Citrus Sinensis ID: 038334

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
ATLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKVIQVAE
ccHHHHHHHHHcccccccccEEEEEEccccccccccccccccccEEEEEccccHHHHHHHHHHcccccccccHHHHHHHHHHcccccccc
cccHHHHHHHHcHHccccccEEEEEEcccHHcccHHHcccccccEEEEEccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccc
ATLSRMLTFIDRLwlgygderiMIVKTNhkakldltllrpghmdvhihmsyctpcgfrmpasnylqiieHPLFSKIEMLLELKKVIQVAE
atlsrmltFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKVIQVAE
ATLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKVIQVAE
*****MLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKVIQ***
ATLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKVIQVA*
ATLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKVIQVAE
ATLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ATLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIEHPLFSKIEMLLELKKVIQVAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
Q9P6Q3449 Probable mitochondrial ch yes no 0.566 0.113 0.415 0.0004
>sp|Q9P6Q3|BCS1_SCHPO Probable mitochondrial chaperone bcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.07 PE=2 SV=1 Back     alignment and function desciption
 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 2   TLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTP 54
           T S +L  +D +     DERI+ + TNH  KLD  L+RPG +DV  ++   TP
Sbjct: 323 TFSGLLNALDGV--TSSDERIIFMTTNHPEKLDPALVRPGRVDVKAYLGNATP 373
Chaperone necessary for the assembly of mitochondrial respiratory chain complex III.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
255543747 501 ATP binding protein, putative [Ricinus c 0.933 0.167 0.654 3e-26
356502980 498 PREDICTED: ATP-dependent zinc metallopro 0.988 0.178 0.648 7e-26
356561203 537 PREDICTED: uncharacterized protein LOC10 0.988 0.165 0.637 1e-25
118486313 539 unknown [Populus trichocarpa] 0.933 0.155 0.642 2e-25
224105359 457 predicted protein [Populus trichocarpa] 0.933 0.183 0.642 2e-25
449520948 480 PREDICTED: uncharacterized protein LOC10 0.988 0.185 0.659 5e-25
449520946 501 PREDICTED: uncharacterized protein LOC10 0.988 0.177 0.659 5e-25
225428416 494 PREDICTED: ATP-dependent zinc metallopro 0.933 0.170 0.642 9e-25
225428414 488 PREDICTED: ATP-dependent zinc metallopro 0.933 0.172 0.642 9e-25
255561048 528 ATP binding protein, putative [Ricinus c 0.988 0.168 0.626 1e-24
>gi|255543747|ref|XP_002512936.1| ATP binding protein, putative [Ricinus communis] gi|223547947|gb|EEF49439.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%)

Query: 2   TLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPA 61
           TLS +L F+D LW   GDER+++  TNHK KLD  LLRPG MDVHIHMSYCTPCGF+M A
Sbjct: 345 TLSGLLNFVDGLWSSCGDERVIVFTTNHKEKLDPALLRPGRMDVHIHMSYCTPCGFKMLA 404

Query: 62  SNYLQIIEHPLFSKIEMLLELKKV 85
            NYL I EHPLF +IE ++E+ KV
Sbjct: 405 FNYLGITEHPLFLEIEEMIEITKV 428

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356502980|ref|XP_003520292.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356561203|ref|XP_003548873.1| PREDICTED: uncharacterized protein LOC100788906 [Glycine max] Back     alignment and taxonomy information
>gi|118486313|gb|ABK94998.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105359|ref|XP_002313783.1| predicted protein [Populus trichocarpa] gi|222850191|gb|EEE87738.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449520948|ref|XP_004167494.1| PREDICTED: uncharacterized protein LOC101229933 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520946|ref|XP_004167493.1| PREDICTED: uncharacterized protein LOC101229933 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225428416|ref|XP_002283761.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428414|ref|XP_002283754.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561048|ref|XP_002521536.1| ATP binding protein, putative [Ricinus communis] gi|223539214|gb|EEF40807.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
TAIR|locus:2077997576 BCS1 "cytochrome BC1 synthesis 0.988 0.154 0.615 3.1e-22
TAIR|locus:2078007451 AT3G50940 [Arabidopsis thalian 0.988 0.197 0.538 1.3e-20
TAIR|locus:1005716649495 AT2G18193 [Arabidopsis thalian 0.933 0.169 0.569 2.4e-20
TAIR|locus:2053109494 AT2G18190 [Arabidopsis thalian 0.933 0.170 0.546 3.9e-20
TAIR|locus:2115954248 AT4G05380 [Arabidopsis thalian 0.911 0.330 0.590 1.9e-19
TAIR|locus:2095537474 AT3G28610 [Arabidopsis thalian 0.888 0.168 0.55 2.6e-19
TAIR|locus:2175986505 AT5G17760 [Arabidopsis thalian 0.988 0.176 0.526 1.3e-17
TAIR|locus:2095532477 AT3G28600 [Arabidopsis thalian 0.988 0.186 0.516 1.5e-17
TAIR|locus:2095502451 AT3G28570 [Arabidopsis thalian 0.988 0.197 0.505 2.1e-17
TAIR|locus:2178057470 AT5G40000 [Arabidopsis thalian 0.988 0.189 0.5 1.1e-16
TAIR|locus:2077997 BCS1 "cytochrome BC1 synthesis" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 266 (98.7 bits), Expect = 3.1e-22, P = 3.1e-22
 Identities = 56/91 (61%), Positives = 65/91 (71%)

Query:     2 TLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPA 61
             TLS +L FID LW   GDERI+I  TN+K KLD  LLRPG MD+HIHMSYCTP  F+  A
Sbjct:   389 TLSGLLNFIDGLWSSCGDERIIIFTTNYKEKLDAALLRPGRMDMHIHMSYCTPSTFKALA 448

Query:    62 SNYLQIIEHPLFSKIEMLLELKKVI--QVAE 90
              NYL+I EH LFSKIE  +E  +V   +VAE
Sbjct:   449 LNYLEIKEHRLFSKIEEGIEATEVTPAEVAE 479
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009611 "response to wounding" evidence=RCA
GO:0009612 "response to mechanical stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
TAIR|locus:2078007 AT3G50940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716649 AT2G18193 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053109 AT2G18190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115954 AT4G05380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095537 AT3G28610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175986 AT5G17760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095532 AT3G28600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095502 AT3G28570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178057 AT5G40000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.88
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.78
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.77
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.74
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.73
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.72
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.71
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.68
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.68
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.67
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.67
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.66
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.62
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.59
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.58
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.58
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.57
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.55
CHL00206 2281 ycf2 Ycf2; Provisional 99.55
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.52
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.52
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.52
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.5
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.49
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.49
PRK03992389 proteasome-activating nucleotidase; Provisional 99.46
CHL00176 638 ftsH cell division protein; Validated 99.46
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.45
CHL00195489 ycf46 Ycf46; Provisional 99.35
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.33
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.18
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.15
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.09
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.07
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.07
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.06
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 98.84
PF00004132 AAA: ATPase family associated with various cellula 98.5
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 98.0
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 97.44
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 97.42
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.17
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.77
CHL00181287 cbbX CbbX; Provisional 96.58
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.49
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.27
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.12
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.99
COG0714 329 MoxR-like ATPases [General function prediction onl 95.12
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.11
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.99
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 94.94
PRK06893229 DNA replication initiation factor; Validated 94.57
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 94.32
PRK10865 857 protein disaggregation chaperone; Provisional 94.31
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 94.02
PRK07940 394 DNA polymerase III subunit delta'; Validated 93.91
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.5
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.14
PRK13407334 bchI magnesium chelatase subunit I; Provisional 93.09
PRK06964 342 DNA polymerase III subunit delta'; Validated 93.08
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.87
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 92.85
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 92.67
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 92.33
PRK00149 450 dnaA chromosomal replication initiation protein; R 92.26
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 92.25
PHA02544 316 44 clamp loader, small subunit; Provisional 92.22
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 91.14
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 89.72
PRK12422 445 chromosomal replication initiation protein; Provis 89.1
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 89.04
KOG0736 953 consensus Peroxisome assembly factor 2 containing 88.81
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 88.3
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 88.11
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 88.03
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 87.06
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 86.74
PRK14086 617 dnaA chromosomal replication initiation protein; P 86.59
PRK07471 365 DNA polymerase III subunit delta'; Validated 86.13
smart00350509 MCM minichromosome maintenance proteins. 85.91
PRK11331459 5-methylcytosine-specific restriction enzyme subun 84.96
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 84.82
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 84.64
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 84.13
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 83.99
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 83.99
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 83.84
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 83.75
PRK09112 351 DNA polymerase III subunit delta'; Validated 83.34
PRK08727233 hypothetical protein; Validated 83.32
PRK14088 440 dnaA chromosomal replication initiation protein; P 83.14
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 83.01
PRK12402 337 replication factor C small subunit 2; Reviewed 82.86
PRK05707 328 DNA polymerase III subunit delta'; Validated 82.44
PRK09087226 hypothetical protein; Validated 81.83
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 81.8
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 81.64
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 80.76
PRK08903227 DnaA regulatory inactivator Hda; Validated 80.03
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.9e-36  Score=236.05  Aligned_cols=90  Identities=59%  Similarity=0.904  Sum_probs=87.4

Q ss_pred             CcHHHHHHHhcCCCCCCCCceEEEEecCCCCCcccccCCCCcccceeecCCCCHHHHHHHHHhhcCCCC-CccHHHHHHH
Q 038334            1 ATLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQIIE-HPLFSKIEML   79 (90)
Q Consensus         1 ~tls~lL~~lDG~~~~~~~~~ivi~tTN~~e~lDpAllRpGR~D~~I~~~~p~~~~~~~l~~~~l~~~~-~~l~~~i~~l   79 (90)
                      ||+|+|||++||+||+||++|||||||||+|+|||||+||||+|+||||++|++++++.|+++||+.++ |++|++|+++
T Consensus       319 VTlSGLLNfiDGlwSscg~ERIivFTTNh~EkLDPALlRpGRmDmhI~mgyCtf~~fK~La~nYL~~~~~h~L~~eie~l  398 (457)
T KOG0743|consen  319 VTLSGLLNFLDGLWSSCGDERIIVFTTNHKEKLDPALLRPGRMDMHIYMGYCTFEAFKTLASNYLGIEEDHRLFDEIERL  398 (457)
T ss_pred             eehHHhhhhhccccccCCCceEEEEecCChhhcCHhhcCCCcceeEEEcCCCCHHHHHHHHHHhcCCCCCcchhHHHHHH
Confidence            799999999999999999999999999999999999999999999999999999999999999999975 9999999999


Q ss_pred             hhccccc--cccC
Q 038334           80 LELKKVI--QVAE   90 (90)
Q Consensus        80 l~~~~~t--~v~E   90 (90)
                      +..+++|  ||+|
T Consensus       399 ~~~~~~tPA~V~e  411 (457)
T KOG0743|consen  399 IEETEVTPAQVAE  411 (457)
T ss_pred             hhcCccCHHHHHH
Confidence            9999998  8876

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.8
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.79
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.78
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.78
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.76
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.75
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.69
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.53
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.49
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.39
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.36
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.35
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.29
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.28
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.26
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.25
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.2
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.19
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.16
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.11
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.09
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.06
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.02
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.92
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 98.9
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.71
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.71
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.64
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.6
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.29
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.45
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.37
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.37
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.23
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.05
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.03
2r44_A 331 Uncharacterized protein; putative ATPase, structur 96.98
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.72
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.71
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.69
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 96.64
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.59
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 96.59
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.56
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.53
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 96.28
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.22
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 96.11
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.04
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.86
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.78
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.66
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.52
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.41
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 95.37
2chq_A 319 Replication factor C small subunit; DNA-binding pr 95.14
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 95.1
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 95.02
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 94.77
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 94.63
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.62
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.39
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 94.23
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.16
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.04
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 94.01
3bos_A242 Putative DNA replication factor; P-loop containing 93.98
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 93.94
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 93.73
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.24
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 92.66
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 92.13
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 90.73
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 89.65
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 87.92
3pvs_A 447 Replication-associated recombination protein A; ma 87.6
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 86.56
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 84.96
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 81.64
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.80  E-value=5e-20  Score=143.82  Aligned_cols=77  Identities=21%  Similarity=0.197  Sum_probs=66.5

Q ss_pred             cHHHHHHHhcCCCCCCCCceEEEEecCCCCCcccccCCCCcccceeecCCCCHHHHHHHHHhhcCCC---CCccHHHHHH
Q 038334            2 TLSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQII---EHPLFSKIEM   78 (90)
Q Consensus         2 tls~lL~~lDG~~~~~~~~~ivi~tTN~~e~lDpAllRpGR~D~~I~~~~p~~~~~~~l~~~~l~~~---~~~l~~~i~~   78 (90)
                      ++++||++|||+.+.  ++++||+|||+|+.|||||+||||||++|+|++|+.++|++|++.|++..   ....+.++.+
T Consensus       271 ~l~~lL~~lDg~~~~--~~V~vIaATNrpd~LDpAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~~lA~  348 (405)
T 4b4t_J          271 TMLELLNQLDGFETS--KNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAE  348 (405)
T ss_dssp             HHHHHHHHHHTTTCC--CCEEEEEEESCSSSSCHHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHHHHHH
T ss_pred             HHHHHHHhhhccCCC--CCeEEEeccCChhhCCHhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHHHHHH
Confidence            478999999999988  78999999999999999999999999999999999999999999998643   2234555555


Q ss_pred             Hh
Q 038334           79 LL   80 (90)
Q Consensus        79 ll   80 (90)
                      ..
T Consensus       349 ~t  350 (405)
T 4b4t_J          349 KM  350 (405)
T ss_dssp             HC
T ss_pred             HC
Confidence            43
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 90
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 6e-05
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-04
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 2e-04
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]

 Score = 37.5 bits (87), Expect = 6e-05
 Identities = 19/82 (23%), Positives = 32/82 (39%), Gaps = 4/82 (4%)

Query: 2   TLSRMLTFIDRLWLGYGDERIMIV-KTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMP 60
           TL+++L  +D       D  I+++  TN    LD  LLRPG  D  I +      G    
Sbjct: 131 TLNQLLVEMDGFE---KDTAIVVMAATNRPDILDPALLRPGRFDRQIAIDAPDVKGREQI 187

Query: 61  ASNYLQIIEHPLFSKIEMLLEL 82
              + +         + +L + 
Sbjct: 188 LRIHARGKPLAEDVDLALLAKR 209
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.69
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.67
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.66
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.6
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.15
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.53
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.42
d1svma_362 Papillomavirus large T antigen helicase domain {Si 97.17
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.01
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.87
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.49
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.86
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.58
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.18
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.86
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.54
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.51
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.15
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 88.43
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.11
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=99.69  E-value=2.7e-17  Score=118.81  Aligned_cols=64  Identities=27%  Similarity=0.311  Sum_probs=59.7

Q ss_pred             HHHHHHHhcCCCCCCCCceEEEEecCCCCCcccccCCCCcccceeecCCCCHHHHHHHHHhhcCCC
Q 038334            3 LSRMLTFIDRLWLGYGDERIMIVKTNHKAKLDLTLLRPGHMDVHIHMSYCTPCGFRMPASNYLQII   68 (90)
Q Consensus         3 ls~lL~~lDG~~~~~~~~~ivi~tTN~~e~lDpAllRpGR~D~~I~~~~p~~~~~~~l~~~~l~~~   68 (90)
                      +++||+.|||+.+.  .++++|+|||+|+.||||++||||||.+|+|++|+.++|+++++.|+...
T Consensus       135 ~~~ll~~~d~~~~~--~~v~vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~  198 (256)
T d1lv7a_         135 LNQMLVEMDGFEGN--EGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRV  198 (256)
T ss_dssp             HHHHHHHHHTCCSS--SCEEEEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTS
T ss_pred             HHHHHHHhhCCCCC--CCEEEEEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCC
Confidence            57899999999877  78999999999999999999999999999999999999999999998653
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure