Citrus Sinensis ID: 038389
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| 255575991 | 354 | DNA binding protein, putative [Ricinus c | 0.957 | 0.954 | 0.612 | 1e-108 | |
| 225469216 | 331 | PREDICTED: transcription factor bHLH93-l | 0.932 | 0.993 | 0.630 | 1e-108 | |
| 356496600 | 334 | PREDICTED: transcription factor bHLH93-l | 0.932 | 0.985 | 0.631 | 1e-102 | |
| 363807994 | 333 | uncharacterized protein LOC100784145 [Gl | 0.929 | 0.984 | 0.620 | 1e-99 | |
| 357485301 | 325 | BHLH transcription factor [Medicago trun | 0.915 | 0.993 | 0.602 | 1e-98 | |
| 225459000 | 334 | PREDICTED: transcription factor bHLH93 [ | 0.934 | 0.988 | 0.582 | 1e-94 | |
| 404551200 | 334 | transcription factor bHLH [Vitis vinifer | 0.934 | 0.988 | 0.579 | 3e-94 | |
| 384157481 | 334 | transcription factor bHLH [Vitis amurens | 0.934 | 0.988 | 0.579 | 3e-94 | |
| 449521403 | 341 | PREDICTED: transcription factor bHLH93-l | 0.912 | 0.944 | 0.556 | 4e-90 | |
| 359491457 | 329 | PREDICTED: transcription factor bHLH93-l | 0.906 | 0.972 | 0.557 | 8e-86 |
| >gi|255575991|ref|XP_002528891.1| DNA binding protein, putative [Ricinus communis] gi|223531645|gb|EEF33471.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 399 bits (1024), Expect = e-108, Method: Compositional matrix adjust.
Identities = 226/369 (61%), Positives = 272/369 (73%), Gaps = 31/369 (8%)
Query: 1 MELTQHGFLEELLAPPIARR------DAWSSF-----SGGLNEYLPSGWILDSLDESSTL 49
MEL+QHGFLEELL P R +W++F + G +E+ +GW DS DE+++L
Sbjct: 1 MELSQHGFLEELLQGPRIRDTNSGSGSSWATFPITTAATGSSEFFTNGWNFDSFDENTSL 60
Query: 50 AAAASNPSSFVGFSAAPSEASFECPPFTDHLHQGYHPFVDGFTVPEVDTSSYTKNEIPSF 109
+ A NP SF+GF P+E +F+C F D +PF DGFT + + P F
Sbjct: 61 SPAP-NPCSFLGF-PTPTEPTFDCS-FNDQ----TYPFFDGFTAATTTVPTEIDDHTPPF 113
Query: 110 PSAQEEYPPMVVEEDRDQLCLRSSDHLHQNHSFEE--TKSSC-AEIEQATSNITN-QGFN 165
P+ QE+YP MV +E+ L LRS HSFEE + +SC E+EQA++N N Q F+
Sbjct: 114 PT-QEDYPSMVEDEELGGLLLRS-------HSFEERLSSTSCKVELEQASNNNNNGQVFS 165
Query: 166 MGLCVDRKRKNKKLEGQPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILGDTID 225
MGL ++K K+KKLEGQPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILGDTID
Sbjct: 166 MGLSAEKKNKSKKLEGQPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILGDTID 225
Query: 226 YLKELLERINKLQEEETELGANQL-LIGKFTELKSNEASVRNSPKFDVERREIDTRIDIC 284
Y+KELLERINKLQEEE+E G ++ L+ E+K NE VRNSPKF+V+RREIDTRIDIC
Sbjct: 226 YMKELLERINKLQEEESEDGTTEMTLMTNLNEIKPNEVLVRNSPKFNVDRREIDTRIDIC 285
Query: 285 CSSKPGLLLSTVNTLEVLGLEIQQCVISCFNDFSLQASCSEAAERRTLLSSEEIKQALFS 344
CS+KPGLLLSTVNTLE LGLEIQQCVISCFNDFS+QASCSEA E+RTL+S E+IKQALF
Sbjct: 286 CSAKPGLLLSTVNTLEALGLEIQQCVISCFNDFSMQASCSEADEQRTLISPEDIKQALFR 345
Query: 345 NAGYGGKCL 353
AGYGG+CL
Sbjct: 346 TAGYGGRCL 354
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225469216|ref|XP_002264407.1| PREDICTED: transcription factor bHLH93-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356496600|ref|XP_003517154.1| PREDICTED: transcription factor bHLH93-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|363807994|ref|NP_001241949.1| uncharacterized protein LOC100784145 [Glycine max] gi|255636814|gb|ACU18740.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357485301|ref|XP_003612938.1| BHLH transcription factor [Medicago truncatula] gi|163889364|gb|ABY48134.1| bHLH transcription factor [Medicago truncatula] gi|355514273|gb|AES95896.1| BHLH transcription factor [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225459000|ref|XP_002285595.1| PREDICTED: transcription factor bHLH93 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|404551200|gb|AFR78197.1| transcription factor bHLH [Vitis vinifera] gi|404551202|gb|AFR78198.1| transcription factor bHLH [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|384157481|gb|AFH68208.1| transcription factor bHLH [Vitis amurensis] gi|384157483|gb|AFH68209.1| transcription factor bHLH [Vitis amurensis] | Back alignment and taxonomy information |
|---|
| >gi|449521403|ref|XP_004167719.1| PREDICTED: transcription factor bHLH93-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359491457|ref|XP_002276557.2| PREDICTED: transcription factor bHLH93-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| TAIR|locus:2155725 | 351 | bHLH093 "AT5G65640" [Arabidops | 0.943 | 0.948 | 0.485 | 2.1e-70 | |
| TAIR|locus:2142419 | 315 | AT5G10570 "AT5G10570" [Arabido | 0.507 | 0.568 | 0.683 | 4.8e-66 | |
| UNIPROTKB|Q8H8E4 | 430 | OJ1006F06.1 "Putative bHLH tra | 0.937 | 0.769 | 0.413 | 3.1e-51 | |
| UNIPROTKB|Q336V8 | 380 | Os10g0544200 "Os10g0544200 pro | 0.490 | 0.455 | 0.537 | 8.4e-42 | |
| TAIR|locus:2090847 | 494 | ICE1 "AT3G26744" [Arabidopsis | 0.184 | 0.131 | 0.712 | 9.8e-30 | |
| UNIPROTKB|Q2R3F6 | 524 | Os11g0523700 "Helix-loop-helix | 0.305 | 0.206 | 0.488 | 2.1e-28 | |
| TAIR|locus:2039445 | 571 | AMS "AT2G16910" [Arabidopsis t | 0.220 | 0.136 | 0.518 | 4.1e-14 | |
| UNIPROTKB|Q5Z988 | 213 | P0548E04.5 "Os06g0724800 prote | 0.150 | 0.248 | 0.574 | 3.7e-12 | |
| TAIR|locus:2141055 | 589 | MYC4 "AT4G17880" [Arabidopsis | 0.487 | 0.292 | 0.3 | 6.6e-11 | |
| TAIR|locus:2178555 | 592 | MYC3 "AT5G46760" [Arabidopsis | 0.487 | 0.290 | 0.288 | 8.6e-11 |
| TAIR|locus:2155725 bHLH093 "AT5G65640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 713 (256.0 bits), Expect = 2.1e-70, P = 2.1e-70
Identities = 180/371 (48%), Positives = 225/371 (60%)
Query: 1 MEL-TQHGFLEELLAPPIARRDAWS----SFSGGLN----EYLPSGWILDSL--DESSTL 49
MEL TQ EELL P + SF+GG + ++ P+G+ +D L +
Sbjct: 1 MELSTQMNVFEELLVPTKQETTDNNINNLSFNGGFDHHHHQFFPNGYNIDYLCFNNEEED 60
Query: 50 AAAASNPSSFVGFSAAPSEASFECPPFTDHLHQGYHPFVDGFTVPEVDTSSYTKNEIPSF 109
PSSF+ + P PP LHQ P + + P +SS T +
Sbjct: 61 ENTLLYPSSFMDLISQP-------PPLL--LHQP--PPLQPLSPPL--SSSATAGATFDY 107
Query: 110 PSAQEEYPPMVVEEDRDQLCLRSSDHLHQNHSFEETKSSCAEIEQATSNITNQGFNMGLC 169
P + + L L++ + N+ S E +Q+ S F++G C
Sbjct: 108 PFLEALQEIIDSSSSSPPLILQNGQEENFNNPMSYP-SPLMESDQSKS------FSVGYC 160
Query: 170 --VDRKRKNKKLEGQPSKNLMAEXXXXXXLNDRLSMLRSIVPKISKMDRTSILGDTIDYL 227
K+K+KKLEGQPSKNLMAE LNDRLSMLRSIVPKISKMDRTSILGD IDY+
Sbjct: 161 GGETNKKKSKKLEGQPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILGDAIDYM 220
Query: 228 KELLERINKLQEEETELG-ANQL----LIGKFTELKSNEASVRNSPKFDVERREIDTRID 282
KELL++INKLQ+EE ELG +N L G +L +NE VRNSPKF+++RR+ DTR+D
Sbjct: 221 KELLDKINKLQDEEQELGNSNNSHHSKLFGDLKDLNANEPLVRNSPKFEIDRRDEDTRVD 280
Query: 283 ICCSSKPGLLLSTVNTLEVLGLEIQQCVISCFNDFSLQASCSEAAERRTLLSSEEIKQAL 342
ICCS KPGLLLSTVNTLE LGLEI+QCVISCF+DFSLQASCSE AE+R ++SE+IKQAL
Sbjct: 281 ICCSPKPGLLLSTVNTLETLGLEIEQCVISCFSDFSLQASCSEGAEQRDFITSEDIKQAL 340
Query: 343 FSNAGYGGKCL 353
F NAGYGG CL
Sbjct: 341 FRNAGYGGSCL 351
|
|
| TAIR|locus:2142419 AT5G10570 "AT5G10570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8H8E4 OJ1006F06.1 "Putative bHLH transcription protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q336V8 Os10g0544200 "Os10g0544200 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090847 ICE1 "AT3G26744" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2R3F6 Os11g0523700 "Helix-loop-helix DNA-binding domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039445 AMS "AT2G16910" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5Z988 P0548E04.5 "Os06g0724800 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141055 MYC4 "AT4G17880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2178555 MYC3 "AT5G46760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 2e-10 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 2e-10 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 5e-09 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
Score = 55.7 bits (135), Expect = 2e-10
Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
Query: 188 MAERRRRKRLNDRLSMLRSIVP---KISKMDRTSILGDTIDYLKELLERI 234
+ ERRRR+R+ND LRS++P K+ + IL +DY+K L E +
Sbjct: 10 LRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL 59
|
A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and have a PAS domain which allows the dimerization between PAS proteins, the binding of small molecules (e.g., dioxin), and interactions with non-PAS proteins. Length = 60 |
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.3 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.26 | |
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.26 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 98.82 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 98.67 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 98.47 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 98.43 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 98.42 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 98.37 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 98.26 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 98.19 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 97.99 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 97.96 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 97.9 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 97.79 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 97.78 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 97.76 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.72 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.7 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 97.56 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 97.34 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 97.27 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 97.13 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 97.06 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 97.06 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 97.05 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 96.91 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 96.85 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 96.79 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 96.77 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 96.6 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 96.5 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 96.39 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 96.29 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 96.29 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 96.28 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 96.25 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 96.24 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 96.21 | |
| PRK00194 | 90 | hypothetical protein; Validated | 95.94 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 95.69 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 95.67 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 95.54 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 95.54 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 95.36 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 95.14 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 94.95 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 94.81 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 94.39 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 94.19 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 93.89 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 92.48 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 92.38 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 91.98 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 91.71 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 91.15 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 90.95 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 90.68 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 90.13 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 89.4 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 89.34 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 89.2 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 88.59 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 88.56 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 87.65 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 87.28 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 87.21 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 86.75 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 86.08 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 85.81 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 85.57 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 85.4 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 85.34 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 84.93 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 84.22 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 84.09 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 83.25 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 82.32 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 82.26 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 82.15 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 82.1 |
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
Probab=99.30 E-value=2.1e-12 Score=95.64 Aligned_cols=53 Identities=38% Similarity=0.710 Sum_probs=49.7
Q ss_pred CCccchHHHHHHHHHHHHHHHhhhhcCCCC---CCCCccchhHHHHHHHHHHHHHH
Q 038389 182 QPSKNLMAERRRRKRLNDRLSMLRSIVPKI---SKMDRTSILGDTIDYLKELLERI 234 (353)
Q Consensus 182 ~~~~h~~~ER~RR~~in~~~~~LrslvP~~---~k~dKasIL~~ai~YIk~Lq~~v 234 (353)
.+..|++.||+||++||+.|..|+++||.. .|++|++||..||+||+.|+.++
T Consensus 4 ~r~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~ 59 (60)
T cd00083 4 RREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL 59 (60)
T ss_pred HHHHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence 456799999999999999999999999987 78999999999999999999876
|
A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and |
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 2e-14 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 3e-11 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 4e-11 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 5e-11 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 3e-08 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 1e-07 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 4e-05 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 8e-05 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
Score = 66.6 bits (163), Expect = 2e-14
Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
Query: 188 MAERRRRKRLNDRLSMLRSIVPKI-SKMDRTSILGDTIDYLKELLERINKLQEEETEL 244
E+R R +ND++ L+ +V +K++++++L IDY++ L KL++E L
Sbjct: 12 AIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL 69
|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.56 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.47 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.45 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.45 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.44 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.43 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.43 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.39 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.34 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.33 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.24 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 98.99 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 98.96 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 98.81 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 98.64 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.37 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.29 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 97.72 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 96.51 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 95.86 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 95.42 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 94.25 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 93.9 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 93.61 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 90.47 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 89.24 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 88.24 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 87.79 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 86.97 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 86.29 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=99.56 E-value=2.4e-15 Score=119.12 Aligned_cols=63 Identities=27% Similarity=0.495 Sum_probs=58.3
Q ss_pred CCccchHHHHHHHHHHHHHHHhhhhcCCCC-CCCCccchhHHHHHHHHHHHHHHHHHHHHHHHh
Q 038389 182 QPSKNLMAERRRRKRLNDRLSMLRSIVPKI-SKMDRTSILGDTIDYLKELLERINKLQEEETEL 244 (353)
Q Consensus 182 ~~~~h~~~ER~RR~~in~~~~~LrslvP~~-~k~dKasIL~~ai~YIk~Lq~~v~~L~~~~~e~ 244 (353)
++..|+.+||+||++||+.|..|+++||.. .|++|++||.+||+||++|+.+++.|+.+...+
T Consensus 6 rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L 69 (82)
T 1am9_A 6 KRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL 69 (82)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 356899999999999999999999999986 899999999999999999999999999876554
|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 353 | ||||
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 2e-13 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 1e-12 | |
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 2e-12 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 2e-11 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 4e-11 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 9e-11 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 2e-10 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 1e-09 |
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 62.4 bits (152), Expect = 2e-13
Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
Query: 194 RKRLNDRLSMLRSIVPKI-SKMDRTSILGDTIDYLKELLERINKLQEEETELGANQ 248
R +ND++ L+ +V +KM ++ +L IDY+K L + +KL++E L
Sbjct: 1 RSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLAN 56
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.45 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.41 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.38 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.34 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 97.0 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 96.47 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 96.26 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 92.58 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 92.35 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 91.48 |
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-1a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.45 E-value=3.1e-14 Score=110.15 Aligned_cols=62 Identities=27% Similarity=0.494 Sum_probs=56.5
Q ss_pred CccchHHHHHHHHHHHHHHHhhhhcCCCC-CCCCccchhHHHHHHHHHHHHHHHHHHHHHHHh
Q 038389 183 PSKNLMAERRRRKRLNDRLSMLRSIVPKI-SKMDRTSILGDTIDYLKELLERINKLQEEETEL 244 (353)
Q Consensus 183 ~~~h~~~ER~RR~~in~~~~~LrslvP~~-~k~dKasIL~~ai~YIk~Lq~~v~~L~~~~~e~ 244 (353)
+..|+.+||+||.+||+.|..|++|||+. .|++|++||..||+||+.|+.+++.|..+...+
T Consensus 7 R~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~l 69 (80)
T d1am9a_ 7 RTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSL 69 (80)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45799999999999999999999999974 688999999999999999999999999875443
|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|