved region predicted to form a TIM alpha/beta barrel, and is found in the delta subunit of a number of CO dehydrogenase/acetyl-CoA synthase enzymes Back     alignment and domain information
>PF02007 MtrH: Tetrahydromethanopterin S-methyltransferase MtrH subunit; InterPro: IPR023467 In archaea the enzyme tetrahydromethanopterin S-methyltransferase is composed of eight subunits, MtrA-H Back     alignment and domain information
>PRK14047 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01114 mtrH N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit H Back     alignment and domain information
>COG2069 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) [Energy production and conversion] Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>COG1962 MtrH Tetrahydromethanopterin S-methyltransferase, subunit H [Coenzyme metabolism] Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd00465 URO-D_CIMS_like The URO-D_CIMS_like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases, as well as cobalamine (B12) independent methionine synthases Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR00190 thiC thiamine biosynthesis protein ThiC Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR01463 mtaA_cmuA methyltransferase, MtaA/CmuA family Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd03307 Mta_CmuA_like MtaA_CmuA_like family Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK13352 thiamine biosynthesis protein ThiC; Provisional Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PLN02433 uroporphyrinogen decarboxylase Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK04326 methionine synthase; Provisional Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01464 hemE uroporphyrinogen decarboxylase Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK00115 hemE uroporphyrinogen decarboxylase; Validated Back     alignment and domain information
>PRK12755 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>TIGR02631 xylA_Arthro xylose isomerase, Arthrobacter type Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>cd03309 CmuC_like CmuC_like Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK09261 phospho-2-dehydro-3-deoxyheptonate aldolase; Validated Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PF01208 URO-D: Uroporphyrinogen decarboxylase (URO-D); InterPro: IPR000257 Uroporphyrinogen decarboxylase (URO-D), the fifth enzyme of the haem biosynthetic pathway, catalyses the sequential decarboxylation of the four acetyl side chains of uroporphyrinogen to yield coproporphyrinogen [] Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only] Back     alignment and domain information
>PRK01261 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK08575 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase; Provisional Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03308 CmuA_CmuC_like CmuA_CmuC_like: uncharacterized protein family similar to uroporphyrinogen decarboxylase (URO-D) and the methyltransferases CmuA and CmuC Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>PF14385 DUF4416: Domain of unknown function (DUF4416) Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
2bmb_A545 X-Ray Structure Of The Bifunctional 6-Hydroxymethyl 3e-59
1tws_A297 Dihydropteroate Synthetase From Bacillus Anthracis 5e-50
3v5o_A297 Structural And Mechanistic Studies Of Catalysis And 2e-49
1aj0_A282 Crystal Structure Of A Ternary Complex Of E. Coli D 3e-49
2dqw_A294 Crystal Structure Of Dihydropteroate Synthase (Folp 3e-47
1ad1_A266 Dihydropteroate Synthetase (Apo Form) From Staphylo 2e-46
4hb7_A270 The Structure Of Dihydropteroate Synthase From Stap 2e-45
1eye_A280 1.7 Angstrom Resolution Crystal Structure Of 6-Hydr 1e-44
3tyu_A280 Crystal Structure Of Dihydropteroate Synthetase Wit 9e-44
2y5j_A294 Crystal Structure Of Burkholderia Cenocepacia Dihyd 6e-36
3mcm_A442 Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydro 1e-32
2vef_A314 Dihydropteroate Synthase From Streptococcus Pneumon 4e-29
3tr9_A314 Structure Of A Dihydropteroate Synthase (Folp) In C 2e-28
3qbc_A161 Structure And Design Of A New Pterin Site Inhibitor 4e-21
2qx0_A159 Crystal Structure Of Yersinia Pestis Hppk (Ternary 2e-17
2cg8_A270 The Bifunctional Dihydroneopterin Aldolase 6-Hydrox 3e-17
1cbk_A160 7,8-Dihydro-6-Hydroxymethylpterin-Pyrophosphokinase 4e-17
1tmj_A158 Crystal Structure Of E.Coli Apo-Hppk(W89a) At 1.45 8e-16
1dy3_A158 Ternary Complex Of 7,8-Dihydro-6- Hydroxymethylpter 8e-16
3hsd_A158 Crystal Structure Of E. Coli Hppk(Y53a) Length = 15 3e-15
3kue_A158 Crystal Structure Of E. Coli Hppk(E77a) Length = 15 4e-15
3hd2_A158 Crystal Structure Of E. Coli Hppk(Q50a) In Complex 4e-15
1hq2_A158 Crystal Structure Of A Ternary Complex Of E.Coli Hp 5e-15
1f9h_A158 Crystal Structure Of The Ternary Complex Of E. Coli 5e-15
1rtz_A152 Crystal Structure Of E.Coli Apo-Hppk(V83gDEL84-89) 5e-15
3hsj_A158 Crystal Structure Of E. Coli Hppk(N55a) Length = 15 6e-15
3hcx_A158 Crystal Structure Of E. Coli Hppk(N10a) Length = 15 6e-15
3ill_A158 Crystal Structure Of E. Coli Hppk(D97a) Length = 15 6e-15
3ili_A158 Crystal Structure Of E. Coli Hppk(D95a) Length = 15 6e-15
3hsz_A158 Crystal Structure Of E. Coli Hppk(F123a) Length = 1 8e-15
3kug_A158 Crystal Structure Of E. Coli Hppk(H115a) Length = 1 9e-15
2vp8_A318 Structure Of Mycobacterium Tuberculosis Rv1207 Leng 4e-13
>pdb|2BMB|A Chain A, X-Ray Structure Of The Bifunctional 6-Hydroxymethyl-7,8- Dihydroxypterin Pyrophosphokinase Dihydropteroate Synthase From Saccharomyces Cerevisiae Length = 545 Back     alignment and structure

Iteration: 1

Score = 226 bits (575), Expect = 3e-59, Method: Compositional matrix adjust. Identities = 161/519 (31%), Positives = 263/519 (50%), Gaps = 95/519 (18%) Query: 48 IAMGSNVGDRLCNFNEALQLM-KKLGVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKL 106 +A GSN+GDR + ALQL+ ++ V + ++E+EP Y DQ F+N V T L Sbjct: 23 LAFGSNIGDRFKHIQMALQLLSREKTVKLRNISSIFESEPMYFKDQTPFMNGCVEVETLL 82 Query: 107 GPHELLGVLKKIE-KDMGRTNGIRHGPRPIDLDILFYGRFS-----IHSDTLTVPHERIW 160 P ELL + KKIE +++ R +GPR IDLDI+ + + ++ L +PH R+ Sbjct: 83 TPSELLKLCKKIEYEELQRVKHFDNGPRTIDLDIVMFLNSAGEDIIVNEPDLNIPHPRML 142 Query: 161 ERPFVVAPLLDLLG---------------------SSVESDTKLGGESLIGKEGMK-RVL 198 ER FV+ PL +L+ + DT L + G++ R L Sbjct: 143 ERTFVLEPLCELISPVHLHPVTAEPIVDHLKQLYDKQHDEDTLWKLVPLPYRSGVEPRFL 202 Query: 199 PI--GNLLWDWSLKTS--------VMGILNLTPDSFSDGGK-FQSVEAAVSQV------R 241 L +++ +T+ +M I N TPDSFSDGG+ F +E+ ++ + Sbjct: 203 KFKTATKLDEFTGETNRITVSPTYIMAIFNATPDSFSDGGEHFADIESQLNDIIKLCKDA 262 Query: 242 LMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTMPEM--EGKLVSVDTFYS 299 L + E +ID+G STRP + + S E+E+ R IP+++A+ E+ + ++S+DT+ S Sbjct: 263 LYLHESV-IIDVGGCSTRPNSIQASEEEEIRRSIPLIKAIRESTELPQDKVILSIDTYRS 321 Query: 300 KVASEAVGKGAHIVNDVSAGQLDPDMYKVVA-GLKVPYVAMHMRGDPSTM---------- 348 VA EA+ G I+ND+S G D +M+ V+A ++ Y+ H RGD STM Sbjct: 322 NVAKEAIKVGVDIINDISGGLFDSNMFAVIAENPEICYILSHTRGDISTMNRLAHYENFA 381 Query: 349 ----------QNEENLQYDDV------CKQVASELYSKVRDAELSGIPAWRIIIDPGLGF 392 N + Q DD+ + V E+ + A +G+ W+I+IDPGLGF Sbjct: 382 LGDSIQQEFVHNTDIQQLDDLKDKTVLIRNVGQEIGERYIKAIDNGVKRWQILIDPGLGF 441 Query: 393 SKKAEHNLDIL-------------------LGLAASHAPILIGPSRKRFLGEICNRPSAD 433 +K + NL I+ + + + P+L+GPSRK+F+G I A Sbjct: 442 AKTWKQNLQIIRHIPILKNYSFTMNSNNSQVYVNLRNMPVLLGPSRKKFIGHITKDVDAK 501 Query: 434 ERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSM 472 +RD AT A + + + G+++VRVH++++ ++KL D++ Sbjct: 502 QRDFATGAVVASCIGFGSDMVRVHDVKNCSKSIKLADAI 540
>pdb|1TWS|A Chain A, Dihydropteroate Synthetase From Bacillus Anthracis Length = 297 Back     alignment and structure
>pdb|3V5O|A Chain A, Structural And Mechanistic Studies Of Catalysis And Sulfa Drug Resistance In Dihydropteroate Synthase Length = 297 Back     alignment and structure
>pdb|1AJ0|A Chain A, Crystal Structure Of A Ternary Complex Of E. Coli Dihydropteroate Synthase Length = 282 Back     alignment and structure
>pdb|2DQW|A Chain A, Crystal Structure Of Dihydropteroate Synthase (Folp) From Thermus Thermophilus Hb8 Length = 294 Back     alignment and structure
>pdb|1AD1|A Chain A, Dihydropteroate Synthetase (Apo Form) From Staphylococcus Aureus Length = 266 Back     alignment and structure
>pdb|4HB7|A Chain A, The Structure Of Dihydropteroate Synthase From Staphylococcus Aureus Subsp. Aureus Mu50. Length = 270 Back     alignment and structure
>pdb|1EYE|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of 6-Hydroxymethyl-7,8- Dihydropteroate Synthase (Dhps) From Mycobacterium Tuberculosis In Complex With 6-Hydroxymethylpterin Monophosphate Length = 280 Back     alignment and structure
>pdb|3TYU|A Chain A, Crystal Structure Of Dihydropteroate Synthetase With Product1 Length = 280 Back     alignment and structure
>pdb|2Y5J|A Chain A, Crystal Structure Of Burkholderia Cenocepacia Dihydropteroate Synthase. Length = 294 Back     alignment and structure
>pdb|3MCM|A Chain A, Crystal Structure Of The 6-Hyroxymethyl-7,8-Dihydropterin Pyrophosphokinase Dihydropteroate Synthase Bifunctional Enzyme From Francisella Tularensis Length = 442 Back     alignment and structure
>pdb|2VEF|A Chain A, Dihydropteroate Synthase From Streptococcus Pneumoniae Length = 314 Back     alignment and structure
>pdb|3TR9|A Chain A, Structure Of A Dihydropteroate Synthase (Folp) In Complex With Pteroic Acid From Coxiella Burnetii Length = 314 Back     alignment and structure
>pdb|3QBC|A Chain A, Structure And Design Of A New Pterin Site Inhibitor Of S. Aureus Hppk Length = 161 Back     alignment and structure
>pdb|2QX0|A Chain A, Crystal Structure Of Yersinia Pestis Hppk (Ternary Complex) Length = 159 Back     alignment and structure
>pdb|2CG8|A Chain A, The Bifunctional Dihydroneopterin Aldolase 6-Hydroxymethyl- 7,8-Dihydropterin Synthase From Streptococcus Pneumoniae Length = 270 Back     alignment and structure
>pdb|1CBK|A Chain A, 7,8-Dihydro-6-Hydroxymethylpterin-Pyrophosphokinase From Haemophilus Influenzae Length = 160 Back     alignment and structure
>pdb|1TMJ|A Chain A, Crystal Structure Of E.Coli Apo-Hppk(W89a) At 1.45 Angstrom Resolution Length = 158 Back     alignment and structure
>pdb|1DY3|A Chain A, Ternary Complex Of 7,8-Dihydro-6- Hydroxymethylpterinpyrophosphokinase From Escherichia Coli With Atp And A Substrate Analogue. Length = 158 Back     alignment and structure
>pdb|3HSD|A Chain A, Crystal Structure Of E. Coli Hppk(Y53a) Length = 158 Back     alignment and structure
>pdb|3KUE|A Chain A, Crystal Structure Of E. Coli Hppk(E77a) Length = 158 Back     alignment and structure
>pdb|3HD2|A Chain A, Crystal Structure Of E. Coli Hppk(Q50a) In Complex With Mgam Pterin Length = 158 Back     alignment and structure
>pdb|1HQ2|A Chain A, Crystal Structure Of A Ternary Complex Of E.Coli Hppk(R82a) With Mgampcpp And 6-Hydroxymethyl-7,8-Dihydropterin At 1.25 Angstrom Resolution Length = 158 Back     alignment and structure
>pdb|1F9H|A Chain A, Crystal Structure Of The Ternary Complex Of E. Coli Hppk(R92a) With Mgampcpp And 6-Hydroxymethyl-7,8- Dihydropterin At 1.50 Angstrom Resolution Length = 158 Back     alignment and structure
>pdb|1RTZ|A Chain A, Crystal Structure Of E.Coli Apo-Hppk(V83gDEL84-89) At 1.33 Angstrom Resolution Length = 152 Back     alignment and structure
>pdb|3HSJ|A Chain A, Crystal Structure Of E. Coli Hppk(N55a) Length = 158 Back     alignment and structure
>pdb|3HCX|A Chain A, Crystal Structure Of E. Coli Hppk(N10a) Length = 158 Back     alignment and structure
>pdb|3ILL|A Chain A, Crystal Structure Of E. Coli Hppk(D97a) Length = 158 Back     alignment and structure
>pdb|3ILI|A Chain A, Crystal Structure Of E. Coli Hppk(D95a) Length = 158 Back     alignment and structure
>pdb|3HSZ|A Chain A, Crystal Structure Of E. Coli Hppk(F123a) Length = 158 Back     alignment and structure
>pdb|3KUG|A Chain A, Crystal Structure Of E. Coli Hppk(H115a) Length = 158 Back     alignment and structure
>pdb|2VP8|A Chain A, Structure Of Mycobacterium Tuberculosis Rv1207 Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
2bmb_A545 Folic acid synthesis protein FOL1; folate biosynth 0.0
3mcm_A442 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 0.0
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 1e-127
1ad1_A266 DHPS, dihydropteroate synthetase; transferase, APO 1e-124
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 1e-122
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 1e-121
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 1e-118
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 1e-118
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 1e-112
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 1e-112
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 1e-110
2cg8_A270 Dihydroneopterin aldolase 6-hydroxymethyl-7,8- dih 6e-55
3qbc_A161 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 1e-50
1cbk_A160 Protein (7,8-dihydro-6-hydroxymethylpterin- pyroph 3e-50
1f9y_A158 HPPK, protein (6-hydroxymethyl-7,8-dihydropterin p 1e-49
2qx0_A159 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokina 3e-49
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 1e-04
>2bmb_A Folic acid synthesis protein FOL1; folate biosynthesis, transferase, ligase, multifunctional enzyme; HET: PMM; 2.3A {Saccharomyces cerevisiae} Length = 545 Back     alignment and structure
 Score =  548 bits (1413), Expect = 0.0
 Identities = 154/542 (28%), Positives = 252/542 (46%), Gaps = 97/542 (17%)

Query: 27  SFFHSSPETTVEVQSQEQEVVIAMGSNVGDRLCNFNEALQLMKKL-GVNITRHGCLYETE 85
           S   S        +   +   +A GSN+GDR  +   ALQL+ +   V +     ++E+E
Sbjct: 2   SHMASMTGGQQMGRGSWKRAFLAFGSNIGDRFKHIQMALQLLSREKTVKLRNISSIFESE 61

Query: 86  PAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIE-KDMGRTNGIRHGPRPIDLDILFYGR 144
           P Y  DQ  F+N  V   T L P ELL + KKIE +++ R     +GPR IDLDI+ +  
Sbjct: 62  PMYFKDQTPFMNGCVEVETLLTPSELLKLCKKIEYEELQRVKHFDNGPRTIDLDIVMFLN 121

Query: 145 F-----SIHSDTLTVPHERIWERPFVVAPLLDLLGS------------------------ 175
                  ++   L +PH R+ ER FV+ PL +L+                          
Sbjct: 122 SAGEDIIVNEPDLNIPHPRMLERTFVLEPLCELISPVHLHPVTAEPIVDHLKQLYDKQHD 181

Query: 176 SVESDTKLGGESLIGKEGMKRVLPIGNLLWDWSL--------KTSVMGILNLTPDSFSDG 227
                  +      G E           L +++          T +M I N TPDSFSDG
Sbjct: 182 EDTLWKLVPLPYRSGVEPRFLKFKTATKLDEFTGETNRITVSPTYIMAIFNATPDSFSDG 241

Query: 228 GK-FQSVEAAVSQVRLMISEG-----ADMIDIGAQSTRPMATKISAEKELERLIPVLEAV 281
           G+ F  +E+ ++ +  +  +      + +ID+G  STRP + + S E+E+ R IP+++A+
Sbjct: 242 GEHFADIESQLNDIIKLCKDALYLHESVIIDVGGCSTRPNSIQASEEEEIRRSIPLIKAI 301

Query: 282 LTMPEM--EGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVA-GLKVPYVA 338
               E+  +  ++S+DT+ S VA EA+  G  I+ND+S G  D +M+ V+A   ++ Y+ 
Sbjct: 302 RESTELPQDKVILSIDTYRSNVAKEAIKVGVDIINDISGGLFDSNMFAVIAENPEICYIL 361

Query: 339 MHMRGDPSTMQNEENLQYDD----------------------------VCKQVASELYSK 370
            H RGD STM       Y++                            + + V  E+  +
Sbjct: 362 SHTRGDISTMNR--LAHYENFALGDSIQQEFVHNTDIQQLDDLKDKTVLIRNVGQEIGER 419

Query: 371 VRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGLAASHA------------------- 411
              A  +G+  W+I+IDPGLGF+K  + NL I+  +                        
Sbjct: 420 YIKAIDNGVKRWQILIDPGLGFAKTWKQNLQIIRHIPILKNYSFTMNSNNSQVYVNLRNM 479

Query: 412 PILIGPSRKRFLGEICNRPSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDS 471
           P+L+GPSRK+F+G I     A +RD AT A + + +  G+++VRVH++++   ++KL D+
Sbjct: 480 PVLLGPSRKKFIGHITKDVDAKQRDFATGAVVASCIGFGSDMVRVHDVKNCSKSIKLADA 539

Query: 472 ML 473
           + 
Sbjct: 540 IY 541


>3mcm_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/dihydropteroate...; folate, TIM barrel, synthase, HPPK, DHPS; 2.20A {Francisella tularensis subsp} PDB: 3mcn_A* 3mco_A* Length = 442 Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Length = 297 Back     alignment and structure
>1ad1_A DHPS, dihydropteroate synthetase; transferase, APO form, complex with OH-CH2-pterin-pyrophosphate; 2.20A {Staphylococcus aureus} SCOP: c.1.21.1 PDB: 1ad4_A* Length = 266 Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Length = 280 Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Length = 282 Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Length = 294 Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Length = 294 Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Length = 314 Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Length = 318 Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Length = 314 Back     alignment and structure
>2cg8_A Dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase; lyase/transferase, folate biosynthesis, pyrophosphokinase, lyase; 2.9A {Streptococcus pneumoniae} Length = 270 Back     alignment and structure
>3qbc_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase; protein-inhibitor complex, ferredoxin-like fold; HET: B55; 1.65A {Staphylococcus aureus} Length = 161 Back     alignment and structure
>1cbk_A Protein (7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase); transferase; HET: ROI; 2.02A {Haemophilus influenzae} SCOP: d.58.30.1 Length = 160 Back     alignment and structure
>1f9y_A HPPK, protein (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase); pyrophosphoryl transfer, catalytic mechanism, folate, ternary complex; HET: APC HHR; 0.89A {Escherichia coli} SCOP: d.58.30.1 PDB: 1eq0_A 1dy3_A* 1ex8_A* 1eqm_A* 1hka_A 1q0n_A* 1rao_A* 1rb0_A* 2f63_A 2f65_A 3h4a_A* 3ip0_A* 3ud5_A* 3ude_A* 3udv_A* 3kue_A 3hd2_A* 1f9h_A* 1g4c_A 1kbr_A ... Length = 158 Back     alignment and structure
>2qx0_A 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase; 3-layered alpha-BATA-alpha fold, homodimer, ternary complex, transferase; HET: APC PH2; 1.80A {Yersinia pestis} Length = 159 Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Length = 310 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Length = 323 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
2bmb_A545 Folic acid synthesis protein FOL1; folate biosynth 100.0
3mcm_A442 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 100.0
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 100.0
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 100.0
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 100.0
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 100.0
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 100.0
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 100.0
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 100.0
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 100.0
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 100.0
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 100.0
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 100.0
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 100.0
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 100.0
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 100.0
3qbc_A161 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 100.0
1cbk_A160 Protein (7,8-dihydro-6-hydroxymethylpterin- pyroph 100.0
1f9y_A158 HPPK, protein (6-hydroxymethyl-7,8-dihydropterin p 100.0
2qx0_A159 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokina 100.0
3ip0_A158 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 100.0
2cg8_A270 Dihydroneopterin aldolase 6-hydroxymethyl-7,8- dih 100.0
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 100.0
4djd_C 446 C/Fe-SP, corrinoid/iron-sulfur protein large subun 99.91
2h9a_A 445 Carbon monoxide dehydrogenase corrinoid/iron- sulf 99.89
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 99.17
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 97.89
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 97.83
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 97.79
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.79
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 97.72
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 97.54
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 97.54
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 97.37
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 97.37
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 97.35
3ble_A337 Citramalate synthase from leptospira interrogans; 97.32
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 97.17
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 97.15
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.07
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 97.06
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 97.05
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 97.0
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 96.92
1ujp_A271 Tryptophan synthase alpha chain; riken structural 96.87
3tha_A252 Tryptophan synthase alpha chain; structural genomi 96.79
4g9p_A 406 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 96.56
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 96.49
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 96.39
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 96.36
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 96.32
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 96.27
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 96.25
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 96.2
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 96.15
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 95.8
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 95.69
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 95.64
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 95.6
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 95.45
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 95.42
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 95.35
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 95.11
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 94.94
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 94.76
1viz_A240 PCRB protein homolog; structural genomics, unknown 94.75
3g8r_A 350 Probable spore coat polysaccharide biosynthesis P; 94.64
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 94.5
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 94.48
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 94.36
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 94.26
3rmj_A 370 2-isopropylmalate synthase; LEUA, truncation, neis 94.13
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 93.92
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 93.9
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 93.83
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 93.81
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 93.8
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 93.76
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 93.63
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 93.58
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 93.43
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 93.34
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.13
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 92.92
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 92.85
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 92.75
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 92.47
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 92.24
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KD 91.91
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 91.89
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 91.85
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 91.72
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 91.57
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 91.57
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 91.54
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 91.52
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 91.18
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 91.15
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 91.14
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 91.12
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 91.11
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 91.04
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 90.69
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 90.68
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 90.55
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 90.5
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 90.48
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 90.47
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 90.46
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 90.4
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 90.29
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 90.16
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 90.15
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 90.02
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 90.0
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 89.97
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 89.88
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 89.78
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 89.44
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 89.32
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 89.21
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 89.2
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 89.14
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 89.01
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 89.0
3kws_A287 Putative sugar isomerase; structural genomics, joi 88.98
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 88.89
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 88.77
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 88.74
2inf_A359 URO-D, UPD, uroporphyrinogen decarboxylase; (alpha 88.61
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 88.53
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 88.48
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 88.47
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 88.37
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 88.34
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 88.31
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 88.26
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 88.13
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 88.03
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 87.9
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 87.89
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 87.85
3rys_A343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 87.66
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 87.61
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 87.5
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 87.39
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 87.29
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 87.28
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 87.14
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 87.01
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 86.93
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 86.91
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 86.88
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 86.75
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 86.75
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 86.62
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 86.59
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 86.51
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 86.36
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 86.36
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 86.31
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 86.27
3cyv_A354 URO-D, UPD, uroporphyrinogen decarboxylase; alpha/ 86.18
3cqj_A295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre 86.17
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 86.16
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 85.95
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 85.79
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 85.78
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 85.73
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 85.6
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 85.33
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 85.27
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 85.21
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 85.1
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 85.01
2o56_A407 Putative mandelate racemase; dehydratase, structur 84.99
3qc0_A275 Sugar isomerase; TIM barrel, structural genomics, 84.97
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 84.87
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 84.84
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 84.82
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 84.68
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 84.55
4ay7_A348 Methylcobalamin\: coenzyme M methyltransferase; TI 84.53
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 84.28
2eja_A338 URO-D, UPD, uroporphyrinogen decarboxylase; dimer, 84.2
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 84.19
4exq_A368 UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid 83.94
1j93_A353 UROD, uroporphyrinogen decarboxylase; beta barrel, 83.93
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 83.76
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 83.68
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 83.45
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 83.23
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 83.06
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 83.0
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 83.0
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 82.69
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 82.64
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 82.42
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 82.26
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 82.19
3qxb_A316 Putative xylose isomerase; structural genomics, jo 82.11
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 82.03
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 81.92
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 81.91
3feq_A423 Putative amidohydrolase; unknown source, sargasso 81.41
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 81.39
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 81.32
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 80.52
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 80.49
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 80.31
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 80.3
1p1j_A533 Inositol-3-phosphate synthase; 1L-MYO-inositol 1-p 80.25
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 80.23
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 80.1
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 80.02
>2bmb_A Folic acid synthesis protein FOL1; folate biosynthesis, transferase, ligase, multifunctional enzyme; HET: PMM; 2.3A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=5.2e-116  Score=936.64  Aligned_cols=433  Identities=34%  Similarity=0.574  Sum_probs=382.2

Q ss_pred             ceeEEEEeCCCcccHHHHHHHHHHHHHhc-CCcEEEeeCcEEeCCCCCCCCccceeeeeeeccCCCHHHHHHHHHHHHH-
Q 038230           43 EQEVVIAMGSNVGDRLCNFNEALQLMKKL-GVNITRHGCLYETEPAYVTDQPRFLNSAVRGVTKLGPHELLGVLKKIEK-  120 (480)
Q Consensus        43 ~~~~~l~LGSN~gd~~~~i~~A~~~L~~~-~~~i~~~S~~y~T~P~g~~~q~~F~N~v~~~~T~l~p~~Ll~~lk~IE~-  120 (480)
                      ++++|||||||+||+.+|+++|++.|++. +..++.+|++|+|+|||+.+||+|+|+|+.++|+|+|.+|++.||+||+ 
T Consensus        18 ~~~~~iaLGSNlGd~~~~l~~A~~~L~~~~~~~~~~~S~~yeT~P~g~~~q~~FlN~v~~~~T~l~p~~LL~~l~~IE~~   97 (545)
T 2bmb_A           18 WKRAFLAFGSNIGDRFKHIQMALQLLSREKTVKLRNISSIFESEPMYFKDQTPFMNGCVEVETLLTPSELLKLCKKIEYE   97 (545)
T ss_dssp             CEEEEEEEEECSSSHHHHHHHHHHHHHHSTTEEEEEECCEEEECCSSCTTSCCEEEEEEEEEESSCHHHHHHHHHHHHHH
T ss_pred             cceEEEEEcCCcccHHHHHHHHHHHHHhCCCCceeEecCcEEeCCCCCCCCCCceeEEEEEEeCCCHHHHHHHHHHHHHH
Confidence            57899999999999999999999999998 6788999999999999999999999999999999999999999999999 


Q ss_pred             HcCCCCCCCCCCCccchhhccc-----CCeeeeCCCccccccccccchhhhhhhhhhhC-CCcccccc------ccCCcc
Q 038230          121 DMGRTNGIRHGPRPIDLDILFY-----GRFSIHSDTLTVPHERIWERPFVVAPLLDLLG-SSVESDTK------LGGESL  188 (480)
Q Consensus       121 ~~GR~r~~~~~~r~iDiDIl~~-----~~~~~~~~~l~iPHp~~~~R~fVl~pl~el~~-~~~~p~~~------~~~~~~  188 (480)
                      ++||+|..||||||||||||+|     ++.++++++|+||||++++|+|||.||+||+| +++||...      +..+..
T Consensus        98 ~~GR~R~~rwgpRtlDLDIL~y~~~~~~~~~~~~~~L~lPHP~~~eR~FVL~PL~ei~p~~~~~P~~~~~i~~ll~~l~~  177 (545)
T 2bmb_A           98 ELQRVKHFDNGPRTIDLDIVMFLNSAGEDIIVNEPDLNIPHPRMLERTFVLEPLCELISPVHLHPVTAEPIVDHLKQLYD  177 (545)
T ss_dssp             HTTC---------CCEEEEEEEECTTSCBCCEECSSCEESCTTGGGCHHHHHHHTTTSCTTCBCTTTCSBHHHHHHHHHH
T ss_pred             HcCCccccCCCCceeeeeeecccccCCCCeEecCCCCCCCChhhhhCcHHHHHHHHhCcccccCCCCCccHHHHHHhCcc
Confidence            9999999999999999999999     99999999999999999999999999999999 99999511      111111


Q ss_pred             ccc--cCcccccccccc-----------------------ccCCCCCcEEEEEEecCCCCCCCCCccC-CHHHHHHHHHH
Q 038230          189 IGK--EGMKRVLPIGNL-----------------------LWDWSLKTSVMGILNLTPDSFSDGGKFQ-SVEAAVSQVRL  242 (480)
Q Consensus       189 ~q~--~~i~r~~~~~~~-----------------------~~~~~~~~~imGIlN~tpDSFsdgg~~~-~~e~a~~~A~~  242 (480)
                      .+.  +.+++++++++.                       .+.++.+|+||||||+|||||||||+|. +.+.|+++|++
T Consensus       178 ~~~~~~~l~~~~pl~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~iMGIlNvTPDSFsDGG~~~~~~~~al~~a~~  257 (545)
T 2bmb_A          178 KQHDEDTLWKLVPLPYRSGVEPRFLKFKTATKLDEFTGETNRITVSPTYIMAIFNATPDSFSDGGEHFADIESQLNDIIK  257 (545)
T ss_dssp             TCCGGGCEEEEEEECCCTTSCCEEEEEEEEEC-------CCEEECSCCEEEEEEECSCSSTTTTTTTTTCHHHHHHHHHH
T ss_pred             cccccccceeeccccccccccccchhccccccccccccccccccCCCCeEEEEEeCCCCCCcCCCcCcCCHHHHHHHHHH
Confidence            000  234444544311                       1124578999999999999999999998 99999999999


Q ss_pred             HHHcC-----CCEEEeCCCCCCCCCCCCCHHHHHHHHHHHHHHHHcC--CcCCCCeEEEeCCCHHHHHHHHHcCCCEEec
Q 038230          243 MISEG-----ADMIDIGAQSTRPMATKISAEKELERLIPVLEAVLTM--PEMEGKLVSVDTFYSKVASEAVGKGAHIVND  315 (480)
Q Consensus       243 ~v~~G-----AdiIDIG~eStrP~a~~v~~~eE~~rl~~vi~~l~~~--~~~~~~pISIDT~~~~v~~aaL~~G~~iINd  315 (480)
                      |+++|     ||||||||+|||||+++||++||++|++|+|+++++.  ....++|||||||+++|+++||++|++||||
T Consensus       258 mv~~G~~~~~AdIIDIGgeSTRPGa~~vs~eEEl~RvvpvI~~i~~~~~~~~~~vpISIDT~~a~VaeaAl~aGadIIND  337 (545)
T 2bmb_A          258 LCKDALYLHESVIIDVGGCSTRPNSIQASEEEEIRRSIPLIKAIRESTELPQDKVILSIDTYRSNVAKEAIKVGVDIIND  337 (545)
T ss_dssp             HHHHHHTTCSCEEEEEECSCCSTTCCCCCHHHHHHHHHHHHHHHHHCSSSCGGGEEEEEECCCHHHHHHHHHTTCCEEEE
T ss_pred             HHHcCCCCCCceEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHhhccccCCCCeEEEeCCcHHHHHHHHHcCCCEEEe
Confidence            99999     9999999999999999999999999999999999861  1113799999999999999999999999999


Q ss_pred             CCCCCCCchHHHHHHhc-CCCEEEEcCCCCCCccccccccchh--------------------------hHHHHHHHHHH
Q 038230          316 VSAGQLDPDMYKVVAGL-KVPYVAMHMRGDPSTMQNEENLQYD--------------------------DVCKQVASELY  368 (480)
Q Consensus       316 Vsg~~~d~~m~~l~~~~-~~~vVlmh~~g~p~~~~~~~~~~~~--------------------------~v~~ev~~~l~  368 (480)
                      |||+..|++|++++++| +|+||+||++|+|+||++++.|..+                          +++.++..+|.
T Consensus       338 Vsg~~~d~~m~~vva~~~~~~vVlmH~rG~p~tm~~~~~y~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~vv~~v~~~l~  417 (545)
T 2bmb_A          338 ISGGLFDSNMFAVIAENPEICYILSHTRGDISTMNRLAHYENFALGDSIQQEFVHNTDIQQLDDLKDKTVLIRNVGQEIG  417 (545)
T ss_dssp             TTTTSSCTTHHHHHHTCTTSEEEEECCCSCTTTGGGCCCCSSCTTTTTEEEEEETTEEGGGSTTHHHHCHHHHHHHHHHH
T ss_pred             CCCCcCChHHHHHHHHhCCCeEEEECCCCCCCCccccccccccccccccchhccccccccccccccccchHHHHHHHHHH
Confidence            99998789999999999 9999999999999999987654311                          29999999999


Q ss_pred             HHHHHHHHCCCCCCCEEEecCCCCccChhHHHHHHHhc---cc----------------CCCcEEEeeccccccccccCC
Q 038230          369 SKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGL---AA----------------SHAPILIGPSRKRFLGEICNR  429 (480)
Q Consensus       369 ~~i~~a~~~Gi~~~~IilDPgiGf~k~~~~~~~~lr~l---~~----------------~g~Pil~G~SrKsfi~~v~g~  429 (480)
                      +++++|.++||++|+||+|||+||+|+.+||+++|+++   +.                +|+|+|+|+|||||||.++|.
T Consensus       418 ~~i~~a~~~GI~~~~IilDPGiGF~Kt~~~nl~lL~~l~~l~~~~~~~~~~~~~~~~~~~g~PvLvG~SRKsFig~l~g~  497 (545)
T 2bmb_A          418 ERYIKAIDNGVKRWQILIDPGLGFAKTWKQNLQIIRHIPILKNYSFTMNSNNSQVYVNLRNMPVLLGPSRKKFIGHITKD  497 (545)
T ss_dssp             HHHHHHHHTTCCGGGEEEECCTTSSCCHHHHHHHHHTHHHHTTEEEEEEETTEEEEEECTTCCBEECCTTCHHHHHHHTC
T ss_pred             HHHHHHHHcCCCHHHEEEeCCCCcccChHHHHHHHHHHHHHHhhhccccccccccccccCCCCEEEEeccHHHHHHhcCC
Confidence            99999999999999999999999999999999999998   33                389999999999999999998


Q ss_pred             CCcCcccHHHHHHHHHHHHcCCcEEEcCChHHHHHHHHHHHHHHhh
Q 038230          430 PSADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTR  475 (480)
Q Consensus       430 ~~~~~r~~~t~a~~~~a~~~Ga~IlRvHdV~e~~~al~~~~ai~~~  475 (480)
                      +++.+|+++|++++++|+.+||+|+|||||+|+++|++|++++++.
T Consensus       498 ~~~~~R~~~T~a~~~~a~~~Ga~IvRVHDV~e~~~a~~~~~ai~~~  543 (545)
T 2bmb_A          498 VDAKQRDFATGAVVASCIGFGSDMVRVHDVKNCSKSIKLADAIYKG  543 (545)
T ss_dssp             CSGGGGHHHHHHHHHHHHHTTCSEEEESCHHHHHHHHHHHHHHHHC
T ss_pred             CChHHhhHHHHHHHHHHHHCCCcEEEcCCHHHHHHHHHHHHHHHhh
Confidence            6678999999999999999999999999999999999999999753



>3mcm_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/dihydropteroate...; folate, TIM barrel, synthase, HPPK, DHPS; 2.20A {Francisella tularensis subsp} PDB: 3mcn_A* 3mco_A* Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>3qbc_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase; protein-inhibitor complex, ferredoxin-like fold; HET: B55; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1cbk_A Protein (7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase); transferase; HET: ROI; 2.02A {Haemophilus influenzae} SCOP: d.58.30.1 Back     alignment and structure
>1f9y_A HPPK, protein (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase); pyrophosphoryl transfer, catalytic mechanism, folate, ternary complex; HET: APC HHR; 0.89A {Escherichia coli} PDB: 1eq0_A 1dy3_A* 1ex8_A* 1eqm_A* 1hka_A 1q0n_A* 1rao_A* 1rb0_A* 2f63_A 2f65_A 3h4a_A* 3ip0_A* 3ud5_A* 3ude_A* 3udv_A* 4f7v_A* 3kue_A 3hd2_A* 1f9h_A* 1g4c_A ... Back     alignment and structure
>2qx0_A 7,8-dihydro-6-hydroxymethylpterin- pyrophosphokinase; 3-layered alpha-BATA-alpha fold, homodimer, ternary complex, transferase; HET: APC PH2; 1.80A {Yersinia pestis} Back     alignment and structure
>3ip0_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase; alpha beta, ATP-binding, folate biosynthesis, nucleotide-binding; HET: APC HHR HHS; 0.89A {Escherichia coli} PDB: 1eq0_A 1dy3_A* 1ex8_A* 1hka_A 1eqm_A* 1rao_A* 1rb0_A* 2f63_A 2f65_A 1q0n_A* 3ud5_A* 3ude_A* 3udv_A* 4f7v_A* 3kue_A 3hd2_A* 1f9h_A* 1g4c_A 1kbr_A 1hq2_A* ... Back     alignment and structure
>2cg8_A Dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase; lyase/transferase, folate biosynthesis, pyrophosphokinase, lyase; 2.9A {Streptococcus pneumoniae} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>4djd_C C/Fe-SP, corrinoid/iron-sulfur protein large subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_C* 4djf_C* Back     alignment and structure
>2h9a_A Carbon monoxide dehydrogenase corrinoid/iron- sulfur protein, gamma subunit; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_A* Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>4g9p_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; oxidoreductase, isoprenoid biosynthesis, non mevalonate PATH iron-sulphur-cluster; HET: CDI MES; 1.55A {Thermus thermophilus} PDB: 2y0f_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>2inf_A URO-D, UPD, uroporphyrinogen decarboxylase; (alpha-beta)8 barrel, eight parallel beta strands surrounded by eight alpha helices, lyase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3cyv_A URO-D, UPD, uroporphyrinogen decarboxylase; alpha/beta barrel, cytoplasm, lyase, porphyrin biosynthesis; 2.80A {Shigella flexneri} Back     alignment and structure
>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2eja_A URO-D, UPD, uroporphyrinogen decarboxylase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>4exq_A UPD, URO-D, uroporphyrinogen decarboxylase; ssgcid, NIH, SBRI, heme biosynthesis, structural GENO niaid; 1.65A {Burkholderia thailandensis} Back     alignment and structure
>1j93_A UROD, uroporphyrinogen decarboxylase; beta barrel, plastidial enzyme, crystallographic dimer, lyase; 2.30A {Nicotiana tabacum} SCOP: c.1.22.1 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1p1j_A Inositol-3-phosphate synthase; 1L-MYO-inositol 1-phosphate, NADH, isomerase, rossmann fold; HET: NAI; 1.70A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.3 PDB: 1jkf_A* 1la2_A* 1p1f_A 1jki_A* 1p1i_A* 1p1h_A* 1p1k_A* 1rm0_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 480
d1ajza_282 c.1.21.1 (A:) Dihydropteroate synthetase {Escheric 2e-67
d1eyea_270 c.1.21.1 (A:) Dihydropteroate synthetase {Mycobact 1e-64
d1tx2a_273 c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus 9e-63
d1ad1a_264 c.1.21.1 (A:) Dihydropteroate synthetase {Staphylo 7e-60
d1cbka_160 d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin p 7e-25
d1f9ya_158 d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin p 6e-22
d1f6ya_262 c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/ir 7e-21
d3bofa1260 c.1.21.2 (A:301-560) Cobalamin-dependent methionin 1e-09
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Length = 282 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Dihydropteroate synthetase-like
family: Dihydropteroate synthetase
domain: Dihydropteroate synthetase
species: Escherichia coli [TaxId: 562]
 Score =  216 bits (550), Expect = 2e-67
 Identities = 106/288 (36%), Positives = 166/288 (57%), Gaps = 13/288 (4%)

Query: 194 MKRVLPIGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDI 253
           MK  L       D S    VMGILN+TPDSFSDGG   S+  AV    LMI+ GA +ID+
Sbjct: 1   MK--LFAQGTSLDLS-HPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDV 57

Query: 254 GAQSTRPMATKISAEKELERLIPVLEAVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIV 313
           G +STRP A ++S E+EL+R+IPV+EA+    E+    +SVDT   +V  E+   GAHI+
Sbjct: 58  GGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEV---WISVDTSKPEVIRESAKVGAHII 114

Query: 314 NDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDVCKQVASELYSKVRD 373
           ND+ +      +        +P   MHM+G+P TMQ  E  +YDDV  +V      ++  
Sbjct: 115 NDIRSLSEPGALEAAAET-GLPVCLMHMQGNPKTMQ--EAPKYDDVFAEVNRYFIEQIAR 171

Query: 374 AELSGIPAWRIIIDPGLGFSKKAEHNLDILLGL---AASHAPILIGPSRKRFLGEICNRP 430
            E +GI   ++++DPG GF K   HN  +L  L      + P+L+G SRK  +G++ N  
Sbjct: 172 CEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVG 231

Query: 431 SADERDPATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKS 478
              ER   ++A      + GA+I+RVH++++ ++A+++ ++ L+ +++
Sbjct: 232 -PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKEN 278


>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 270 Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Length = 273 Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Length = 264 Back     information, alignment and structure
>d1cbka_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Haemophilus influenzae [TaxId: 727]} Length = 160 Back     information, alignment and structure
>d1f9ya_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]} Length = 158 Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Length = 262 Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 100.0
d1eyea_270 Dihydropteroate synthetase {Mycobacterium tubercul 100.0
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 100.0
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 100.0
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 100.0
d1f6ya_262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 100.0
d1cbka_160 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinas 100.0
d1f9ya_158 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinas 100.0
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 96.46
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 96.42
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 96.38
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 96.37
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 96.23
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 96.07
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 95.93
d1vlia2295 Spore coat polysaccharide biosynthesis protein Sps 94.71
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 94.35
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 93.35
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 93.28
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 93.04
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 92.32
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 92.19
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 91.13
d1o60a_281 3-deoxy-D-manno-octulosonate 8-phosphate synthase 89.82
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 88.84
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 88.39
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 88.13
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 88.05
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 87.97
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 86.81
d1j93a_343 Uroporphyrinogen decarboxylase, UROD {Tobacco (Nic 85.54
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 84.82
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 84.7
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 83.44
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 83.02
d1r3sa_356 Uroporphyrinogen decarboxylase, UROD {Human (Homo 82.96
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 82.6
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 81.97
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 81.85
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 80.37
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 80.02
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Dihydropteroate synthetase-like
family: Dihydropteroate synthetase
domain: Dihydropteroate synthetase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=5.1e-80  Score=611.68  Aligned_cols=271  Identities=38%  Similarity=0.645  Sum_probs=256.9

Q ss_pred             ccccccCCCCCcEEEEEEecCCCCCCCCCccCCHHHHHHHHHHHHHcCCCEEEeCCCCCCCCCCCCCHHHHHHHHHHHHH
Q 038230          200 IGNLLWDWSLKTSVMGILNLTPDSFSDGGKFQSVEAAVSQVRLMISEGADMIDIGAQSTRPMATKISAEKELERLIPVLE  279 (480)
Q Consensus       200 ~~~~~~~~~~~~~imGIlN~tpDSFsdgg~~~~~e~a~~~A~~~v~~GAdiIDIG~eStrP~a~~v~~~eE~~rl~~vi~  279 (480)
                      .+++.++++ +|+||||||+|||||||||+|.+.++|+++|++|+++|||||||||||||||+++|+++|||+|+.|+|+
T Consensus         5 ~~~~~l~l~-~P~IMGIlNvTPDSFsdgg~~~~~~~a~~~a~~mi~~GAdiIDIGgeSTrPga~~vs~eeE~~Rl~pvi~   83 (282)
T d1ajza_           5 AQGTSLDLS-HPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVE   83 (282)
T ss_dssp             ETTEEEETT-SCEEEEEEECCTTTSTTTTCSSHHHHHHHHHHHHHHHTCSEEEEESSCCSTTCCCCCHHHHHHHHHHHHH
T ss_pred             ECCEEecCC-CCeEEEEEeCCCCCCCCCCcCCCHHHHHHHHHHHHHCCCCEEEECCccccccccCCcHHHHHHHHHHHHH
Confidence            456677885 7899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCcCCCCeEEEeCCCHHHHHHHHHcCCCEEecCCCCCCCchHHHHHHhcCCCEEEEcCCCCCCccccccccchhhH
Q 038230          280 AVLTMPEMEGKLVSVDTFYSKVASEAVGKGAHIVNDVSAGQLDPDMYKVVAGLKVPYVAMHMRGDPSTMQNEENLQYDDV  359 (480)
Q Consensus       280 ~l~~~~~~~~~pISIDT~~~~v~~aaL~~G~~iINdVsg~~~d~~m~~l~~~~~~~vVlmh~~g~p~~~~~~~~~~~~~v  359 (480)
                      .|++.   .+++||||||+++|+++||++|++|||||+|+. +++|+++++++++++|+||++|.|++|+..+  .|+++
T Consensus        84 ~l~~~---~~~~iSIDT~~~eVa~~al~~Ga~iINDvsg~~-~~~~~~~va~~~~~~vlmh~~g~p~~~~~~~--~y~dv  157 (282)
T d1ajza_          84 AIAQR---FEVWISVDTSKPEVIRESAKVGAHIINDIRSLS-EPGALEAAAETGLPVCLMHMQGNPKTMQEAP--KYDDV  157 (282)
T ss_dssp             HHHHH---CCCEEEEECCCHHHHHHHHHTTCCEECCTTTTC-STTHHHHHHHHTCCEEEECCSSCTTCCSCCC--CCSCH
T ss_pred             HHhhc---ccceEEEEecChHHHHHHHhcCceEEechhhcc-cchhHHHhhccCceEEEeccCCCccccccCC--cccch
Confidence            99865   378999999999999999999999999999876 8999999999999999999999999999865  47899


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCEEEecCCCCccChhHHHHHHHhc---ccCCCcEEEeeccccccccccCCCCcCccc
Q 038230          360 CKQVASELYSKVRDAELSGIPAWRIIIDPGLGFSKKAEHNLDILLGL---AASHAPILIGPSRKRFLGEICNRPSADERD  436 (480)
Q Consensus       360 ~~ev~~~l~~~i~~a~~~Gi~~~~IilDPgiGf~k~~~~~~~~lr~l---~~~g~Pil~G~SrKsfi~~v~g~~~~~~r~  436 (480)
                      +.++.++|.++++.|.++||++++||+|||+||+|+.+||+++++++   +.+++|+|+|+|||||++.+++.+ +++|+
T Consensus       158 ~~~v~~~~~~~~~~~~~~GI~~~~IilDPGiGFgK~~~~n~~ll~~l~~~~~~~~PiLvG~SRKsfi~~~~~~~-~~~R~  236 (282)
T d1ajza_         158 FAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVG-PSERL  236 (282)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCGGGEEEECCTTSSCCHHHHHHHHHTGGGGGGGCSCBEECCTTCHHHHHHHTCC-GGGCH
T ss_pred             hhhhHHHHHHHHHHHHHcCCcHhhEecCCCcCcCCChhhhHHHHhhcchhhccccceEEeccHHHHHHHHhCCC-hhhhc
Confidence            99999999999999999999999999999999999999999999998   467999999999999999999985 78999


Q ss_pred             HHHHHHHHHHHHcCCcEEEcCChHHHHHHHHHHHHHHhhhhc
Q 038230          437 PATIASITAGVLGGANIVRVHNIRDNLDAVKLCDSMLTRRKS  478 (480)
Q Consensus       437 ~~t~a~~~~a~~~Ga~IlRvHdV~e~~~al~~~~ai~~~~~~  478 (480)
                      ++|++++++|+.+||+|+|||||+|+++++++++++++.+.+
T Consensus       237 ~~T~a~~~~a~~~Ga~iiRVHdV~e~~~a~~v~~ai~~~~~~  278 (282)
T d1ajza_         237 SGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKEN  278 (282)
T ss_dssp             HHHHHHHHHHHHTTCSEEEESCHHHHHHHHHHHHHHHHTSTT
T ss_pred             hhHHHHHHHHHHCCCCEEEeCCHHHHHHHHHHHHHHHhcccc
Confidence            999999999999999999999999999999999999877654



>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1cbka_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f9ya_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o60a_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1j93a_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Tobacco (Nicotiana tabacum), UROD-III [TaxId: 4097]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r3sa_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure