Citrus Sinensis ID: 038379

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRVINT
ccccccccHHcccccccccEEEEEEccccccccccEEEEEEcccccccccccccEEEcHHHHHHHHHHHHHccccEEEEEcccEEEEEEcccc
ccEEcccHHHHHHHHccccccccccHHHHHHHccccEEEEEcHHHHccccHHHEEEEcHHHHHHHHHHHHHcccEEEEEEcccEEEEEccccc
mvlfdqgtydkhfptLRECLFLVRscgkvsqeGTKMFVKLCFTstgneagfNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRVINT
mvlfdqgtydkhfptlRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMIsayasqqiYTRVINT
MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRVINT
***FDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRVI**
MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRV***
MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRVINT
MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRV***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISAYASQQIYTRVINT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
P46301108 40S ribosomal protein S25 N/A no 0.741 0.638 0.462 5e-12
Q9SIK2108 40S ribosomal protein S25 yes no 0.741 0.638 0.440 1e-10
Q9T029108 40S ribosomal protein S25 yes no 0.741 0.638 0.419 7e-10
Q8GYL5108 40S ribosomal protein S25 no no 0.709 0.611 0.422 2e-09
Q9SIW5109 40S ribosomal protein S25 no no 0.698 0.596 0.393 2e-07
Q94G66114 40S ribosomal protein S25 N/A no 0.731 0.596 0.369 3e-06
>sp|P46301|RS25_SOLLC 40S ribosomal protein S25 OS=Solanum lycopersicum GN=RPS25 PE=3 SV=1 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 51/93 (54%), Gaps = 24/93 (25%)

Query: 1   MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGS 60
           MVLFD+ TYDK                    E  K   KL   S       +  + ISGS
Sbjct: 40  MVLFDKSTYDKLL-----------------SEAPK--YKLITPSV-----LSDRLRISGS 75

Query: 61  LASRAIKDLVARGSIRMISAYASQQIYTRVINT 93
           LA +AI+DL+ARGSIRM+SA+ASQQIYTR  NT
Sbjct: 76  LARKAIRDLMARGSIRMVSAHASQQIYTRATNT 108

Solanum lycopersicum (taxid: 4081)
>sp|Q9SIK2|RS252_ARATH 40S ribosomal protein S25-2 OS=Arabidopsis thaliana GN=RPS25B PE=2 SV=1 Back     alignment and function description
>sp|Q9T029|RS254_ARATH 40S ribosomal protein S25-4 OS=Arabidopsis thaliana GN=RPS25E PE=2 SV=1 Back     alignment and function description
>sp|Q8GYL5|RS253_ARATH 40S ribosomal protein S25-3 OS=Arabidopsis thaliana GN=RPS25D PE=3 SV=2 Back     alignment and function description
>sp|Q9SIW5|RS251_ARATH 40S ribosomal protein S25-1 OS=Arabidopsis thaliana GN=RPS25A PE=3 SV=3 Back     alignment and function description
>sp|Q94G66|RS25_AMACR 40S ribosomal protein S25 OS=Amaranthus cruentus GN=RPS25 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
449446287108 PREDICTED: 40S ribosomal protein S25-2-l 0.741 0.638 0.483 2e-11
255565659108 40S ribosomal protein S25, putative [Ric 0.741 0.638 0.494 3e-11
449453836108 PREDICTED: 40S ribosomal protein S25-2-l 0.741 0.638 0.494 3e-11
225450236108 PREDICTED: 40S ribosomal protein S25-lik 0.731 0.629 0.489 3e-11
296080976151 unnamed protein product [Vitis vinifera] 0.731 0.450 0.489 5e-11
118482837108 unknown [Populus trichocarpa] 0.741 0.638 0.473 5e-11
164564736108 CM0216.350.nc [Lotus japonicus] 0.741 0.638 0.462 8e-11
388504588108 unknown [Lotus japonicus] gi|388522993|g 0.741 0.638 0.462 8e-11
22409761269 predicted protein [Populus trichocarpa] 0.741 1.0 0.483 1e-10
116779097108 unknown [Picea sitchensis] gi|116779909| 0.741 0.638 0.473 1e-10
>gi|449446287|ref|XP_004140903.1| PREDICTED: 40S ribosomal protein S25-2-like [Cucumis sativus] gi|449494149|ref|XP_004159463.1| PREDICTED: 40S ribosomal protein S25-2-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 24/93 (25%)

Query: 1   MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGS 60
           MVLFDQGTYDK          L+    K          KL   S       +  + ++GS
Sbjct: 40  MVLFDQGTYDK----------LLSEVPKY---------KLVTPSI-----LSDRMRVNGS 75

Query: 61  LASRAIKDLVARGSIRMISAYASQQIYTRVINT 93
           LA RAIKDL+ARGSIRMISA++SQQIYTR  NT
Sbjct: 76  LARRAIKDLMARGSIRMISAHSSQQIYTRATNT 108

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255565659|ref|XP_002523819.1| 40S ribosomal protein S25, putative [Ricinus communis] gi|223536907|gb|EEF38545.1| 40S ribosomal protein S25, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449453836|ref|XP_004144662.1| PREDICTED: 40S ribosomal protein S25-2-like [Cucumis sativus] gi|449499412|ref|XP_004160809.1| PREDICTED: 40S ribosomal protein S25-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225450236|ref|XP_002267311.1| PREDICTED: 40S ribosomal protein S25-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296080976|emb|CBI18574.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|118482837|gb|ABK93334.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|164564736|dbj|BAF98218.1| CM0216.350.nc [Lotus japonicus] Back     alignment and taxonomy information
>gi|388504588|gb|AFK40360.1| unknown [Lotus japonicus] gi|388522993|gb|AFK49558.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224097612|ref|XP_002311010.1| predicted protein [Populus trichocarpa] gi|222850830|gb|EEE88377.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|116779097|gb|ABK21138.1| unknown [Picea sitchensis] gi|116779909|gb|ABK21473.1| unknown [Picea sitchensis] gi|116788763|gb|ABK24990.1| unknown [Picea sitchensis] gi|116790134|gb|ABK25512.1| unknown [Picea sitchensis] gi|116793648|gb|ABK26827.1| unknown [Picea sitchensis] gi|148906644|gb|ABR16473.1| unknown [Picea sitchensis] gi|148906786|gb|ABR16539.1| unknown [Picea sitchensis] gi|224284082|gb|ACN39778.1| unknown [Picea sitchensis] gi|224286580|gb|ACN40995.1| unknown [Picea sitchensis] gi|224286704|gb|ACN41055.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
TAIR|locus:2049369108 AT2G21580 "AT2G21580" [Arabido 0.419 0.361 0.641 2.6e-13
TAIR|locus:2136348108 AT4G39200 "AT4G39200" [Arabido 0.419 0.361 0.615 2.2e-12
TAIR|locus:505006559108 AT4G34555 "AT4G34555" [Arabido 0.376 0.324 0.657 5.8e-12
UNIPROTKB|Q56JX5125 RPS25 "40S ribosomal protein S 0.354 0.264 0.454 5.2e-07
UNIPROTKB|P62851125 RPS25 "40S ribosomal protein S 0.354 0.264 0.454 5.2e-07
UNIPROTKB|F2Z5G8125 RPS25 "Uncharacterized protein 0.354 0.264 0.454 5.2e-07
MGI|MGI:1922867125 Rps25 "ribosomal protein S25" 0.354 0.264 0.454 5.2e-07
RGD|621043125 Rps25 "ribosomal protein s25" 0.354 0.264 0.454 5.2e-07
UNIPROTKB|F1NU56139 RPS25 "Uncharacterized protein 0.354 0.237 0.454 6.5e-07
ZFIN|ZDB-GENE-040426-1788132 rps25 "ribosomal protein S25" 0.354 0.25 0.454 6.5e-07
TAIR|locus:2049369 AT2G21580 "AT2G21580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 2.6e-13, Sum P(2) = 2.6e-13
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query:    55 VHISGSLASRAIKDLVARGSIRMISAYASQQIYTRVINT 93
             + I+GSLA RAI++L+A+G IRM+SA++SQQIYTR  NT
Sbjct:    70 MRINGSLARRAIRELMAKGLIRMVSAHSSQQIYTRATNT 108
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0005840 "ribosome" evidence=ISS
GO:0006412 "translation" evidence=ISS
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0022627 "cytosolic small ribosomal subunit" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0001510 "RNA methylation" evidence=RCA
TAIR|locus:2136348 AT4G39200 "AT4G39200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006559 AT4G34555 "AT4G34555" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q56JX5 RPS25 "40S ribosomal protein S25" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62851 RPS25 "40S ribosomal protein S25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5G8 RPS25 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1922867 Rps25 "ribosomal protein S25" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621043 Rps25 "ribosomal protein s25" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NU56 RPS25 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1788 rps25 "ribosomal protein S25" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
pfam03297105 pfam03297, Ribosomal_S25, S25 ribosomal protein 2e-12
COG4901107 COG4901, COG4901, Ribosomal protein S25 [Translati 0.004
>gnl|CDD|217479 pfam03297, Ribosomal_S25, S25 ribosomal protein Back     alignment and domain information 
 Score = 57.4 bits (139), Expect = 2e-12
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 24/90 (26%)

Query: 1   MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGS 60
            VLFD+ TYDK                 + +E      KL   S  ++      + I+GS
Sbjct: 39  AVLFDKATYDK-----------------LLKEVPTY--KLITPSVLSDR-----LKINGS 74

Query: 61  LASRAIKDLVARGSIRMISAYASQQIYTRV 90
           LA RA+++L  +G I+ +  +++Q IYTR 
Sbjct: 75  LARRALRELEEKGLIKPVVKHSAQLIYTRA 104

Length = 105
>gnl|CDD|227238 COG4901, COG4901, Ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG1767110 consensus 40S ribosomal protein S25 [Translation, 99.96
PRK0933486 30S ribosomal protein S25e; Provisional 99.93
PF03297105 Ribosomal_S25: S25 ribosomal protein; InterPro: IP 99.93
COG4901107 Ribosomal protein S25 [Translation, ribosomal stru 99.7
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 94.24
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 93.51
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 93.29
PRK04984 239 fatty acid metabolism regulator; Provisional 92.76
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 92.69
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 92.54
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 91.57
PRK03837 241 transcriptional regulator NanR; Provisional 91.2
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 90.87
TIGR02404 233 trehalos_R_Bsub trehalose operon repressor, B. sub 90.74
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 90.52
TIGR02325 238 C_P_lyase_phnF phosphonates metabolism transcripti 90.46
PRK14165 217 winged helix-turn-helix domain-containing protein/ 90.23
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 89.38
PRK11402 241 DNA-binding transcriptional regulator FrlR; Provis 89.3
PRK09764 240 DNA-binding transcriptional repressor MngR; Provis 89.25
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 89.15
TIGR02018 230 his_ut_repres histidine utilization repressor, pro 88.91
COG2188 236 PhnF Transcriptional regulators [Transcription] 88.83
PF1373055 HTH_36: Helix-turn-helix domain 88.53
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 88.4
PRK10225 257 DNA-binding transcriptional repressor UxuR; Provis 88.19
COG1846126 MarR Transcriptional regulators [Transcription] 88.15
PRK14999 241 histidine utilization repressor; Provisional 87.95
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 87.88
TIGR03338 212 phnR_burk phosphonate utilization associated trans 87.65
PF0822261 HTH_CodY: CodY helix-turn-helix domain; InterPro: 87.57
PRK10079 241 phosphonate metabolism transcriptional regulator P 87.27
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 86.79
TIGR02812 235 fadR_gamma fatty acid metabolism transcriptional r 86.66
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 86.12
PRK10421 253 DNA-binding transcriptional repressor LldR; Provis 85.43
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 85.09
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 84.85
PRK09464 254 pdhR transcriptional regulator PdhR; Reviewed 84.71
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 84.64
PRK11534 224 DNA-binding transcriptional regulator CsiR; Provis 84.63
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 84.58
PRK09990 251 DNA-binding transcriptional regulator GlcC; Provis 84.53
PRK11523 253 DNA-binding transcriptional repressor ExuR; Provis 84.5
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 84.35
PF1450248 HTH_41: Helix-turn-helix domain 84.29
TIGR03337 231 phnR transcriptional regulator protein. This famil 84.23
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 83.83
PRK13509 251 transcriptional repressor UlaR; Provisional 81.93
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 81.9
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 81.54
COG3355126 Predicted transcriptional regulator [Transcription 81.49
PRK11414 221 colanic acid/biofilm transcriptional regulator; Pr 81.39
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 81.36
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 81.17
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 80.21
>KOG1767 consensus 40S ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=99.96  E-value=3.3e-30  Score=182.98  Aligned_cols=68  Identities=40%  Similarity=0.571  Sum_probs=66.7

Q ss_pred             CeeechhhhhhhhhhhhhhhhhhhhcCccccccceeeeeEEEeccCCcccccceeeeeHHHHHHHHHHHHHcCCeeeeee
Q 038379            1 MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISA   80 (93)
Q Consensus         1 ~VlfDk~TydK~~kev~~~~~~~~~~~~~~~~g~~~~vKli~T~s~~~~~~~~rlkI~gSLAr~alkdL~~kG~Ik~Vs~   80 (93)
                      ||||||+||||+++|+|.               |    |+| |||+    ++||++|||||||+||+||.++|+|++|++
T Consensus        40 ~Vlfdqatydkl~kevp~---------------~----k~i-t~sv----l~dRlkIngsLAr~alr~L~~kG~Ik~Vs~   95 (110)
T KOG1767|consen   40 AVLFDQATYDKLLKEVPK---------------Y----KLI-TPSV----LSDRLKINGSLARAALRELSNKGVIKQVSK   95 (110)
T ss_pred             heeecHHHHHHHHHhccc---------------c----eee-cHHH----hhhhhhhchHHHHHHHHHHHhcchHHHHhh
Confidence            799999999999999999               9    999 9999    999999999999999999999999999999


Q ss_pred             ccceEEEEeecC
Q 038379           81 YASQQIYTRVIN   92 (93)
Q Consensus        81 ~~~Q~IYTR~~~   92 (93)
                      |++|+||||+++
T Consensus        96 h~~q~IYTrat~  107 (110)
T KOG1767|consen   96 HSKQVIYTRATA  107 (110)
T ss_pred             cchheeeccccc
Confidence            999999999986

>PRK09334 30S ribosomal protein S25e; Provisional Back     alignment and domain information
>PF03297 Ribosomal_S25: S25 ribosomal protein; InterPro: IPR004977 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PRK04984 fatty acid metabolism regulator; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PRK03837 transcriptional regulator NanR; Provisional Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>TIGR02404 trehalos_R_Bsub trehalose operon repressor, B Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>TIGR02325 C_P_lyase_phnF phosphonates metabolism transcriptional regulator PhnF Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>PRK11402 DNA-binding transcriptional regulator FrlR; Provisional Back     alignment and domain information
>PRK09764 DNA-binding transcriptional repressor MngR; Provisional Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>TIGR02018 his_ut_repres histidine utilization repressor, proteobacterial Back     alignment and domain information
>COG2188 PhnF Transcriptional regulators [Transcription] Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK10225 DNA-binding transcriptional repressor UxuR; Provisional Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK14999 histidine utilization repressor; Provisional Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator Back     alignment and domain information
>PF08222 HTH_CodY: CodY helix-turn-helix domain; InterPro: IPR013198 This family consists of the C-terminal helix-turn-helix domain found in several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins Back     alignment and domain information
>PRK10079 phosphonate metabolism transcriptional regulator PhnF; Provisional Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>TIGR02812 fadR_gamma fatty acid metabolism transcriptional regulator FadR Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PRK10421 DNA-binding transcriptional repressor LldR; Provisional Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PRK09464 pdhR transcriptional regulator PdhR; Reviewed Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PRK11534 DNA-binding transcriptional regulator CsiR; Provisional Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>PRK09990 DNA-binding transcriptional regulator GlcC; Provisional Back     alignment and domain information
>PRK11523 DNA-binding transcriptional repressor ExuR; Provisional Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>PF14502 HTH_41: Helix-turn-helix domain Back     alignment and domain information
>TIGR03337 phnR transcriptional regulator protein Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11414 colanic acid/biofilm transcriptional regulator; Provisional Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3iz6_V108 Localization Of The Small Subunit Ribosomal Protein 1e-07
>pdb|3IZ6|V Chain V, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 108 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 46/91 (50%), Gaps = 24/91 (26%)
Query: 2   VLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSL 61
           VLFD+ TYDK          L+    K  Q    +  +               + I+GSL
Sbjct: 41  VLFDKATYDK----------LLSEVPKYKQITPSVLSER--------------LRINGSL 76
Query: 62  ASRAIKDLVARGSIRMISAYASQQIYTRVIN 92
           A +AIKDL +RG+IR++S ++SQ IYTR  N
Sbjct: 77  ARQAIKDLESRGAIRVVSVHSSQLIYTRATN 107

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
2xzm_8143 RPS25E,; ribosome, translation; 3.93A {Tetrahymena 3e-11
3iz6_V108 40S ribosomal protein S25 (S25E); eukaryotic ribos 7e-11
3u5c_Z108 RP45, S31, YS23, 40S ribosomal protein S25-A; tran 3e-10
>2xzm_8 RPS25E,; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_8 Length = 143 Back     alignment and structure
 Score = 54.8 bits (131), Expect = 3e-11
 Identities = 13/93 (13%), Positives = 34/93 (36%), Gaps = 23/93 (24%)

Query: 1   MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGS 60
            V  ++   +                  +    +K+  K+   ST  E      + ++GS
Sbjct: 42  AVFIEKKNVES-----------------IINNPSKVG-KVLTVSTVVEK-----LKVNGS 78

Query: 61  LASRAIKDLVARGSIRMISAYASQQIYTRVINT 93
           LA + ++ +  R  +  ++   +Q +Y+ +   
Sbjct: 79  LARQLMRTMADRKLVEKVAKNGNQWVYSVIGGV 111
>3iz6_V 40S ribosomal protein S25 (S25E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 108 Back     alignment and structure
>3u5c_Z RP45, S31, YS23, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_V 3o30_Q 3o2z_Q 3u5g_Z Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
3u5c_Z108 RP45, S31, YS23, 40S ribosomal protein S25-A; tran 99.95
3iz6_V108 40S ribosomal protein S25 (S25E); eukaryotic ribos 99.95
2xzm_8143 RPS25E,; ribosome, translation; 3.93A {Tetrahymena 99.93
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 92.64
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 92.51
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 92.45
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 91.7
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 91.64
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 91.56
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 91.26
3ic7_A126 Putative transcriptional regulator; helix-turn-hel 91.21
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 91.2
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 91.16
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 90.79
3by6_A126 Predicted transcriptional regulator; structural ge 90.02
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 89.95
1sfx_A109 Conserved hypothetical protein AF2008; structural 89.78
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 89.55
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 89.37
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 89.06
2nnn_A140 Probable transcriptional regulator; structural gen 88.75
3edp_A 236 LIN2111 protein; APC88337, listeria innocua CLIP11 88.3
3df8_A111 Possible HXLR family transcriptional factor; APC89 88.29
3bdd_A142 Regulatory protein MARR; putative multiple antibio 88.15
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 88.15
1okr_A123 MECI, methicillin resistance regulatory protein ME 87.96
2gxg_A146 146AA long hypothetical transcriptional regulator; 87.94
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 87.93
3f3x_A144 Transcriptional regulator, MARR family, putative; 87.9
2oqg_A114 Possible transcriptional regulator, ARSR family P; 87.74
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 87.74
2pex_A153 Transcriptional regulator OHRR; transcription regu 87.52
3oop_A143 LIN2960 protein; protein structure initiative, PSI 87.46
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 87.29
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 87.26
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 87.23
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 87.23
3eet_A 272 Putative GNTR-family transcriptional regulator; st 87.22
2jt1_A77 PEFI protein; solution structure, winged helix-tur 87.19
3s2w_A159 Transcriptional regulator, MARR family; structural 87.13
2hr3_A147 Probable transcriptional regulator; MCSG, structur 87.12
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 87.0
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 86.77
3e6m_A161 MARR family transcriptional regulator; APC88769, s 86.76
2pg4_A95 Uncharacterized protein; structural genomics, join 86.69
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 86.68
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 86.66
1hw1_A 239 FADR, fatty acid metabolism regulator protein; hel 86.64
3jth_A98 Transcription activator HLYU; transcription factor 86.53
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 86.48
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 86.41
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 86.35
2kko_A108 Possible transcriptional regulatory protein (possi 86.28
2v7f_A150 RPS19, RPS19E SSU ribosomal protein S19E; diamond 86.25
1p6r_A82 Penicillinase repressor; transcription regulation, 86.22
2vn2_A128 DNAD, chromosome replication initiation protein; D 86.04
1z91_A147 Organic hydroperoxide resistance transcriptional; 86.0
1ku9_A152 Hypothetical protein MJ223; putative transcription 85.96
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 85.9
2wv0_A 243 YVOA, HTH-type transcriptional repressor YVOA; DNA 85.88
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 85.74
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 85.71
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 85.69
2eth_A154 Transcriptional regulator, putative, MAR family; M 85.49
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 85.35
1s3j_A155 YUSO protein; structural genomics, MARR transcript 85.34
3bwg_A 239 Uncharacterized HTH-type transcriptional regulato; 85.33
3cjn_A162 Transcriptional regulator, MARR family; silicibact 85.3
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 85.29
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 85.25
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 85.23
3ech_A142 MEXR, multidrug resistance operon repressor; winge 85.06
4fx0_A148 Probable transcriptional repressor protein; helix- 85.02
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 84.89
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 84.6
2ra5_A 247 Putative transcriptional regulator; beta structure 84.55
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 84.47
3f8m_A 248 GNTR-family protein transcriptional regulator; PHN 84.18
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 84.05
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 83.87
3f6o_A118 Probable transcriptional regulator, ARSR family pr 83.85
3r0a_A123 Putative transcriptional regulator; structural gen 83.81
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 83.71
2nyx_A168 Probable transcriptional regulatory protein, RV14; 83.64
2frh_A127 SARA, staphylococcal accessory regulator A; winged 83.64
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 83.6
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 83.52
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 83.48
3nqo_A189 MARR-family transcriptional regulator; structural 83.48
3bja_A139 Transcriptional regulator, MARR family, putative; 83.4
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 83.28
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 83.2
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 83.08
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 82.88
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 82.87
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 82.62
3sxy_A 218 Transcriptional regulator, GNTR family; transcript 82.57
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 82.34
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 82.3
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 82.2
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 81.74
4aik_A151 Transcriptional regulator SLYA; transcription, tra 81.39
2di3_A 239 Bacterial regulatory proteins, GNTR family; helix- 81.33
2h09_A155 Transcriptional regulator MNTR; transcription regu 81.31
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 81.27
3boq_A160 Transcriptional regulator, MARR family; MARR famil 80.89
3c7j_A 237 Transcriptional regulator, GNTR family; structural 80.58
2hs5_A 239 Putative transcriptional regulator GNTR; APC6050, 80.45
3ihu_A 222 Transcriptional regulator, GNTR family; YP_298823. 80.11
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 80.09
>3u5c_Z RP45, S31, YS23, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_V 3o30_Q 3o2z_Q 3u5g_Z Back     alignment and structure
Probab=99.95  E-value=7.3e-30  Score=178.15  Aligned_cols=69  Identities=30%  Similarity=0.431  Sum_probs=65.9

Q ss_pred             CeeechhhhhhhhhhhhhhhhhhhhcCccccccceeeeeEEEeccCCcccccceeeeeHHHHHHHHHHHHHcCCeeeeee
Q 038379            1 MVLFDQGTYDKHFPTLRECLFLVRSCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMISA   80 (93)
Q Consensus         1 ~VlfDk~TydK~~kev~~~~~~~~~~~~~~~~g~~~~vKli~T~s~~~~~~~~rlkI~gSLAr~alkdL~~kG~Ik~Vs~   80 (93)
                      +|+||++||||+++|||+               +    |+| ||++    ++||++|+|||||+||+||+++|+|++|++
T Consensus        39 ~VlfDk~t~dkl~KEVpk---------------~----KlI-Tpsv----lseRlkI~gSLAR~aLreL~~kGlIk~V~k   94 (108)
T 3u5c_Z           39 AVILDQEKYDRILKEVPT---------------Y----RYV-SVSV----LVDRLKIGGSLARIALRHLEKEGIIKPISK   94 (108)
T ss_dssp             CSSCTTHHHHHHHHHCSS---------------C----SSB-SHHH----HHHTTCCCTTHHHHHHHHHSSSSSCEEEEC
T ss_pred             ceeeCHHHHHHHHHHccC---------------C----eEE-eHHH----hhhhhhhhHHHHHHHHHHHHHCCCEEEEec
Confidence            599999999999999999               9    999 9999    999999999999999999999999999999


Q ss_pred             ccceEEEEeecCC
Q 038379           81 YASQQIYTRVINT   93 (93)
Q Consensus        81 ~~~Q~IYTR~~~~   93 (93)
                      |++|.||||++++
T Consensus        95 h~~q~IYTr~~~~  107 (108)
T 3u5c_Z           95 HSKQAIYTRATAS  107 (108)
T ss_dssp             CSSCCEEECCC--
T ss_pred             CCCEEEEecCccC
Confidence            9999999999864
>3iz6_V 40S ribosomal protein S25 (S25E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xzm_8 RPS25E,; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_8 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ic7_A Putative transcriptional regulator; helix-turn-helix, structural genomics, PSI-2, protein struct initiative; 2.82A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3edp_A LIN2111 protein; APC88337, listeria innocua CLIP11262, structural GE PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.09A {Listeria innocua} Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>3eet_A Putative GNTR-family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.97A {Streptomyces avermitilis} Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>1hw1_A FADR, fatty acid metabolism regulator protein; helix-turn-helix, helix bundle, transcription; 1.50A {Escherichia coli} SCOP: a.4.5.6 a.78.1.1 PDB: 1hw2_A 1e2x_A 1h9g_A* 1h9t_A Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2v7f_A RPS19, RPS19E SSU ribosomal protein S19E; diamond blackfan anemia small ribosomal subunit; 1.15A {Pyrococcus abyssi} SCOP: a.4.5.84 Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2wv0_A YVOA, HTH-type transcriptional repressor YVOA; DNA-binding, transcription regulation, transcriptional regulator, GNTR/HUTC family; 2.40A {Bacillus subtilis} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3bwg_A Uncharacterized HTH-type transcriptional regulato; APC85486, YYDK, transcriptional regulator, structural genomi 2; 2.09A {Bacillus subtilis subsp} SCOP: a.4.5.6 d.190.1.2 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2ra5_A Putative transcriptional regulator; beta structure, UTRA domain, structural genomics, PSI-2, protein structure initiative; HET: SRT; 2.40A {Streptomyces coelicolor A3} SCOP: d.190.1.2 Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>3f8m_A GNTR-family protein transcriptional regulator; PHNF, HUTC, winged helix-TUR UTRA, DNA-binding, transcription regulation; 1.80A {Mycobacterium smegmatis} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3sxy_A Transcriptional regulator, GNTR family; transcription factor, metal-binding, structur genomics, PSI-2, protein structure initiative; 1.65A {Thermotoga maritima} PDB: 3dbw_A 3fms_A* Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2di3_A Bacterial regulatory proteins, GNTR family; helix-turn-helix, transcription; 2.05A {Corynebacterium glutamicum} Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3c7j_A Transcriptional regulator, GNTR family; structural genomics, PSI-2, protein structure initiative, midwest center for STR genomics; HET: MSE; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>2hs5_A Putative transcriptional regulator GNTR; APC6050, rhodococcus SP. RH structural genomics, PSI-2, protein structure initiative; 2.20A {Rhodococcus SP} SCOP: a.4.5.6 a.78.1.1 Back     alignment and structure
>3ihu_A Transcriptional regulator, GNTR family; YP_298823.1, DNA binding protein, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.92A {Ralstonia eutropha} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 95.13
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 92.05
d1hw1a174 Fatty acid responsive transcription factor FadR, N 91.32
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 90.43
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 90.2
d2dk5a178 DNA-directed RNA polymerase III subunit RPC6, RPO3 90.15
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 90.05
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 89.29
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 88.98
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 88.97
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 88.86
d1v4ra1100 Transcriptional repressor TraR, N-terminal domain 87.8
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 87.17
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 86.99
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 86.3
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 86.23
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 86.1
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 85.64
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 85.51
d1z91a1137 Organic hydroperoxide resistance transcriptional r 85.1
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 84.06
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 84.01
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 83.02
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 82.67
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 82.62
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 82.32
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 82.13
d1i5za169 Catabolite gene activator protein (CAP), C-termina 81.8
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 81.3
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 81.08
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 80.77
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Ta1064 (RFK), N-terminal domain
species: Thermoplasma acidophilum [TaxId: 2303]

Probab=95.13  E-value=0.0087  Score=36.30  Aligned_cols=43  Identities=30%  Similarity=0.310  Sum_probs=37.5

Q ss_pred             hcCccccccceeeeeEEEeccCCcccccceeeeeHHHHHHHHHHHHHcCCeeee
Q 038379           25 SCGKVSQEGTKMFVKLCFTSTGNEAGFNCLVHISGSLASRAIKDLVARGSIRMI   78 (93)
Q Consensus        25 ~~~~~~~~g~~~~vKli~T~s~~~~~~~~rlkI~gSLAr~alkdL~~kG~Ik~V   78 (93)
                      .++..++.|.       +|++-    +++++.++-|-..+.|+.|+++|+|..-
T Consensus        12 ~~~~~~~~~~-------lt~~e----La~~l~i~~~~vs~~l~~Le~~GlV~r~   54 (85)
T d3ctaa1          12 EAAEASNRAY-------LTSSK----LADMLGISQQSASRIIIDLEKNGYITRT   54 (85)
T ss_dssp             HHTTTSSEEE-------CCHHH----HHHHHTSCHHHHHHHHHHHHHTTSEEEE
T ss_pred             HhhhccCCCC-------CCHHH----HHHHHCCCHHHHHHHHHHHHHCCCeeee
Confidence            3666677666       58999    9999999999999999999999999984
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure