Citrus Sinensis ID: 038320


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MANNQYIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRLTLVFNVSPEW
ccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccEEccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHcccccccEEEccccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccEEEccccccccccHHHHHHHHccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccEEEccccccccccccEEEcccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccHHHcccccccEEEEcccccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHccccccccccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccc
MANNQYIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKAsvtdpsgrlsswtgedcckwegvicdnstgkvvqlklrspeipdsftdngttyqlegeispsvldlkhlnyldlslnnfrgsripnflgSLEKLRYLNlsgasfagnippsfgnlsslqildlNTFYYSSLESDDVEWLSRLSSlqylnlegvdlskagsswvqatnmlpslselhlpacglfefpplsvvnfsSLLFLdlssndfnssiPQWLLNISKLAHLDlsannlqgnipdaFANMTslreldlsensliggqipkdlgslcnlwdldlsgndldgEIIEFVDRLSKCansslesldlgqnnlggflpnslgqleNLKILQLWGNlfrgsipesigNLSSLRELYLhnnlmdgtipkslgkLSHLVVLdisgnpwiGLVTEVHFSKLKNLKELHIAKyslaprltlVFNVSPEW
MANNQYIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKasvtdpsgrlsswTGEDCCKWEGVICDNSTGKVVQLKlrspeipdsftdnGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAkyslaprltlVFNVSPEW
MANNQYIQPvflvllsgflffnsvRLSTCQSIARCVQNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPlsvvnfssllfldlssndfnssIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRLTLVFNVSPEW
*****YIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRLTLVFNV****
******I*PVFLVLLSGFLFFNSVRLST********QNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRLTLVFNVSPEW
MANNQYIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKASV*********WTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRLTLVFNVSPEW
***NQYIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRLTLVFNVSPE*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANNQYIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRLTLVFNVSPEW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query467 2.2.26 [Sep-21-2011]
C0LGT6 1031 LRR receptor-like serine/ no no 0.845 0.383 0.323 1e-41
O82318 960 Probably inactive leucine no no 0.805 0.391 0.344 1e-39
Q42371 976 LRR receptor-like serine/ no no 0.867 0.414 0.310 1e-38
Q9LP24 1120 Probable leucine-rich rep no no 0.749 0.312 0.359 2e-38
C0LGW6 966 LRR receptor-like serine/ no no 0.773 0.373 0.316 2e-38
Q9FL28 1173 LRR receptor-like serine/ no no 0.850 0.338 0.324 6e-38
Q9FL51 872 Probably inactive leucine no no 0.725 0.388 0.351 9e-37
Q9FRS6 1029 Leucine-rich repeat recep no no 0.822 0.373 0.287 9e-36
Q9M0G7 1013 Leucine-rich repeat recep no no 0.785 0.362 0.325 4e-35
Q9LRT1 1016 Probably inactive leucine no no 0.781 0.359 0.320 7e-35
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function desciption
 Score =  171 bits (433), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 147/455 (32%), Positives = 217/455 (47%), Gaps = 60/455 (13%)

Query: 37  QNEKEALLKIKASVTDPSGR--LSSWTGED-CCKWEGVICDNSTGKVVQLKLRSPEIPDS 93
           + + +ALL+ K+ V++ + R  L+SW      C W GV C     +V+ L L        
Sbjct: 29  ETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGG------ 82

Query: 94  FTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFA 153
                  ++L G ISPS+ +L  L  L+L+ N+F GS IP  +G L +L+YLN+S     
Sbjct: 83  -------FKLTGVISPSIGNLSFLRLLNLADNSF-GSTIPQKVGRLFRLQYLNMSYNLLE 134

Query: 154 GNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAG--SSWV 211
           G IP S  N S L  +DL++ +       ++  LS+L+ L        DLSK     ++ 
Sbjct: 135 GRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAIL--------DLSKNNLTGNFP 186

Query: 212 QATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHL 271
            +   L SL +L      +    P  V   + ++F  ++ N F+   P  L NIS L  L
Sbjct: 187 ASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESL 246

Query: 272 DLSANNLQGN-------------------------IPDAFANMTSLRELDLSENSLIGGQ 306
            L+ N+  GN                         IP   AN++SL   D+S N L  G 
Sbjct: 247 SLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYL-SGS 305

Query: 307 IPKDLGSLCNLWDLDLS---GNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNS 363
           IP   G L NLW L +      +     +EF+  ++ C  + LE LD+G N LGG LP S
Sbjct: 306 IPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANC--TQLEYLDVGYNRLGGELPAS 363

Query: 364 LGQLE-NLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLD 422
           +  L   L  L L  NL  G+IP  IGNL SL+EL L  N++ G +P S GKL +L V+D
Sbjct: 364 IANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVD 423

Query: 423 ISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAPRL 457
           +  N   G +   +F  +  L++LH+   S   R+
Sbjct: 424 LYSNAISGEIPS-YFGNMTRLQKLHLNSNSFHGRI 457




Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Reduces transformation by Rhizobium radiobacter probably by inducing plant defense during the interaction. Binding to the effector AvrPto1 from P.syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
359484185 990 PREDICTED: LRR receptor-like serine/thre 0.944 0.445 0.591 1e-136
359488591 981 PREDICTED: probable leucine-rich repeat 0.944 0.449 0.561 1e-135
359488583 958 PREDICTED: LRR receptor-like serine/thre 0.918 0.447 0.601 1e-134
225451409 1007 PREDICTED: leucine-rich repeat receptor 0.993 0.460 0.562 1e-133
359488633 981 PREDICTED: LRR receptor-like serine/thre 0.952 0.453 0.560 1e-133
359496717 1014 PREDICTED: brassinosteroid LRR receptor 0.991 0.456 0.558 1e-129
359488635 1322 PREDICTED: leucine-rich repeat receptor 0.955 0.337 0.556 1e-128
296090228 896 unnamed protein product [Vitis vinifera] 0.903 0.470 0.565 1e-128
359488637 988 PREDICTED: probable leucine-rich repeat 0.959 0.453 0.542 1e-128
147770493 1024 hypothetical protein VITISV_019847 [Viti 0.993 0.453 0.560 1e-128
>gi|359484185|ref|XP_002273824.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  491 bits (1265), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 265/448 (59%), Positives = 334/448 (74%), Gaps = 7/448 (1%)

Query: 23  SVRLSTCQSIAR--CVQNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKV 80
           +++LS+C +     C++ EKEALLK K  +TDPSGRLSSW GEDCCKW GV C+N TG+V
Sbjct: 22  TIKLSSCDANQNMDCLEVEKEALLKFKQGLTDPSGRLSSWVGEDCCKWRGVSCNNRTGRV 81

Query: 81  VQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLE 140
           ++LKL +P  P+S   +GT  +L GEI+PS+L LK+LNYLDLS+NNF G  IP F+GSL 
Sbjct: 82  IKLKLGNP-FPNSLEGDGTASELGGEINPSLLSLKYLNYLDLSMNNFGGMEIPKFIGSLG 140

Query: 141 KLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEG 200
           KLRYLNLSGASF G IPP+  NLS+L+ LDLNT Y      + +EWLS LSSL+YLNL G
Sbjct: 141 KLRYLNLSGASFGGMIPPNIANLSNLRYLDLNT-YSIEPNKNGLEWLSGLSSLKYLNLGG 199

Query: 201 VDLSKAGSSWVQATNMLPSLSELHLPACGLFEFP-PLSVVNFSSLLFLDLSSNDFNSSIP 259
           +DLS+A + W+Q  N LPSL ELH+P C L  F   L  +NF+SL  LDLS+N+F+S+IP
Sbjct: 200 IDLSEAAAYWLQTINTLPSLLELHMPNCQLSNFSLSLPFLNFTSLSILDLSNNEFDSTIP 259

Query: 260 QWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWD 319
            WL N+S L +LDL++NNLQG +PDAF N TSL+ LDLS+NS I G+ P+ LG+LC L  
Sbjct: 260 HWLFNLSSLVYLDLNSNNLQGGLPDAFQNFTSLQLLDLSQNSNIEGEFPRTLGNLCCLRT 319

Query: 320 LDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNL 379
           L LS N L GEI EF+D LS C+ S+LE+LDLG N L G LP+SLG L+NL+ LQL  N 
Sbjct: 320 LILSVNKLSGEITEFLDGLSACSYSTLENLDLGFNELTGNLPDSLGHLKNLRYLQLRSNS 379

Query: 380 FRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSK 439
           F GSIPESIG LSSL+ELYL  N M G IP SLG+LS LVVL+++GN W G++TE HF+ 
Sbjct: 380 FSGSIPESIGRLSSLQELYLSQNQMGGIIPDSLGQLSSLVVLELNGNSWEGVITEAHFAN 439

Query: 440 LKNLKELHIAKYSLAPRLTLVFNVSPEW 467
           L +LK+L I + S  P ++LVFNVS +W
Sbjct: 440 LSSLKQLSITRSS--PNVSLVFNVSSDW 465




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359488591|ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488583|ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451409|ref|XP_002273126.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488633|ref|XP_002264905.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496717|ref|XP_003635312.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488635|ref|XP_003633793.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090228|emb|CBI40047.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488637|ref|XP_003633794.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770493|emb|CAN78141.1| hypothetical protein VITISV_019847 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.920 0.475 0.438 3.7e-87
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.843 0.351 0.333 7.3e-40
TAIR|locus:2139885 1013 AT4G28650 [Arabidopsis thalian 0.841 0.387 0.325 8.2e-38
TAIR|locus:2825762 994 RLP6 "AT1G45616" [Arabidopsis 0.792 0.372 0.325 7.3e-37
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.867 0.397 0.310 7.7e-37
TAIR|locus:2094613 784 RLP38 "receptor like protein 3 0.826 0.492 0.307 2.2e-36
TAIR|locus:2167948 966 ERL1 "ERECTA-like 1" [Arabidop 0.691 0.334 0.322 6.9e-25
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.800 0.380 0.322 1.1e-35
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.847 0.317 0.315 2.8e-35
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.875 0.417 0.317 3.7e-35
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 871 (311.7 bits), Expect = 3.7e-87, P = 3.7e-87
 Identities = 194/442 (43%), Positives = 263/442 (59%)

Query:    34 RCVQNEKEALLKIKASVTDPSGRLSSWTGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDS 93
             +C+  E++ALL  +A++TD S RL SW+G DCC W GV+CD  T  VV++ LR+P   D 
Sbjct:    32 KCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPS-QDV 90

Query:    94 FTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFA 153
              +D      L G+I PS+  LK L+YLDLS N+F    IP F+G +  LRYLNLS +SF+
Sbjct:    91 RSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFS 150

Query:   154 GNIPPSFGNLSSLQILDL--NTFYYS---SLESDDVEWLSRLSS-LQYLNLEGVDLSKAG 207
             G IP S GNLS L+ LDL   +F  S   SL + ++ WLS LSS L+YLN+  V+LS AG
Sbjct:   151 GEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAG 210

Query:   208 SSWVQATNMLPSLSELHLPACGLFEFPPXXXXXXXXXXXXXXXXXXXXXX--IPQWLLNI 265
              +W+Q  + + +L ELHL    L   PP                        IP WL  +
Sbjct:   211 ETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGL 270

Query:   266 SKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGN 325
             + L  L L  + LQG+IP  F N+  L  LDLS N  + G+IP  LG L  L  LDLS N
Sbjct:   271 TNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSAN 330

Query:   326 DLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIP 385
             +L+G+I  F+D  S+   +SL  LDL  N L G LP SLG L NL+ L L  N F GS+P
Sbjct:   331 ELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVP 390

Query:   386 ESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKE 445
              SIGN++SL++L L NN M+GTI +SLG+L+ LV L++  N W G++ + HF  L++LK 
Sbjct:   391 SSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKS 450

Query:   446 LHIAKYSLAPRLTLVFNVSPEW 467
             + +   +  P  +LVF +   W
Sbjct:   451 IRL---TTEPYRSLVFKLPSTW 469


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094613 RLP38 "receptor like protein 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-52
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-08
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  187 bits (477), Expect = 9e-52
 Identities = 150/435 (34%), Positives = 211/435 (48%), Gaps = 62/435 (14%)

Query: 1   MANNQYIQPVFLVLLSGFLFFNSVRLSTCQSIARCVQNEKEALLKIKASVTDPSGRLSSW 60
           MA        +L+ +  FLF N   L            E E LL  K+S+ DP   LS+W
Sbjct: 1   MAKKGPQHCPYLIFMLFFLFLNFSMLHA---------EELELLLSFKSSINDPLKYLSNW 51

Query: 61  -TGEDCCKWEGVICDNSTGKVVQLKLRSPEIPDSFTDNGTTYQLEGEISPSVLDLKHLNY 119
            +  D C W+G+ C+NS+ +VV + L    I              G+IS ++  L ++  
Sbjct: 52  NSSADVCLWQGITCNNSS-RVVSIDLSGKNI-------------SGKISSAIFRLPYIQT 97

Query: 120 LDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSL 179
           ++LS N   G    +   +   LRYLNLS  +F G+IP   G++ +L+ LDL+    S  
Sbjct: 98  INLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGE 155

Query: 180 ESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVV 239
             +D+      SSL+ L+L G              N+L       +P          S+ 
Sbjct: 156 IPNDI---GSFSSLKVLDLGG--------------NVLVG----KIPN---------SLT 185

Query: 240 NFSSLLFLDLSSNDFNSSIPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSE 299
           N +SL FL L+SN     IP+ L  +  L  + L  NNL G IP     +TSL  LDL  
Sbjct: 186 NLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVY 245

Query: 300 NSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGF 359
           N+L G  IP  LG+L NL  L L  N L G I   +  L K     L SLDL  N+L G 
Sbjct: 246 NNLTG-PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQK-----LISLDLSDNSLSGE 299

Query: 360 LPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLV 419
           +P  + QL+NL+IL L+ N F G IP ++ +L  L+ L L +N   G IPK+LGK ++L 
Sbjct: 300 IPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLT 359

Query: 420 VLDISGNPWIGLVTE 434
           VLD+S N   G + E
Sbjct: 360 VLDLSTNNLTGEIPE 374


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 467
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.82
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.78
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.55
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.35
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.33
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
PLN03150623 hypothetical protein; Provisional 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.0
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.73
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.59
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.57
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.49
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.47
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.4
KOG4341483 consensus F-box protein containing LRR [General fu 98.35
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.34
KOG4341483 consensus F-box protein containing LRR [General fu 98.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.06
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.04
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.9
PRK15386426 type III secretion protein GogB; Provisional 97.9
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.75
PRK15386 426 type III secretion protein GogB; Provisional 97.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.49
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.32
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.06
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.96
KOG4308 478 consensus LRR-containing protein [Function unknown 96.05
KOG4308 478 consensus LRR-containing protein [Function unknown 95.85
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.9
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.61
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.96
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.95
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.0
smart0037026 LRR Leucine-rich repeats, outliers. 88.54
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.54
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.5
KOG0473 326 consensus Leucine-rich repeat protein [Function un 85.22
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 83.97
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.4e-49  Score=432.55  Aligned_cols=401  Identities=35%  Similarity=0.524  Sum_probs=328.3

Q ss_pred             HhhHHHHHHhHhcCCCCCCCCCCCC-CCCCCCcccEEecCCCCCEEEEEcCCCCCC-----------CCcCCCCcccccc
Q 038320           37 QNEKEALLKIKASVTDPSGRLSSWT-GEDCCKWEGVICDNSTGKVVQLKLRSPEIP-----------DSFTDNGTTYQLE  104 (467)
Q Consensus        37 ~~~~~~l~~~~~~~~~~~~~~~~w~-~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~-----------~~~~~~~~~~~l~  104 (467)
                      +.|+.+|++||+.+.+|.+.+.+|+ +.+||.|.||+|+. .++|+.+++++..+.           ..+.+++++|.++
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~  106 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLS  106 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccC
Confidence            4789999999999988887889994 67899999999975 579999999985432           2356677777777


Q ss_pred             cccCcccc-CCCCCCEEeCCCCCCCCCCCCcccCCCCCCCEEEcCCCcCCCCCCccCCCCCcCCeeeccCccCCC-CCCC
Q 038320          105 GEISPSVL-DLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSS-LESD  182 (467)
Q Consensus       105 ~~~~~~l~-~l~~L~~L~L~~n~i~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~-l~~~  182 (467)
                      |.+|..+. .+++|++|++++|.+++. +|.  +.+++|++|++++|.+++.+|..++++++|++|++++|.+.. +|..
T Consensus       107 ~~ip~~~~~~l~~L~~L~Ls~n~l~~~-~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~  183 (968)
T PLN00113        107 GPIPDDIFTTSSSLRYLNLSNNNFTGS-IPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS  183 (968)
T ss_pred             CcCChHHhccCCCCCEEECcCCccccc-cCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChh
Confidence            77776654 777888888887777765 553  457778888888888877778778888888888888887653 3332


Q ss_pred             ChhhcCCCCCCCEEECCCcCCCCCCCchhhhcCCCCCCCEEECCCCcCcccCCccccCCCCCcEEEccCCcCCCCcchhc
Q 038320          183 DVEWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWL  262 (467)
Q Consensus       183 ~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l  262 (467)
                          +.++++|++|++++|.+.+..   +..+..+++|+.|++++|.+.+..|..+.++++|++|++++|.+++.+|..+
T Consensus       184 ----~~~l~~L~~L~L~~n~l~~~~---p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l  256 (968)
T PLN00113        184 ----LTNLTSLEFLTLASNQLVGQI---PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL  256 (968)
T ss_pred             ----hhhCcCCCeeeccCCCCcCcC---ChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhH
Confidence                677888888888888877665   3467778888888888888888888888888888888888888888888888


Q ss_pred             cCCCCCCEEeccCCccccccchhhhCCCCCCEEeCCCCCCCCCCCcccccCCCCCCEEeccCCcCCCchhhHHHhhhccc
Q 038320          263 LNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCA  342 (467)
Q Consensus       263 ~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~~~  342 (467)
                      .++++|+.|++++|.+.+.+|..+.++++|++|++++|.+ .+.+|..+..+++|+.|++++|.+.+..|..+..++   
T Consensus       257 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l-~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~---  332 (968)
T PLN00113        257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSL-SGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLP---  332 (968)
T ss_pred             hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCee-ccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCC---
Confidence            8888888888888888888888888888888888888887 677888888888888888888888888887777665   


Q ss_pred             CCCccEEECcCCCCCcCCCccccCCCCCCEEEccCCcCcccccccccCCCCCCEEECcCCcCcccChhhhcCCCCCCEEe
Q 038320          343 NSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLD  422 (467)
Q Consensus       343 ~~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~  422 (467)
                        +|+.|++++|.+++.+|..++.+++|+.|++++|.+++.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|+
T Consensus       333 --~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~  410 (968)
T PLN00113        333 --RLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVR  410 (968)
T ss_pred             --CCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEE
Confidence              888999998888888888888888899999999988888888888888899999999998888888888999999999


Q ss_pred             CcCCCCcccCChhhhCCCCCCCEEeccCCCCCC
Q 038320          423 ISGNPWIGLVTEVHFSKLKNLKELHIAKYSLAP  455 (467)
Q Consensus       423 l~~n~~~~~~~~~~~~~l~~L~~l~l~~n~i~~  455 (467)
                      +++|++++.+|. .|..++.|+.+++++|+++.
T Consensus       411 L~~n~l~~~~p~-~~~~l~~L~~L~Ls~N~l~~  442 (968)
T PLN00113        411 LQDNSFSGELPS-EFTKLPLVYFLDISNNNLQG  442 (968)
T ss_pred             CcCCEeeeECCh-hHhcCCCCCEEECcCCcccC
Confidence            999999888888 78889999999999995553



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
3rgx_A768 Structural Insight Into Brassinosteroid Perception 5e-26
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-05
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-26
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-08
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-13
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-05
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-05
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 3e-05
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 5e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 5e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 7e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 9e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-04
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 1e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 7e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 92.0 bits (227), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 127/424 (29%), Positives = 180/424 (42%), Gaps = 66/424 (15%) Query: 83 LKLRSPEIPD-SFTDNGTTYQLEGEISPSVLDLK-HLNYLDLSLNNFRGSRIPNFLGSLE 140 LK+R ++ D SF + GE+ S+ +L L LDLS NNF G +PN + + Sbjct: 340 LKMRGLKVLDLSFN------EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393 Query: 141 K-LRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQ-YLN- 197 L+ L L F G IPP+ N S L L L+ Y S + LS+L L+ +LN Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 453 Query: 198 LEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPXXXXXXXXXXXXXXXXXXXXXX 257 LEG Q + +L L L L P Sbjct: 454 LEG--------EIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGE 505 Query: 258 IPQWLLNISKLAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIP----KDLGS 313 IP+W+ + LA L LS N+ GNIP + SL LDL+ N L G IP K G Sbjct: 506 IPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN-LFNGTIPAAMFKQSGK 564 Query: 314 LCNLW----------------DLDLSGNDLDGEII--EFVDRLSK---CA---------- 342 + + + +GN L+ + I E ++RLS C Sbjct: 565 IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHT 624 Query: 343 ------NSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRE 396 N S+ LD+ N L G++P +G + L IL L N GSIP+ +G+L L Sbjct: 625 SPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNI 684 Query: 397 LYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEV----HFSKLKNLKELHIAKYS 452 L L +N +DG IP+++ L+ L +D+S N G + E+ F K L + Y Sbjct: 685 LDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYP 744 Query: 453 LAPR 456 L PR Sbjct: 745 L-PR 747
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-94
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-68
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-66
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-52
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-48
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-48
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-44
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-38
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-44
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-29
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-34
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-32
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-31
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-30
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-27
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-27
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-27
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-19
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-12
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-14
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-10
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-13
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-07
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  299 bits (769), Expect = 4e-94
 Identities = 121/424 (28%), Positives = 196/424 (46%), Gaps = 33/424 (7%)

Query: 31  SIARCVQNEKEALLKIKASVTDPSGRLSSWT-GEDCCKWEGVICDNSTGKVVQLKLRSPE 89
           S ++ +  E   L+  K  + D    L  W+  ++ C ++GV C +   KV  + L S  
Sbjct: 5   SPSQSLYREIHQLISFKDVLPDK-NLLPDWSSNKNPCTFDGVTCRD--DKVTSIDLSSKP 61

Query: 90  IPDSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSG 149
           +   F            +S S+L L  L  L LS ++  GS +  F      L  L+LS 
Sbjct: 62  LNVGF----------SAVSSSLLSLTGLESLFLSNSHINGS-VSGF-KCSASLTSLDLSR 109

Query: 150 ASFAGNIPP--SFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAG 207
            S +G +    S G+ S L+ L++++          V    +L+SL+ L+L    +S A 
Sbjct: 110 NSLSGPVTTLTSLGSCSGLKFLNVSSNTLDF--PGKVSGGLKLNSLEVLDLSANSISGAN 167

Query: 208 SSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISK 267
                 ++    L  L +    +     +S     +L FLD+SSN+F++ IP +L + S 
Sbjct: 168 VVGWVLSDGCGELKHLAISGNKISGDVDVS--RCVNLEFLDVSSNNFSTGIP-FLGDCSA 224

Query: 268 LAHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDL 327
           L HLD+S N L G+   A +  T L+ L++S N    G IP     L +L  L L+ N  
Sbjct: 225 LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQF-VGPIPP--LPLKSLQYLSLAENKF 281

Query: 328 DGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIP-E 386
            GEI +F+         +L  LDL  N+  G +P   G    L+ L L  N F G +P +
Sbjct: 282 TGEIPDFLSGAC----DTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD 337

Query: 387 SIGNLSSLRELYLHNNLMDGTIPKSLGKLS-HLVVLDISGNPWIGLV-TEVHFSKLKNLK 444
           ++  +  L+ L L  N   G +P+SL  LS  L+ LD+S N + G +   +  +    L+
Sbjct: 338 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 397

Query: 445 ELHI 448
           EL++
Sbjct: 398 ELYL 401


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.23
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.17
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.93
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.95
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-53  Score=450.64  Aligned_cols=415  Identities=27%  Similarity=0.354  Sum_probs=243.9

Q ss_pred             ccccccHhhHHHHHHhHhcCCCCCCCCCCC-CCCCCCCcccEEecCCCCCEEEEEcCCCCCC------------------
Q 038320           31 SIARCVQNEKEALLKIKASVTDPSGRLSSW-TGEDCCKWEGVICDNSTGKVVQLKLRSPEIP------------------   91 (467)
Q Consensus        31 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~w-~~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~------------------   91 (467)
                      +++.+.++|++||++||+++.||. .+++| .+.+||.|+||+|+  .++|+.+++++..+.                  
T Consensus         5 ~~~~~~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~   81 (768)
T 3rgz_A            5 SPSQSLYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLES   81 (768)
T ss_dssp             ---CCHHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCE
T ss_pred             ccccCCHHHHHHHHHHHhhCCCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCcccc
Confidence            334446789999999999999988 88999 57899999999998  689999999865432                  


Q ss_pred             -------------------CCcCCCCcccccccccCc--cccCCCCCCEEeCCCCCCCCCCCCccc-CCCCCCCEEEcCC
Q 038320           92 -------------------DSFTDNGTTYQLEGEISP--SVLDLKHLNYLDLSLNNFRGSRIPNFL-GSLEKLRYLNLSG  149 (467)
Q Consensus        92 -------------------~~~~~~~~~~~l~~~~~~--~l~~l~~L~~L~L~~n~i~~~~~~~~~-~~l~~L~~L~L~~  149 (467)
                                         ..+++++++|.++|.+|.  .++++++|++|++++|.+.+. .|..+ .++++|++|++++
T Consensus        82 l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~-~~~~~~~~l~~L~~L~Ls~  160 (768)
T 3rgz_A           82 LFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFP-GKVSGGLKLNSLEVLDLSA  160 (768)
T ss_dssp             EECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECC-SSCCSCCCCTTCSEEECCS
T ss_pred             cCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCc-CCHHHhccCCCCCEEECCC
Confidence                               125677788888888887  888888888888888877665 44332 4455555555555


Q ss_pred             CcCCCCCCcc-------------------------CCCCCcCCeeeccCccCCCCCCC--------------------Ch
Q 038320          150 ASFAGNIPPS-------------------------FGNLSSLQILDLNTFYYSSLESD--------------------DV  184 (467)
Q Consensus       150 n~l~~~~p~~-------------------------l~~l~~L~~L~l~~n~~~~l~~~--------------------~~  184 (467)
                      |.+++..|..                         +.++++|++|++++|.+....+.                    ..
T Consensus       161 n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~  240 (768)
T 3rgz_A          161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFS  240 (768)
T ss_dssp             SCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHH
T ss_pred             CccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCccc
Confidence            4443322211                         13445555555555554432222                    11


Q ss_pred             hhcCCCCCCCEEECCCcCCCCCCCchhhhcCCCCCCCEEECCCCcCcccCCccccCC-CCCcEEEccCCcCCCCcchhcc
Q 038320          185 EWLSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNF-SSLLFLDLSSNDFNSSIPQWLL  263 (467)
Q Consensus       185 ~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l-~~L~~L~l~~n~l~~~~~~~l~  263 (467)
                      ..+.++++|++|++++|.+.+..+.     ..+++|++|++++|.+.+.+|..+... ++|++|++++|.+++.+|..+.
T Consensus       241 ~~l~~l~~L~~L~Ls~n~l~~~~~~-----~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~  315 (768)
T 3rgz_A          241 RAISTCTELKLLNISSNQFVGPIPP-----LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFG  315 (768)
T ss_dssp             HHTTTCSSCCEEECCSSCCEESCCC-----CCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGG
T ss_pred             HHHhcCCCCCEEECCCCcccCccCc-----cccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHh
Confidence            1234444444444444444332211     023333333333333333334333332 5555555555555555555555


Q ss_pred             CCCCCCEEeccCCccccccchh-hhCCCCCCEEeCCCCCCC---------------------------------------
Q 038320          264 NISKLAHLDLSANNLQGNIPDA-FANMTSLRELDLSENSLI---------------------------------------  303 (467)
Q Consensus       264 ~l~~L~~L~l~~n~l~~~~~~~-l~~l~~L~~L~L~~n~l~---------------------------------------  303 (467)
                      ++++|+.|++++|.+.+.+|.. +.++++|++|++++|.+.                                       
T Consensus       316 ~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~  395 (768)
T 3rgz_A          316 SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNT  395 (768)
T ss_dssp             GCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCC
T ss_pred             cCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCC
Confidence            5555555555555544444433 444444444444444330                                       


Q ss_pred             -----------CCCCcccccCCCCCCEEeccCCcCCCchhhHHHhhhcccCCCccEEECcCCCCCcCCCccccCCCCCCE
Q 038320          304 -----------GGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKI  372 (467)
Q Consensus       304 -----------~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~~~~~~L~~L~L~~n~i~~~~~~~l~~l~~L~~  372 (467)
                                 .+.+|..+..+++|+.|++++|.+++..|..+..++     +|++|++++|.+++.+|..+..+++|++
T Consensus       396 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~-----~L~~L~L~~n~l~~~~p~~~~~l~~L~~  470 (768)
T 3rgz_A          396 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-----KLRDLKLWLNMLEGEIPQELMYVKTLET  470 (768)
T ss_dssp             CCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCT-----TCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             ccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCC-----CCCEEECCCCcccCcCCHHHcCCCCceE
Confidence                       123333444444555555555555544444444443     6666666666666666666666666666


Q ss_pred             EEccCCcCcccccccccCCCCCCEEECcCCcCcccChhhhcCCCCCCEEeCcCCCCcccCChhhhCCCCCCCEEeccCCC
Q 038320          373 LQLWGNLFRGSIPESIGNLSSLRELYLHNNLMDGTIPKSLGKLSHLVVLDISGNPWIGLVTEVHFSKLKNLKELHIAKYS  452 (467)
Q Consensus       373 L~l~~n~l~~~~~~~l~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~l~l~~n~  452 (467)
                      |++++|.+++.+|..+..+++|++|++++|++++.+|..+..+++|++|++++|++++.+|. .+..+++|+.|++++| 
T Consensus       471 L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~-~l~~l~~L~~L~Ls~N-  548 (768)
T 3rgz_A          471 LILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA-ELGDCRSLIWLDLNTN-  548 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCG-GGGGCTTCCEEECCSS-
T ss_pred             EEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCH-HHcCCCCCCEEECCCC-
Confidence            66666666666666666667777777777777666676666677777777777777666666 5666777777777777 


Q ss_pred             CCCCccEEEecCCC
Q 038320          453 LAPRLTLVFNVSPE  466 (467)
Q Consensus       453 i~~~~~~~g~~p~~  466 (467)
                           .+.|.+|..
T Consensus       549 -----~l~g~ip~~  557 (768)
T 3rgz_A          549 -----LFNGTIPAA  557 (768)
T ss_dssp             -----EEESBCCGG
T ss_pred             -----ccCCcCChH
Confidence                 666666653



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 467
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-12
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-15
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-09
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 90.2 bits (222), Expect = 1e-20
 Identities = 84/371 (22%), Positives = 125/371 (33%), Gaps = 75/371 (20%)

Query: 35  CVQNEKEALLKIKASVTDPSGRLSSWT-GEDCC--KWEGVICDNSTGKVVQLKLRSPEIP 91
           C   +K+ALL+IK  + +P+  LSSW    DCC   W GV+CD  T              
Sbjct: 3   CNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTY----------- 50

Query: 92  DSFTDNGTTYQLEGEISPSVLDLKHLNYLDLSLNNFRGSRIPNFLGSLEKLRYLNLSGAS 151
                                    +N LDLS  N                         
Sbjct: 51  ------------------------RVNNLDLSGLNLPKP--------------------- 65

Query: 152 FAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEWLSRLSSLQYLNLEGVDLSKAGSSWV 211
               IP S  NL  L  L +     ++L       +++L+ L YL +   ++S A   ++
Sbjct: 66  --YPIPSSLANLPYLNFLYIG--GINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL 121

Query: 212 QATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNISKLAHL 271
                L +L   +     L    P S+ +  +L+ +    N  + +IP    + SKL   
Sbjct: 122 SQIKTLVTLDFSY---NALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTS 178

Query: 272 DLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEI 331
              + N             +L  +DLS N L G                  +      + 
Sbjct: 179 MTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDAS-------VLFGSDKNTQKIHLAKN 231

Query: 332 IEFVDRLSKCANSSLESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNL 391
               D      + +L  LDL  N + G LP  L QL+ L  L +  N   G IP+  GNL
Sbjct: 232 SLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNL 290

Query: 392 SSLRELYLHNN 402
                    NN
Sbjct: 291 QRFDVSAYANN 301


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.63
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.6e-40  Score=311.39  Aligned_cols=291  Identities=34%  Similarity=0.527  Sum_probs=176.6

Q ss_pred             ccHhhHHHHHHhHhcCCCCCCCCCCC-CCCCCCC--cccEEecCCC--CCEEEEEcCCCCCCCCcCCCCccccccc--cc
Q 038320           35 CVQNEKEALLKIKASVTDPSGRLSSW-TGEDCCK--WEGVICDNST--GKVVQLKLRSPEIPDSFTDNGTTYQLEG--EI  107 (467)
Q Consensus        35 ~~~~~~~~l~~~~~~~~~~~~~~~~w-~~~~~c~--w~gv~c~~~~--~~v~~l~l~~~~~~~~~~~~~~~~~l~~--~~  107 (467)
                      |.++|++||++||+.+.+|. .+.+| .+.|||.  |+||+|+...  +||+++++++             +.++|  .+
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~-------------~~l~g~~~l   68 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG-------------LNLPKPYPI   68 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEEC-------------CCCSSCEEC
T ss_pred             CCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCC-------------CCCCCCCCC
Confidence            89999999999999998875 57899 5789994  9999998644  4899999998             66665  45


Q ss_pred             CccccCCCCCCEEeCCC-CCCCCCCCCcccCCCCCCCEEEcCCCcCCCCCCccCCCCCcCCeeeccCccCCCCCCCChhh
Q 038320          108 SPSVLDLKHLNYLDLSL-NNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLESDDVEW  186 (467)
Q Consensus       108 ~~~l~~l~~L~~L~L~~-n~i~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~l~~~~~~~  186 (467)
                      |+.++++++|++|+|++ |.++|. +|..++++++|++|++++|++.+..+..+..+++|+++++++             
T Consensus        69 p~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~-------------  134 (313)
T d1ogqa_          69 PSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSY-------------  134 (313)
T ss_dssp             CGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCS-------------
T ss_pred             ChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhccccccc-------------
Confidence            66677777777777765 556554 666666666666666666666554444444444444444443             


Q ss_pred             cCCCCCCCEEECCCcCCCCCCCchhhhcCCCCCCCEEECCCCcCcccCCccccCCCCCcEEEccCCcCCCCcchhccCCC
Q 038320          187 LSRLSSLQYLNLEGVDLSKAGSSWVQATNMLPSLSELHLPACGLFEFPPLSVVNFSSLLFLDLSSNDFNSSIPQWLLNIS  266 (467)
Q Consensus       187 l~~l~~L~~L~L~~n~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~  266 (467)
                                                               |.+.+.+|..+.+++.++.+++++|.+.+.+|..+..+.
T Consensus       135 -----------------------------------------N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~  173 (313)
T d1ogqa_         135 -----------------------------------------NALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFS  173 (313)
T ss_dssp             -----------------------------------------SEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCC
T ss_pred             -----------------------------------------ccccccCchhhccCcccceeecccccccccccccccccc
Confidence                                                     333344444555666666666666666666666666665


Q ss_pred             CC-CEEeccCCccccccchhhhCCCCCCEEeCCCCCCCCCCCcccccCCCCCCEEeccCCcCCCchhhHHHhhhcccCCC
Q 038320          267 KL-AHLDLSANNLQGNIPDAFANMTSLRELDLSENSLIGGQIPKDLGSLCNLWDLDLSGNDLDGEIIEFVDRLSKCANSS  345 (467)
Q Consensus       267 ~L-~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~~~~~~  345 (467)
                      .+ +.+++++|++++..+..+..+..+ .+++.++.. .+.++..+..+++++.+++++|.+.+.++. +...     ++
T Consensus       174 ~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~-~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~-~~~~-----~~  245 (313)
T d1ogqa_         174 KLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNML-EGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLS-----KN  245 (313)
T ss_dssp             TTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEE-EECCGGGCCTTSCCSEEECCSSEECCBGGG-CCCC-----TT
T ss_pred             ccccccccccccccccccccccccccc-ccccccccc-cccccccccccccccccccccccccccccc-cccc-----cc
Confidence            54 667777777776666666555433 566666655 555565555666666666665555543321 1111     14


Q ss_pred             ccEEECcCCCCCcCCCccccCCCCCCEEEccCCcCcccccccccCCCCCCEEECcCCc
Q 038320          346 LESLDLGQNNLGGFLPNSLGQLENLKILQLWGNLFRGSIPESIGNLSSLRELYLHNNL  403 (467)
Q Consensus       346 L~~L~L~~n~i~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~Ls~n~  403 (467)
                      |+.|++++|+++|.+|..++++++|++|+|++|+++|.+|. ++++++|+.+++++|+
T Consensus       246 L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         246 LNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             cccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            44444444444444444444444444444444444444442 2334444444444443



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure