Citrus Sinensis ID: 038273


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620---
FQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRACM
cccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccEEccHHHHHccccccEEEcccccccEEccccccccccccEEEccccccEEcccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEccccEEEEcccccccccccccEEEccccccEEEcccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHHccccccEEEccccEEcccccccccccccccEEEcccccccccccHHHHHHccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHHHccccccEEccccccccccccHHHHccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHEEEEEEEEEEEccccccccc
ccccHcHccHHccccEEEEEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEEccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHccHHHHHHHccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccEccc
fqipfslepffnnsklkvfsgECNEIFVesesshsmtpkfqlesvklsgsgihatfpkflynqhdleyvdfsdsnlkgefpnwllenntnlntLVLRnnslsgpfrmpiqphwhldtlhvsknffqgnipleigvyfPRLVYLnlsrndfngsipssigdmnslkfldlshnqltgeipehlVIGCFNLEYLVLSenslhgqlfyKKIYLRKLARLHldanyctgeipkslsncspleglymsdnnlygnipawlgnlsSLNDIMMAINHlqgpiplefcqlnYLEIldlsennisgtlpscsshstiQQVHLsknmlygplkygtffnrssivtldlsynsfsgnipYWIERLTRLRYLILANnnlegevpnqlcrLKQLRLidlsnnnlfgqipgcldntslhnngdndgssaptrykgkplnkmygvdlscnkltgeippqigkltsiralnfshnnltgvipvsfsnlkqvESLDVSynnlngkippqlVELNVLAVFSVAHnnlsgkipewtAQFTtfkedsyegnpllcgkplpdcdvaavpeasneedgnslidmgsfyiTFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDnliptrfyracm
fqipfslepffnnsklkvFSGECNEIFVEsesshsmtpKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPeasneedgnsLIDMGSFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRACM
FQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPnwllenntnlntlvlrnnslSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRACM
********PFFNNSKLKVFSGECNEIFV****************VKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDN**********************LNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAV**********SLIDMGSFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRA**
FQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNN*******APTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGK**************************SFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRAC*
FQIPFSLEPFFNNSKLKVFSGECNEIFVE********PKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRACM
FQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRACM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTSCFYFIVDNLIPTRFYRACM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query623 2.2.26 [Sep-21-2011]
Q9SHI2 1101 Leucine-rich repeat recep no no 0.881 0.498 0.320 8e-58
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.812 0.404 0.299 1e-57
Q9FL28 1173 LRR receptor-like serine/ no no 0.789 0.419 0.324 3e-57
Q9LJF3 1164 Receptor-like protein kin no no 0.914 0.489 0.295 3e-57
Q9ZWC8 1166 Serine/threonine-protein no no 0.853 0.456 0.301 8e-57
Q9LYN8 1192 Leucine-rich repeat recep no no 0.735 0.384 0.320 2e-55
Q8L899 1207 Systemin receptor SR160 O N/A no 0.836 0.431 0.304 7e-55
P93194 1109 Receptor-like protein kin N/A no 0.751 0.422 0.334 8e-55
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.850 0.439 0.303 1e-54
O22476 1196 Protein BRASSINOSTEROID I no no 0.759 0.395 0.315 2e-54
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function desciption
 Score =  225 bits (573), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 189/590 (32%), Positives = 287/590 (48%), Gaps = 41/590 (6%)

Query: 35  SMTPKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTL 94
           SM    QL  ++   +G     P  +     L+ +  +++ L+G  P  L E   NL  L
Sbjct: 182 SMAKLRQLRIIRAGRNGFSGVIPSEISGCESLKVLGLAENLLEGSLPKQL-EKLQNLTDL 240

Query: 95  VLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSI 154
           +L  N LSG     +     L+ L + +N+F G+IP EIG    ++  L L  N   G I
Sbjct: 241 ILWQNRLSGEIPPSVGNISRLEVLALHENYFTGSIPREIG-KLTKMKRLYLYTNQLTGEI 299

Query: 155 PSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLA 214
           P  IG++     +D S NQLTG IP+       NL+ L L EN L G +  +   L  L 
Sbjct: 300 PREIGNLIDAAEIDFSENQLTGFIPKEFG-HILNLKLLHLFENILLGPIPRELGELTLLE 358

Query: 215 RLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGP 274
           +L L  N   G IP+ L     L  L + DN L G IP  +G  S+ + + M+ N L GP
Sbjct: 359 KLDLSINRLNGTIPQELQFLPYLVDLQLFDNQLEGKIPPLIGFYSNFSVLDMSANSLSGP 418

Query: 275 IPLEFCQLNYLEILDLSENNISGTLP-SCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSI 333
           IP  FC+   L +L L  N +SG +P    +  ++ ++ L  N L G L     FN  ++
Sbjct: 419 IPAHFCRFQTLILLSLGSNKLSGNIPRDLKTCKSLTKLMLGDNQLTGSLPI-ELFNLQNL 477

Query: 334 VTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFG 393
             L+L  N  SGNI   + +L  L  L LANNN  GE+P ++  L ++   ++S+N L G
Sbjct: 478 TALELHQNWLSGNISADLGKLKNLERLRLANNNFTGEIPPEIGNLTKIVGFNISSNQLTG 537

Query: 394 QIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVD---LSCNKLTGEIP-------- 442
            IP  L +       D  G+   + Y  + L ++  ++   LS N+LTGEIP        
Sbjct: 538 HIPKELGSCVTIQRLDLSGNKF-SGYIAQELGQLVYLEILRLSDNRLTGEIPHSFGDLTR 596

Query: 443 ----------------PQIGKLTSIR-ALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNL 485
                            ++GKLTS++ +LN SHNNL+G IP S  NL+ +E L ++ N L
Sbjct: 597 LMELQLGGNLLSENIPVELGKLTSLQISLNISHNNLSGTIPDSLGNLQMLEILYLNDNKL 656

Query: 486 NGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVA 545
           +G+IP  +  L  L + ++++NNL G +P+ TA F      ++ GN  LC      C   
Sbjct: 657 SGEIPASIGNLMSLLICNISNNNLVGTVPD-TAVFQRMDSSNFAGNHGLCNSQRSHCQ-P 714

Query: 546 AVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPHW--RRR 593
            VP + ++   N LI+ GS      +   IVI ++  + ++   W  +RR
Sbjct: 715 LVPHSDSKL--NWLIN-GSQRQKILTITCIVIGSVFLITFLGLCWTIKRR 761





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query623
255581263 912 serine-threonine protein kinase, plant-t 0.951 0.650 0.511 1e-167
224142481 781 predicted protein [Populus trichocarpa] 0.953 0.760 0.487 1e-155
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.971 0.413 0.458 1e-140
224112245 876 predicted protein [Populus trichocarpa] 0.878 0.624 0.462 1e-140
224098008 1097 predicted protein [Populus trichocarpa] 0.963 0.546 0.460 1e-135
224073452710 predicted protein [Populus trichocarpa] 0.971 0.852 0.430 1e-132
224114135664 predicted protein [Populus trichocarpa] 0.953 0.894 0.428 1e-131
224073382 1309 predicted protein [Populus trichocarpa] 0.963 0.458 0.423 1e-130
224073436 1014 predicted protein [Populus trichocarpa] 0.971 0.596 0.423 1e-130
224142501561 predicted protein [Populus trichocarpa] 0.833 0.925 0.489 1e-130
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 325/635 (51%), Positives = 422/635 (66%), Gaps = 42/635 (6%)

Query: 1   FQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFL 60
           FQ+PFSL PFFN+S LK   G+ N I++E+E  HS  P+FQL S+  SG GI  TFP FL
Sbjct: 288 FQVPFSLGPFFNHSNLKHIRGQNNAIYLEAEL-HS-APRFQLISIIFSGYGICGTFPNFL 345

Query: 61  YNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHV 120
           Y+Q++L++VD S  +LKGEFPNWLL NNT L  L L NNSLSG  ++P+ PH +L  L +
Sbjct: 346 YHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDI 405

Query: 121 SKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPE 180
           S N    +IPLEIG + P+L  LN+S N F+GSIPSS G+MNSL+ LDLS+NQL+G IPE
Sbjct: 406 SNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPE 465

Query: 181 HLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGL 240
           HL  GCF+L  L+LS NSL GQ+F K+  L  L  L LD N+ +G IPKSLS  S L  +
Sbjct: 466 HLATGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK-SALSIM 524

Query: 241 YMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLP 300
            +SDN+L G IP W+GNLS L +++++ N L+GPIP+EFCQL+YLE+LDL+ N++SG LP
Sbjct: 525 DLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILP 584

Query: 301 SCSSHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYL 360
           SC S S+I  VHLS+NM+ GP     F     +VTLDLS N  +G IP  I  +  LR L
Sbjct: 585 SCLSPSSIIHVHLSQNMIEGPWT-NAFSGSHFLVTLDLSSNRITGRIPTLIGGINALRIL 643

Query: 361 ILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPT--- 417
            L +N  +GE+P Q+C L QL LI L++NNL G IP CL         D   S AP    
Sbjct: 644 NLKSNRFDGEIPAQICGLYQLSLIVLADNNLSGSIPSCLQ-------LDQSDSLAPDVPP 696

Query: 418 ------------------------RYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRA 453
                                    Y+GK L+ + G+D SCNKLTGEIPP++G  ++I +
Sbjct: 697 VPNPLNPYYLPVRPMYFTTKRRSYSYQGKILSYISGIDFSCNKLTGEIPPEMGNHSAIYS 756

Query: 454 LNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKI 513
           LN S+N  TG IP +FSNLKQ+ESLD+SYNNLNG IP QL+EL  L+ FSVAHNNL GK 
Sbjct: 757 LNLSYNRFTGPIPSTFSNLKQIESLDLSYNNLNGDIPSQLLELKFLSYFSVAHNNLFGKT 816

Query: 514 PEWTAQFTTFKEDSYEGNPLLCGKPLP----DCDVAAVPEASNEEDGNSLIDMGSFYITF 569
           P+ T QF TF+  SYEGNP LCG PLP    + + ++ P AS  ++ ++ +DM +FY +F
Sbjct: 817 PKRTGQFATFEVSSYEGNPNLCGLPLPKSCTEREASSAPRASAMDEESNFLDMNTFYGSF 876

Query: 570 TSSYVIVILAIIGVLYVNPHWRRRWFYLIENWMTS 604
             SY  VI+ +  VLY+NP WRR WF  ++  ++S
Sbjct: 877 IVSYTFVIIGMFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073452|ref|XP_002304097.1| predicted protein [Populus trichocarpa] gi|222841529|gb|EEE79076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114135|ref|XP_002332433.1| predicted protein [Populus trichocarpa] gi|222832402|gb|EEE70879.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142501|ref|XP_002324595.1| predicted protein [Populus trichocarpa] gi|222866029|gb|EEF03160.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query623
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.629 0.401 0.361 2.4e-91
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.638 0.446 0.342 2.6e-90
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.799 0.516 0.351 4.4e-68
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.884 0.551 0.332 4.1e-67
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.804 0.462 0.323 2.2e-63
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.935 0.642 0.319 3.8e-60
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.890 0.593 0.322 1.2e-57
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.760 0.427 0.332 5.6e-56
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.735 0.403 0.334 6e-56
TAIR|locus:2020457 1166 BRL1 "BRI1 like" [Arabidopsis 0.634 0.338 0.331 3.2e-35
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 544 (196.6 bits), Expect = 2.4e-91, Sum P(2) = 2.4e-91
 Identities = 145/401 (36%), Positives = 204/401 (50%)

Query:     5 FSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQH 64
             FSL P  N +KLKVF        ++ E+  +  PKFQL    L    +    P FL  Q 
Sbjct:   324 FSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSL-GKIPNFLVYQT 382

Query:    65 DLEYVDFSDSNLKGEFPXXXXXXXXXXXXXXXXXXXXSGPFRMPIQPHWHLDTLHVSKNF 124
             +L  VD S + L G+ P                    +  F++P   H  L  L  S N 
Sbjct:   383 NLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFT-IFQIPTIVH-KLQVLDFSAND 440

Query:   125 FQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVI 184
               G +P  IG   PRL+++N S N F G++PSS+G+MN + FLDLS+N  +GE+P  L+ 
Sbjct:   441 ITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLT 500

Query:   185 GCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSD 244
             GCF+L  L LS NS  G +   +  L  L  L +  N  TGEI   L     L     S+
Sbjct:   501 GCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASN 560

Query:   245 NNLYGNIPAWLGNLSS-LNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCS 303
             N L G I + +   SS L  ++++ N L+G +P     +++L  LDLS N +SG LPS  
Sbjct:   561 NRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSV 620

Query:   304 SHSTIQ-QVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLIL 362
              +S    ++ L  N   GPL   T    + I  LDL  N  SG+IP ++    ++  L+L
Sbjct:   621 VNSMYGIKIFLHNNSFTGPLPV-TLLENAYI--LDLRNNKLSGSIPQFVNT-GKMITLLL 676

Query:   363 ANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTS 403
               NNL G +P +LC L  +RL+DLS+N L G IP CL++ S
Sbjct:   677 RGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLS 717


GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020457 BRL1 "BRI1 like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181059
hypothetical protein (781 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-38
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  217 bits (553), Expect = 2e-60
 Identities = 169/558 (30%), Positives = 252/558 (45%), Gaps = 86/558 (15%)

Query: 42  LESVKLSGSGIHATFPK-FLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNS 100
           ++++ LS + +    P         L Y++ S++N  G  P   +    NL TL L NN 
Sbjct: 95  IQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSI---PNLETLDLSNNM 151

Query: 101 LSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVY----------------FPR----- 139
           LSG     I     L  L +  N   G IP  +                    PR     
Sbjct: 152 LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQM 211

Query: 140 --LVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSEN 197
             L ++ L  N+ +G IP  IG + SL  LDL +N LTG IP  L     NL+YL L +N
Sbjct: 212 KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG-NLKNLQYLFLYQN 270

Query: 198 SLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGN 257
            L G +      L+KL  L L  N  +GEIP+ +     LE L++  NN  G IP  L +
Sbjct: 271 KLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS 330

Query: 258 LSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPS--CSSHSTIQQVHLSK 315
           L  L  + +  N   G IP    + N L +LDLS NN++G +P   CSS +  + +  S 
Sbjct: 331 LPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFS- 389

Query: 316 NMLYG--PLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPN 373
           N L G  P   G      S+  + L  NSFSG +P    +L  + +L ++NNNL+G + +
Sbjct: 390 NSLEGEIPKSLGAC---RSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINS 446

Query: 374 QLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLS 433
           +   +  L+++ L+ N  FG +P            D+ GS            ++  +DLS
Sbjct: 447 RKWDMPSLQMLSLARNKFFGGLP------------DSFGSK-----------RLENLDLS 483

Query: 434 CNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQL 493
            N+ +G +P ++G L+ +  L  S N L+G IP   S+ K++ SLD+S+N L+G+IP   
Sbjct: 484 RNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASF 543

Query: 494 VELNVLAVFSVAHNNLSGKIPE-----------------------WTAQFTTFKEDSYEG 530
            E+ VL+   ++ N LSG+IP+                        T  F      +  G
Sbjct: 544 SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAG 603

Query: 531 NPLLCG----KPLPDCDV 544
           N  LCG      LP C  
Sbjct: 604 NIDLCGGDTTSGLPPCKR 621


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 623
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.49
PLN03150623 hypothetical protein; Provisional 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.74
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.34
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.0
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.98
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG4341483 consensus F-box protein containing LRR [General fu 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
PRK15386426 type III secretion protein GogB; Provisional 97.85
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.77
PRK15386426 type III secretion protein GogB; Provisional 97.72
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.96
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.64
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.56
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.5
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.04
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.33
KOG4308478 consensus LRR-containing protein [Function unknown 92.98
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.81
smart0037026 LRR Leucine-rich repeats, outliers. 92.51
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.51
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 92.17
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.64
smart0037026 LRR Leucine-rich repeats, outliers. 91.64
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.55
KOG4308478 consensus LRR-containing protein [Function unknown 89.97
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.42
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.01
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.96
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.1
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.1e-58  Score=527.51  Aligned_cols=522  Identities=32%  Similarity=0.487  Sum_probs=410.2

Q ss_pred             ccccCCCCCcEEECcCCccccccccccCCCCCCcccEEEccCCCCCCCCCcccCCCCCCcEEEccCCCCCCcCChHHhhC
Q 038273            8 EPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLEN   87 (623)
Q Consensus         8 ~~l~~l~~L~~L~ls~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~   87 (623)
                      +.+..+++|++|+|++|++.+..+... +..+.+|++|++++|.+++.+|.  +.+++|++|++++|.+++.+|..+ ..
T Consensus        87 ~~~~~l~~L~~L~Ls~n~~~~~ip~~~-~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~-~~  162 (968)
T PLN00113         87 SAIFRLPYIQTINLSNNQLSGPIPDDI-FTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDI-GS  162 (968)
T ss_pred             hHHhCCCCCCEEECCCCccCCcCChHH-hccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHH-hc
Confidence            467788888888888888765444321 11334888888888888777664  467888888888888887777764 78


Q ss_pred             CCCCCEEEccCCcCcCcCCCCCCCCCCCCEEEccCCCCCCCCChhhhhcCCCccEEecccCcccccCCcccCCCCCCCEE
Q 038273           88 NTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFL  167 (623)
Q Consensus        88 l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L  167 (623)
                      +++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+.. +++|+.|++++|.+.+.+|..+.++++|++|
T Consensus       163 l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  241 (968)
T PLN00113        163 FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQ-MKSLKWIYLGYNNLSGEIPYEIGGLTSLNHL  241 (968)
T ss_pred             CCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcC-cCCccEEECcCCccCCcCChhHhcCCCCCEE
Confidence            888888888888888888888888888888888888888778877766 6788888888888888888888888888888


Q ss_pred             EccCCcCCcccchHHhhCCCCCCEEEcccCcCccccccccccCCCCCEEecccccCccccCccCcCCCCCcEEECcCCcC
Q 038273          168 DLSHNQLTGEIPEHLVIGCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNL  247 (623)
Q Consensus       168 ~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l  247 (623)
                      ++++|.+++.+|..+ .++++|++|++++|.+.+..|..+.++++|+.|++++|.+.+..|..+..+++|+.|++++|.+
T Consensus       242 ~L~~n~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~  320 (968)
T PLN00113        242 DLVYNNLTGPIPSSL-GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNF  320 (968)
T ss_pred             ECcCceeccccChhH-hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCcc
Confidence            888888886677655 6788888888888888887888888888888888888888888888888888888888888888


Q ss_pred             ccccchhccCCCCCCEEECccccccccccccccCCCCCcEEeCcCccceeeCCCCC-CCCcccEEEccCccccccCCCCC
Q 038273          248 YGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCS-SHSTIQQVHLSKNMLYGPLKYGT  326 (623)
Q Consensus       248 ~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~-~~~~L~~L~l~~n~l~~~~~~~~  326 (623)
                      .+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|++.+.+|... ..++++.+++++|.+.+.++.. 
T Consensus       321 ~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~-  399 (968)
T PLN00113        321 TGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKS-  399 (968)
T ss_pred             CCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHH-
Confidence            88888888888888888888888888888888888888888888888887776654 5678888888888887777765 


Q ss_pred             ccCCCceeEEeCCCCcCCCCCchhhhccccCcEEEcccccccccCchhhcCCCCCCEEEccCCcCcCCCCCccccccccC
Q 038273          327 FFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHN  406 (623)
Q Consensus       327 ~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~l~~  406 (623)
                      +..+++|+.|++++|++++..|..+..+++|+.|++++|.+.+..+..+..+++|+.|++++|++.+..|..+....+..
T Consensus       400 ~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~  479 (968)
T PLN00113        400 LGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLEN  479 (968)
T ss_pred             HhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceE
Confidence            77788888888888888888888888888888888888888888887788888888888888888877777654433222


Q ss_pred             C--CCCCCCCCCccccCCCCCCccEEEccCCcccccCCccccccccCCeeeCCCCcccccCCccCCCCCCCcEEECCCCc
Q 038273          407 N--GDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNN  484 (623)
Q Consensus       407 ~--~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~  484 (623)
                      +  ..+......+ .....+++|+.|++++|.+.+.+|..+..+++|++|++++|.+++.+|..|..+++|+.|+|++|+
T Consensus       480 L~ls~n~l~~~~~-~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~  558 (968)
T PLN00113        480 LDLSRNQFSGAVP-RKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQ  558 (968)
T ss_pred             EECcCCccCCccC-hhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCc
Confidence            1  1111111111 112246678888888888888888888888888888888888888888888888888888888888


Q ss_pred             ccccCccccccCCCCCeeecccCcccccCCCCccccCCCCCccccCCCCCCCCC
Q 038273          485 LNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKP  538 (623)
Q Consensus       485 l~~~~p~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~l~l~~Np~~C~~~  538 (623)
                      +++.+|..+..+++|+.+++++|++.+.+|.. ..+.++....+.|||.+|+.+
T Consensus       559 l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        559 LSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCccccCCc
Confidence            88888888888888888888888888877764 356666777778888888643



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-52
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-31
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-52
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-31
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-17
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-12
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-06
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-06
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 1e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 6e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 204 bits (519), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 178/577 (30%), Positives = 259/577 (44%), Gaps = 104/577 (18%) Query: 42 LESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPXXXXXXXXXXXXXXXXXXXX 101 LE + +S + P FL + L+++D S + L G+F Sbjct: 202 LEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV 260 Query: 102 SGPFRMPIQPHWHLDTLHVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIG-- 159 GP +P P L L +++N F G IP + L L+LS N F G++P G Sbjct: 261 -GP--IPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSC 317 Query: 160 -----------------------DMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSE 196 M LK LDLS N+ +GE+PE L +L L LS Sbjct: 318 SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSS 377 Query: 197 NSLHGQLFYKKIYLRK--LARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAW 254 N+ G + K L L+L N TG+IP +LSNCS L L++S N L G IP+ Sbjct: 378 NNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS 437 Query: 255 LGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLS 314 LG+LS L D+ + +N L+G IP E + LE L L N+++G +PS S+ T Sbjct: 438 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT------- 490 Query: 315 KNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQ 374 ++ + LS N +G IP WI RL L L L+NN+ G +P + Sbjct: 491 -----------------NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAE 533 Query: 375 LCRLKQLRLIDLSNNNLFGQIPGCLDNTS---------------LHNNG---DNDGSSAP 416 L + L +DL+ N G IP + S + N+G + G+ Sbjct: 534 LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNL 593 Query: 417 TRYKG------------KPLN---KMYG---------------VDLSCNKLTGEIPPQIG 446 ++G P N ++YG +D+S N L+G IP +IG Sbjct: 594 LEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIG 653 Query: 447 KLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAH 506 + + LN HN+++G IP +L+ + LD+S N L+G+IP + L +L +++ Sbjct: 654 SMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSN 713 Query: 507 NNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCD 543 NNLSG IPE QF TF + NP LCG PLP CD Sbjct: 714 NNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLPRCD 749
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-132
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-98
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-56
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-61
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-52
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-67
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-54
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-49
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-55
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-50
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 9e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  406 bits (1045), Expect = e-132
 Identities = 160/540 (29%), Positives = 230/540 (42%), Gaps = 61/540 (11%)

Query: 9   PFFNNSKLKVFSGECNEI--FVESESSHSMTPKFQLESVKLSGSGIHATFPKFLYNQHDL 66
           P      L+  S   N+    +    S +      L  + LSG+  +   P F  +   L
Sbjct: 264 PPLPLKSLQYLSLAENKFTGEIPDFLSGACD---TLTGLDLSGNHFYGAVPPFFGSCSLL 320

Query: 67  EYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPI-QPHWHLDTLHVSKNFF 125
           E +  S +N  GE P   L     L  L L  N  SG     +      L TL +S N F
Sbjct: 321 ESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNF 380

Query: 126 QGNIPLEIG-VYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVI 184
            G I   +       L  L L  N F G IP ++ + + L  L LS N L+G IP  L  
Sbjct: 381 SGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL-G 439

Query: 185 GCFNLEYLVLSENSLHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSD 244
               L  L L  N L G++  + +Y++ L  L LD N  TGEIP  LSNC+ L  + +S+
Sbjct: 440 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSN 499

Query: 245 NNLYGNIPAWLGNLSSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSS 304
           N L G IP W+G L +L  + ++ N   G IP E      L  LDL+ N  +GT+P+   
Sbjct: 500 NRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAA-- 557

Query: 305 HSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILAN 364
                                  F +S      ++ N  +G    +I+     +    A 
Sbjct: 558 ----------------------MFKQS----GKIAANFIAGKRYVYIKNDGMKKECHGAG 591

Query: 365 N--NLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGK 422
           N    +G    QL RL      ++++    G      DN                     
Sbjct: 592 NLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDN--------------------- 630

Query: 423 PLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSY 482
               M  +D+S N L+G IP +IG +  +  LN  HN+++G IP    +L+ +  LD+S 
Sbjct: 631 -NGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSS 689

Query: 483 NNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDC 542
           N L+G+IP  +  L +L    +++NNLSG IPE   QF TF    +  NP LCG PLP C
Sbjct: 690 NKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETFPPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query623
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.19
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.22
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.21
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.95
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.73
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.46
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-64  Score=561.41  Aligned_cols=508  Identities=32%  Similarity=0.481  Sum_probs=450.6

Q ss_pred             CCcccEEEccCCCCCCCCCcccCCCCCCcEEEccCCCCCCcCChHHhhCCCCCCEEEccCCcCcCcCCCCCCCCCCCCEE
Q 038273           39 KFQLESVKLSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFPNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTL  118 (623)
Q Consensus        39 ~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L  118 (623)
                      +.+|++|++++|++.+.+|. ++++++|++|++++|.+++.+|..+ ..+++|++|++++|++++..|..  .+++|++|
T Consensus       199 l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L  274 (768)
T 3rgz_A          199 CVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI-STCTELKLLNISSNQFVGPIPPL--PLKSLQYL  274 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT-TTCSSCCEEECCSSCCEESCCCC--CCTTCCEE
T ss_pred             CCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH-hcCCCCCEEECCCCcccCccCcc--ccCCCCEE
Confidence            34899999999999887777 8999999999999999987777664 89999999999999998776654  88999999


Q ss_pred             EccCCCCCCCCChhhhhcCCCccEEecccCcccccCCcccCCCCCCCEEEccCCcCCcccchHHhhCCCCCCEEEcccCc
Q 038273          119 HVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENS  198 (623)
Q Consensus       119 ~l~~n~l~~~~p~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~  198 (623)
                      ++++|.+.+.+|..++..+++|++|++++|.+++..|..++++++|++|++++|.+++.+|...+..+++|++|++++|.
T Consensus       275 ~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~  354 (768)
T 3rgz_A          275 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE  354 (768)
T ss_dssp             ECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSE
T ss_pred             ECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCc
Confidence            99999999899999888778999999999999999999999999999999999999989999877899999999999999


Q ss_pred             CccccccccccCC-CCCEEecccccCccccCccCcC--CCCCcEEECcCCcCccccchhccCCCCCCEEECccccccccc
Q 038273          199 LHGQLFYKKIYLR-KLARLHLDANYCTGEIPKSLSN--CSPLEGLYMSDNNLYGNIPAWLGNLSSLNDIMMAINHLQGPI  275 (623)
Q Consensus       199 l~~~~~~~~~~~~-~L~~L~l~~n~~~~~~~~~~~~--l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~  275 (623)
                      +.+..|..+..++ +|+.|++++|.+++..+..+..  +++|++|++++|.+++..|..+..+++|++|++++|.+.+..
T Consensus       355 l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~  434 (768)
T 3rgz_A          355 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI  434 (768)
T ss_dssp             EEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCC
T ss_pred             cCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcc
Confidence            9988999998887 9999999999999888887776  889999999999999999999999999999999999999999


Q ss_pred             cccccCCCCCcEEeCcCccceeeCCCCC-CCCcccEEEccCccccccCCCCCccCCCceeEEeCCCCcCCCCCchhhhcc
Q 038273          276 PLEFCQLNYLEILDLSENNISGTLPSCS-SHSTIQQVHLSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERL  354 (623)
Q Consensus       276 ~~~~~~l~~L~~L~l~~n~~~~~~~~~~-~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l  354 (623)
                      |..+..+++|+.|++++|.+.+.+|... .+++|++|++++|.+.+.++.. +..+++|++|++++|++++..|.++..+
T Consensus       435 p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~-l~~l~~L~~L~L~~N~l~~~~p~~~~~l  513 (768)
T 3rgz_A          435 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG-LSNCTNLNWISLSNNRLTGEIPKWIGRL  513 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGG-GGGCTTCCEEECCSSCCCSCCCGGGGGC
T ss_pred             cHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHH-HhcCCCCCEEEccCCccCCcCChHHhcC
Confidence            9999999999999999999998777655 6899999999999998888876 8999999999999999999999999999


Q ss_pred             ccCcEEEcccccccccCchhhcCCCCCCEEEccCCcCcCCCCCccccccccCCCCCC-----------------------
Q 038273          355 TRLRYLILANNNLEGEVPNQLCRLKQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDND-----------------------  411 (623)
Q Consensus       355 ~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~l~~~~~~~-----------------------  411 (623)
                      ++|+.|++++|++.+.+|..+..+++|+.|++++|++.+.+|..+....-.......                       
T Consensus       514 ~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  593 (768)
T 3rgz_A          514 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNL  593 (768)
T ss_dssp             TTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEE
T ss_pred             CCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccc
Confidence            999999999999999999999999999999999999999999876543211000000                       


Q ss_pred             -------------------CCCCCcc------ccCCCCCCccEEEccCCcccccCCccccccccCCeeeCCCCcccccCC
Q 038273          412 -------------------GSSAPTR------YKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIP  466 (623)
Q Consensus       412 -------------------~~~~~~~------~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~  466 (623)
                                         .......      .....+++|+.||+++|++++.+|..++.+++|+.|+|++|.+++.+|
T Consensus       594 ~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip  673 (768)
T 3rgz_A          594 LEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP  673 (768)
T ss_dssp             EECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             cccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCC
Confidence                               0000000      012346789999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCcEEECCCCcccccCccccccCCCCCeeecccCcccccCCCCccccCCCCCccccCCCCCCCCCCCCCCCCC
Q 038273          467 VSFSNLKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAA  546 (623)
Q Consensus       467 ~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~l~l~~Np~~C~~~l~~C~~~~  546 (623)
                      ..++++++|+.|||++|++++.+|..+..+++|++|++++|+++|.+|+.. ++.++...++.|||.+||.+++.|....
T Consensus       674 ~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~-~~~~~~~~~~~gN~~Lcg~~l~~C~~~~  752 (768)
T 3rgz_A          674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMG-QFETFPPAKFLNNPGLCGYPLPRCDPSN  752 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSS-SGGGSCGGGGCSCTEEESTTSCCCCSCC
T ss_pred             hHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCch-hhccCCHHHhcCCchhcCCCCcCCCCCc
Confidence            999999999999999999999999999999999999999999999999864 7888899999999999999998899887


Q ss_pred             CCCCCC
Q 038273          547 VPEASN  552 (623)
Q Consensus       547 ~~~~~~  552 (623)
                      ..+|+.
T Consensus       753 ~~~~~~  758 (768)
T 3rgz_A          753 ADGYAH  758 (768)
T ss_dssp             ------
T ss_pred             cCCCCC
Confidence            777773



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 623
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-18
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 92.0 bits (227), Expect = 1e-20
 Identities = 58/369 (15%), Positives = 121/369 (32%), Gaps = 30/369 (8%)

Query: 139 RLVYLNLSRNDFNGSIPSSIGDMNSLKFLDLSHNQLTGEIPEHLVIGCFNLEYLVLSENS 198
           ++  L   R     SI   +  +N+L  ++ S+NQLT   P   +     L  ++++ N 
Sbjct: 45  QVTTLQADRLGIK-SI-DGVEYLNNLTQINFSNNQLTDITP---LKNLTKLVDILMNNNQ 99

Query: 199 LHGQLFYKKIYLRKLARLHLDANYCTGEIPKSLSNCSPLEGLYMSDNNLYGNIPAWLGNL 258
           +        +       L  +       +    +         +S N +           
Sbjct: 100 IADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRL----ELSSNTISDISALSGLTS 155

Query: 259 SSLNDIMMAINHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVHLSKNML 318
                    +  L+    L   +           +N    +   +  + ++ +  + N +
Sbjct: 156 LQQLSFGNQVTDLKPLANLTTLERLD------ISSNKVSDISVLAKLTNLESLIATNNQI 209

Query: 319 YGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRL 378
                       +++  L L+ N         +  LT L  L LANN +    P  L  L
Sbjct: 210 SDITPL---GILTNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAP--LSGL 262

Query: 379 KQLRLIDLSNNNLFGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLT 438
            +L  + L  N +    P  L   +   N + + +          L  +  + L  N ++
Sbjct: 263 TKLTELKLGANQISNISP--LAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNIS 320

Query: 439 GEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSNLKQVESLDVSYNNLNGKIPPQLVELNV 498
              P  +  LT ++ L F++N ++     S +NL  +  L   +N ++   P  L  L  
Sbjct: 321 DISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTR 374

Query: 499 LAVFSVAHN 507
           +    +   
Sbjct: 375 ITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query623
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.59
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=9e-30  Score=250.01  Aligned_cols=259  Identities=32%  Similarity=0.540  Sum_probs=205.0

Q ss_pred             CCcEEECcCCcCcc--ccchhccCCCCCCEEECcc-ccccccccccccCCCCCcEEeCcCccceeeCCCCCCCCcccEEE
Q 038273          236 PLEGLYMSDNNLYG--NIPAWLGNLSSLNDIMMAI-NHLQGPIPLEFCQLNYLEILDLSENNISGTLPSCSSHSTIQQVH  312 (623)
Q Consensus       236 ~L~~L~L~~n~l~~--~~~~~l~~l~~L~~L~l~~-n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~L~~L~  312 (623)
                      +++.|+|+++.+.+  .+|..++++++|++|++++ |.+.+.+|..+.++++|++|++++|++.+..+.           
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~-----------  119 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD-----------  119 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCG-----------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccc-----------
Confidence            45666666665554  3556666677777777765 566666666677777777777777766543322           


Q ss_pred             ccCccccccCCCCCccCCCceeEEeCCCCcCCCCCchhhhccccCcEEEcccccccccCchhhcCCCCC-CEEEccCCcC
Q 038273          313 LSKNMLYGPLKYGTFFNRSSIVTLDLSYNSFSGNIPYWIERLTRLRYLILANNNLEGEVPNQLCRLKQL-RLIDLSNNNL  391 (623)
Q Consensus       313 l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~l~~n~l  391 (623)
                                   .+..+..|+.+++++|.+.+..|..+..++.++.+++++|.+.+.+|..+..++.+ +.+++++|++
T Consensus       120 -------------~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l  186 (313)
T d1ogqa_         120 -------------FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL  186 (313)
T ss_dssp             -------------GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEE
T ss_pred             -------------cccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccc
Confidence                         14455667777777777777777778888888888888888887788877777765 7888888888


Q ss_pred             cCCCCCccccccccCCCCCCCCCCCccccCCCCCCccEEEccCCcccccCCccccccccCCeeeCCCCcccccCCccCCC
Q 038273          392 FGQIPGCLDNTSLHNNGDNDGSSAPTRYKGKPLNKMYGVDLSCNKLTGEIPPQIGKLTSIRALNFSHNNLTGVIPVSFSN  471 (623)
Q Consensus       392 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~  471 (623)
                      ++..|..+...                       ....++++++...+.+|..+..+++++.+++++|.+.+.+| .+..
T Consensus       187 ~~~~~~~~~~l-----------------------~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~  242 (313)
T d1ogqa_         187 TGKIPPTFANL-----------------------NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGL  242 (313)
T ss_dssp             EEECCGGGGGC-----------------------CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCC
T ss_pred             ccccccccccc-----------------------ccccccccccccccccccccccccccccccccccccccccc-cccc
Confidence            87777666543                       34568889999988999999999999999999999986654 6888


Q ss_pred             CCCCcEEECCCCcccccCccccccCCCCCeeecccCcccccCCCCccccCCCCCccccCCCCCCCCCCCCCC
Q 038273          472 LKQVESLDVSYNNLNGKIPPQLVELNVLAVFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCD  543 (623)
Q Consensus       472 l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~l~l~~Np~~C~~~l~~C~  543 (623)
                      +++|+.|+|++|++++.+|+.+.++++|++|+|++|+++|.+|+. ..+++|+.+++.+|+.+||.|++.|.
T Consensus       243 ~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         243 SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             CTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             ccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-ccCCCCCHHHhCCCccccCCCCCCCC
Confidence            999999999999999999999999999999999999999999974 58899999999999999999999884



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure