Citrus Sinensis ID: 038400


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MKCAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERCKRPTGEDWPKIAHIPQVNLD
cccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHccccccccHHHHHcccccccccHHHHHcccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccHHHHHHHHHHHccEEEEEccccccccccEEEEEEEccccccccccccccccccEEEEEcccccccHHHHHHHHHHccccccEEEccccccccccccccccccccccccccccccEEcccccccccccccHHHccccccccEEEccccccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccccHHHHccccccHHHHHHcccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccEEccccccccccccEEEEccccHHHHHHccccccccccccccccEEEc
ccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHcHHHccHHHHHHHHHHHEccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEHHHHHHHHHHHHccccEEEEccccccccccEEEEEEEccccccccccccccccHcccEEEEccccccccHHHHHHHHHHcccEEEEEEcccccccccccccccccccEEEccccccccccccHcccHHHHHcccHccccccccEEEEccccccccccccccccccEEEEEEcccccccccHHHcccccccEEEEccccccccccHHccccccccEEEEcccccHccccccccccHHHHHHHccccccccEEEEEcccccccccHHHccccccccEEEEEcccccHccccccccccccHcEEEEccccccccccHHccccccccEEEEcccHHHHHHHcccccccccccccccEEEEc
mkcafkeerdkhpnliKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLeqkesgilpilrlsyyqlpphlkQCVAYCsifpkdypfdsfSLVQFWMAHGllqshnkneeLEDIGMRYLKELLsrsffhdltfgMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVcprkignlkhmryldlsgnskikklpksIYCLELEELPKDIRHLTSLRAFALTTKQKSLQesgirslgslrcltisgcgdlEHLFEEIDQLRVLRTLSIvccprlislppaIKYLSSLETLFLYKCESLDLninmemegegsnhdrkntrphlRRVVIGEITQLLELPQWLLQGSTDTLQNlliidcpnfmalprslkDLEALETLFILgcpklsslsedmhhvttlksltiggcpalserckrptgedwpkiahipqvnld
mkcafkeerdkhpnlikIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPrkignlkhmRYLDlsgnskikklpKSIYCLELEELPKDIRHLTSLRAFALttkqkslqesgirslgslRCLTISGCGDLEHLFEEIDQLRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEgegsnhdrkntrpHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTlksltiggcpalserckrptgedwpkiahipqvnld
MKCAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTfgmlgmgmfffkmHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERCKRPTGEDWPKIAHIPQVNLD
*************NLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNIN*****************HLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERC********************
MKCAFK*ERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNK*EELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGC**************VLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINM********HDRKNTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERCKRPTGEDWPKIAHIPQVNLD
********RDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEME*********NTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERCKRPTGEDWPKIAHIPQVNLD
**CAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERCKRPTGEDWPKIAHIPQVNLD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERCKRPTGEDWPKIAHIPQVNLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query504 2.2.26 [Sep-21-2011]
Q7XA42 979 Putative disease resistan N/A no 0.839 0.432 0.335 2e-52
Q7XA39 988 Putative disease resistan N/A no 0.591 0.301 0.360 5e-48
Q7XBQ9 970 Disease resistance protei N/A no 0.565 0.293 0.395 3e-47
Q7XA40 992 Putative disease resistan N/A no 0.599 0.304 0.355 9e-46
Q9LRR5 1424 Putative disease resistan yes no 0.613 0.216 0.353 1e-40
Q9LRR4 1054 Putative disease resistan no no 0.861 0.411 0.294 1e-37
Q8W4J9908 Disease resistance protei no no 0.884 0.491 0.260 3e-25
Q8W3K3910 Putative disease resistan no no 0.492 0.272 0.276 5e-23
Q9SX38857 Putative disease resistan no no 0.900 0.529 0.253 1e-22
P59584910 Disease resistance protei no no 0.896 0.496 0.246 2e-22
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function desciption
 Score =  207 bits (526), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 165/492 (33%), Positives = 236/492 (47%), Gaps = 69/492 (14%)

Query: 1   MKCAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEY--------L 52
           M+ AF  + + +PNL+ IG+EIVKKCGG+PLA + LG +L    +E +WE+        L
Sbjct: 321 MQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNL 380

Query: 53  EQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNE 112
            Q ES ILP LRLSY+ LP  L+QC  YC++FPKD      +L+ FWMAHG L S   N 
Sbjct: 381 PQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKG-NL 439

Query: 113 ELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDCQ 172
           ELED+G     EL  RSFF ++    +  G  +FKMHDL+HDLA                
Sbjct: 440 ELEDVGNEVWNELYLRSFFQEIE---VESGKTYFKMHDLIHDLA---------------- 480

Query: 173 SIPKRVRHLSFAAANASRKDFSSLLSDL-GRVRTIVFSTDDEKISQSFVESCISKSQFLR 231
                    S  +AN S  +   + ++  G + +I F+    ++  S+  S + K   LR
Sbjct: 481 --------TSLFSANTSSSNIREINANYDGYMMSIGFA----EVVSSYSPSLLQKFVSLR 528

Query: 232 VLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSI------------YCLELEEL 279
           VLNL  S +   P  IG+L H+RYLDLSGN +I+ LPK +            YC  L  L
Sbjct: 529 VLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCL 588

Query: 280 PKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDL----EHLFEEIDQLRV 335
           PK    L SLR   L     SL  +  R +G L CL    C  +     H   E+  L +
Sbjct: 589 PKQTSKLGSLRNLLLDG--CSLTSTPPR-IGLLTCLKSLSCFVIGKRKGHQLGELKNLNL 645

Query: 336 LRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPH- 394
             ++SI    R+     A +   S +      C S DL+     + E      +  +PH 
Sbjct: 646 YGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEV----LEALKPHS 701

Query: 395 -LRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFI-LG 452
            L+ + I      + LP W+ Q     + ++ I  C N   LP    +L  LE+L +  G
Sbjct: 702 NLKYLEINGFGG-IRLPDWMNQSVLKNVVSIRIRGCENCSCLP-PFGELPCLESLELHTG 759

Query: 453 CPKLSSLSEDMH 464
              +  + +++H
Sbjct: 760 SADVEYVEDNVH 771




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
255577491 860 leucine-rich repeat containing protein, 0.974 0.570 0.466 1e-119
225441815 874 PREDICTED: putative disease resistance p 0.956 0.551 0.445 1e-117
224120592 836 nbs-lrr resistance protein [Populus tric 0.918 0.553 0.452 1e-115
225456043 848 PREDICTED: putative disease resistance p 0.942 0.560 0.441 1e-111
359491491 845 PREDICTED: disease resistance protein RG 0.942 0.562 0.440 1e-109
225456041 853 PREDICTED: disease resistance protein RG 0.942 0.556 0.429 1e-108
225456045 851 PREDICTED: putative disease resistance p 0.942 0.558 0.426 1e-107
297734263 729 unnamed protein product [Vitis vinifera] 0.884 0.611 0.428 1e-105
225456092 849 PREDICTED: putative disease resistance p 0.940 0.558 0.421 1e-105
356570458 857 PREDICTED: disease resistance protein RG 0.966 0.568 0.423 1e-103
>gi|255577491|ref|XP_002529624.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223530909|gb|EEF32769.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 246/527 (46%), Positives = 333/527 (63%), Gaps = 36/527 (6%)

Query: 1   MKCAFKEERDK-HPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEY-------- 51
           ++CAF E ++K +PNL+KIG EIVKKCGG+PLAVR +G+ L+  TDE DW          
Sbjct: 343 LRCAFNEGQEKLYPNLVKIGSEIVKKCGGVPLAVRTVGTQLFLKTDEADWNLVKESDIWE 402

Query: 52  LEQKESGILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKN 111
           L+Q  + ILP LR+SY QLP +LKQC A CS+FPKDY F+S  L+QFWMAHGLLQS ++ 
Sbjct: 403 LDQNPNDILPALRISYQQLPSYLKQCFASCSVFPKDYEFNSLKLIQFWMAHGLLQSPDQV 462

Query: 112 EELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVVNSDC 171
           +  E +G++YLKEL SR FF D+         F FKMHDL+HDLA  VA+ E L+  S  
Sbjct: 463 QLPEYLGLKYLKELFSRCFFQDIEDCSF---YFVFKMHDLVHDLAQSVAQRESLIPKSGR 519

Query: 172 QSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQSFVESCISKSQFLR 231
               KRVRHL+F       KD   L  DL  V+TI+ +     +S+S  + CIS  Q LR
Sbjct: 520 HYSCKRVRHLTFFDPEVLSKDPRKLFHDLDHVQTILIAG----VSKSLAQVCISGFQNLR 575

Query: 232 VLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSI------------YCLELEEL 279
           VL+L+ S  EV PR IG LKH+RYLDL+ N KI++LP SI             C ELE L
Sbjct: 576 VLDLAWSTFEVLPRSIGTLKHLRYLDLTNNVKIRRLPSSICNLQSLQTLILSGCEELEGL 635

Query: 280 PKDIRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRV--LR 337
           P++++ + SL    +T K + L  + I  L SLR L I GCG+LEHLF+++  L +  LR
Sbjct: 636 PRNMKCMISLSFLWITAKLRFLPSNRIGCLQSLRTLGIGGCGNLEHLFDDMIGLNLIALR 695

Query: 338 TLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPHLRR 397
           TL +  C  LI LP  IKYL++LE L +  CE+LDL I      +G+  D ++    L+ 
Sbjct: 696 TLVVGGCRNLIYLPHDIKYLTALENLTIATCENLDLLI------DGNVVDNEHCGFKLKT 749

Query: 398 VVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLS 457
           + + E+  L+ LP+WLLQ S  +L+++ I  C N + LP  L+D  +L+ L ILGCP LS
Sbjct: 750 LSLHELPLLVALPRWLLQWSACSLESIAIWRCHNLVMLPEWLQDFISLQKLDILGCPGLS 809

Query: 458 SLSEDMHHVTTLKSLTIGGCPALSERCKRPTGEDWPKIAHIPQVNLD 504
           SL   +H +T+L+ LT+  CPAL+E C   TG+DWP+IAH+ ++ LD
Sbjct: 810 SLPIGLHRLTSLRKLTVEDCPALAESCNPETGKDWPQIAHVSEIYLD 856




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225441815|ref|XP_002277987.1| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224120592|ref|XP_002318368.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222859041|gb|EEE96588.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225456043|ref|XP_002277498.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491491|ref|XP_003634282.1| PREDICTED: disease resistance protein RGA2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456041|ref|XP_002277479.1| PREDICTED: disease resistance protein RGA2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456045|ref|XP_002277526.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734263|emb|CBI15510.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456092|ref|XP_002278041.1| PREDICTED: putative disease resistance protein RGA4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570458|ref|XP_003553404.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query504
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.630 0.223 0.350 1.5e-43
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.736 0.351 0.326 2e-35
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.521 0.145 0.299 1.7e-31
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.674 0.374 0.283 9.9e-25
TAIR|locus:2011982857 AT1G50180 [Arabidopsis thalian 0.920 0.541 0.265 8.4e-23
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.521 0.250 0.272 1.1e-22
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.521 0.250 0.272 1.1e-22
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.295 0.164 0.309 5.3e-20
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.906 0.508 0.261 7.8e-20
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.682 0.381 0.266 1.1e-19
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 411 (149.7 bits), Expect = 1.5e-43, Sum P(2) = 1.5e-43
 Identities = 122/348 (35%), Positives = 174/348 (50%)

Query:    18 IGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKESG----ILPILRLSYYQLPPH 73
             IG+ I ++C G+PLA RA+ S L    +  DW  + +  S     ILP+L+LSY  LPP 
Sbjct:   358 IGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKNFSSYTNSILPVLKLSYDSLPPQ 417

Query:    74 LKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHD 133
             LK+C A CSIFPK + FD   LV  WMA  LL     +  LEDIG  YL +L+++SFF  
Sbjct:   418 LKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQR 477

Query:   134 LTXXXXXXXXXXXXXHDLMHDLALLVAKDE-FLVVNSDCQSIPKRVRHLSFAAANASRKD 192
             L              HDLM+DLA  V+ D  F + + +   IP   RH SF+ +      
Sbjct:   478 LDITMTSFVM-----HDLMNDLAKAVSGDFCFRLEDDNIPEIPSTTRHFSFSRSQCDASV 532

Query:   193 FSSLLSDLGRVRTIV-F----STDDEKISQSFVESCISKSQFLRVLNLSESAIEVCPRKI 247
                 +     +RTI+ F    S +  ++++  +   ++    LR+L+LS   I   P+ +
Sbjct:   533 AFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSL 592

Query:   248 GNLKHMRYLDLSGNSKIKKLPKSIY------------CLELEELPKDIRHLTSLRAFALT 295
               LK +RYLDLS ++KIK+LP+ +             C +L  LPK I  L +LR   L 
Sbjct:   593 KGLKLLRYLDLS-STKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLV 651

Query:   296 TKQKSLQESGIRSLGSLRCLTISGCGDLEHL-FEEIDQLRVLR-TLSI 341
                      GI+ L SL+ L+    G L      E+ +L  LR TL I
Sbjct:   652 GTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRI 699


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-24
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score =  102 bits (257), Expect = 2e-24
 Identities = 40/116 (34%), Positives = 66/116 (56%), Gaps = 10/116 (8%)

Query: 4   AFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKES------ 57
            F++E    P L ++ +EIV+KC G+PLA++ LG LL   +   +WE++ ++ +      
Sbjct: 169 VFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGR 228

Query: 58  ----GILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHN 109
                +L IL LSY  LP HLK+C  Y ++FP+DY      L++ W+A G +   +
Sbjct: 229 DGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSD 284


Length = 285

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 504
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.71
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.69
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.68
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.62
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.57
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.42
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.41
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.36
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.33
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.31
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.1
KOG4237498 consensus Extracellular matrix protein slit, conta 99.01
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.0
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.93
KOG4341483 consensus F-box protein containing LRR [General fu 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.86
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.69
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.6
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
KOG4341483 consensus F-box protein containing LRR [General fu 98.46
PLN03150623 hypothetical protein; Provisional 98.43
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.41
PRK15386 426 type III secretion protein GogB; Provisional 98.39
PLN03150623 hypothetical protein; Provisional 98.27
PRK15386 426 type III secretion protein GogB; Provisional 98.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.15
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.78
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.53
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.44
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.32
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.31
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.09
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.68
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.98
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.79
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.42
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.96
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.68
KOG2123 388 consensus Uncharacterized conserved protein [Funct 92.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.82
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.49
PRK04841 903 transcriptional regulator MalT; Provisional 89.04
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.88
smart0037026 LRR Leucine-rich repeats, outliers. 84.33
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.33
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 84.22
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=5.9e-51  Score=428.40  Aligned_cols=453  Identities=29%  Similarity=0.476  Sum_probs=326.0

Q ss_pred             ccccCCCCCCCcchHHHHHHHHHHcCCchHHHHHHHhhhcCCCChhhhhhhh------------hccCCchhHHHhhhhC
Q 038400            2 KCAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLE------------QKESGILPILRLSYYQ   69 (504)
Q Consensus         2 ~~Af~~~~~~~~~~~~i~~~iv~~c~GlPLal~~ig~~L~~~~~~~~W~~~~------------~~~~~i~~~L~~sy~~   69 (504)
                      ++||+...+.+++++++|++||++|+|||||++|+|+.|+.+++..+|+..-            ...+.|..+|++|||.
T Consensus       328 ~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~  407 (889)
T KOG4658|consen  328 KKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDN  407 (889)
T ss_pred             HhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhh
Confidence            5788875555678999999999999999999999999999999999998721            1245788999999999


Q ss_pred             CChhhHhhhhhhcccCCCCccChHHHHHHHHHccCcccCCCCchHHHHHHHHHHHHHHCcceeeecccccCCcEeEEEeC
Q 038400           70 LPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQSHNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMH  149 (504)
Q Consensus        70 L~~~~k~~fl~~a~fp~~~~i~~~~li~~w~~~g~~~~~~~~~~~~~~~~~~~~~L~~~~l~~~~~~~~~~~~~~~~~mh  149 (504)
                      ||++.|.||+|||.||+||.|+++.|+.+|+||||+.+......+++.|+.|+.+|++++++.....   .++..+|+||
T Consensus       408 L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~---~~~~~~~kmH  484 (889)
T KOG4658|consen  408 LPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERD---EGRKETVKMH  484 (889)
T ss_pred             hhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhccc---ccceeEEEee
Confidence            9988999999999999999999999999999999999966788999999999999999999987654   2567899999


Q ss_pred             hhHHHHHHHHhc-----CceEEeccc-------CCCCCCCeEEEEEEcCCCCccchhhhhcCCCCeeEEeeecCCcccch
Q 038400          150 DLMHDLALLVAK-----DEFLVVNSD-------CQSIPKRVRHLSFAAANASRKDFSSLLSDLGRVRTIVFSTDDEKISQ  217 (504)
Q Consensus       150 dl~~~~~~~~~~-----~~~~~~~~~-------~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~  217 (504)
                      |++||||.++++     +++.++...       ....+..+|++++.++....   ...-..+++|++|.+..+.. ...
T Consensus       485 DvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~---~~~~~~~~~L~tLll~~n~~-~l~  560 (889)
T KOG4658|consen  485 DVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEH---IAGSSENPKLRTLLLQRNSD-WLL  560 (889)
T ss_pred             HHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhh---ccCCCCCCccceEEEeecch-hhh
Confidence            999999999999     666555543       12334678999998876622   22234556899999986542 133


Q ss_pred             HHHHHHhcCCCcccEEEeCCCC-ccccCccccCCCCcCeeeccCCCCccccCcceeccccccCchhhhccccCCeeeecc
Q 038400          218 SFVESCISKSQFLRVLNLSESA-IEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTT  296 (504)
Q Consensus       218 ~~~~~~~~~~~~L~~L~l~~~~-~~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~~~~~~l~~lp~~i~~l~~L~~L~l~~  296 (504)
                      .....+|..++.||||||++|. +..+|+++++|.+||||+++++.             +.+||.++++|.+|.+|++..
T Consensus       561 ~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~-------------I~~LP~~l~~Lk~L~~Lnl~~  627 (889)
T KOG4658|consen  561 EISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTG-------------ISHLPSGLGNLKKLIYLNLEV  627 (889)
T ss_pred             hcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCC-------------ccccchHHHHHHhhheecccc
Confidence            4455678899999999999764 66999999999999999999875             889999999999999999986


Q ss_pred             cccccc-cccCCCCCCccEEeeeCCC--CcccchhhcCCCCcccEEeeccCC-------------------------Ccc
Q 038400          297 KQKSLQ-ESGIRSLGSLRCLTISGCG--DLEHLFEEIDQLRVLRTLSIVCCP-------------------------RLI  348 (504)
Q Consensus       297 ~~~~~~-~~~~~~l~~L~~L~l~~~~--~l~~~~~~~~~l~~L~~L~l~~~~-------------------------~l~  348 (504)
                      +..... +.....|++||+|.+....  ........+.++.+|+.+......                         ...
T Consensus       628 ~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~  707 (889)
T KOG4658|consen  628 TGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGCSKR  707 (889)
T ss_pred             ccccccccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcccccc
Confidence            654333 3444559999999987643  111222344555555555443221                         123


Q ss_pred             ccCccCCCCCCccEEEeccCCCccccccccccCCCCCCCCCC-CCCccceEEEccCCCcccchhhhhcCCCCCccEEEec
Q 038400          349 SLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKN-TRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLII  427 (504)
Q Consensus       349 ~l~~~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~-~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~  427 (504)
                      ..+..+..+.+|+.|.+.+|...+......-      ..... .++++..+.+.+|.....+ .|.  ...++|+.|.+.
T Consensus       708 ~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~------~~~~~~~f~~l~~~~~~~~~~~r~l-~~~--~f~~~L~~l~l~  778 (889)
T KOG4658|consen  708 TLISSLGSLGNLEELSILDCGISEIVIEWEE------SLIVLLCFPNLSKVSILNCHMLRDL-TWL--LFAPHLTSLSLV  778 (889)
T ss_pred             eeecccccccCcceEEEEcCCCchhhccccc------ccchhhhHHHHHHHHhhcccccccc-chh--hccCcccEEEEe
Confidence            3455677888999999999987654321100      01111 2445666666666555443 343  356888888888


Q ss_pred             cCCCCCccCcCCCCCCCc----------ceE----ecccCccCCcCccCCCCCCCcCeEeEeCCCchhhhcCC
Q 038400          428 DCPNFMALPRSLKDLEAL----------ETL----FILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSERCKR  486 (504)
Q Consensus       428 ~~~~l~~l~~~~~~l~~L----------~~L----~l~~c~~l~~l~~~~~~l~~L~~L~l~~c~~l~~~~~~  486 (504)
                      .|+.++.+......+..+          ..+    ++.+.+.+...|-   ..+.|+.+.+..||++...+..
T Consensus       779 ~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l---~~~~l~~~~ve~~p~l~~~P~~  848 (889)
T KOG4658|consen  779 SCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQLYWLPL---SFLKLEELIVEECPKLGKLPLL  848 (889)
T ss_pred             cccccccCCCHHHHhhhcccEEecccccccceeeecCCCCceeEeccc---CccchhheehhcCcccccCccc
Confidence            887776654323222222          222    2222222222222   3344777777777777765444



>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-05
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 63/237 (26%), Positives = 91/237 (38%), Gaps = 67/237 (28%) Query: 225 SKSQF--LRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKD 282 + QF L L L+ + + P I +L +R L + C EL ELP+ Sbjct: 122 TXQQFAGLETLTLARNPLRALPASIASLNRLRELSIRA------------CPELTELPE- 168 Query: 283 IRHLTSLRAFALTTKQKSLQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVLRTLSIV 342 L + S + G+ +L SLR L +G + L I L+ L++L I Sbjct: 169 ----------PLASTDASGEHQGLVNLQSLR-LEWTG---IRSLPASIANLQNLKSLKIR 214 Query: 343 CCPRLISLPPAIKYLSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPHLRRVVIGE 402 P L +L PAI +L LE L L C +L +N P Sbjct: 215 NSP-LSALGPAIHHLPKLEELDLRGCTAL-----------------RNYPP--------- 247 Query: 403 ITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKLSSL 459 + G L+ L++ DC N + LP + L LE L + GC LS L Sbjct: 248 -----------IFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRL 293

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query504
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-48
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  174 bits (443), Expect = 4e-48
 Identities = 38/215 (17%), Positives = 72/215 (33%), Gaps = 36/215 (16%)

Query: 2   KCAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDE----------HDWEY 51
                +      +L +    I+K+C G PL V  +G+LL    +             ++ 
Sbjct: 297 LFVNMK----KADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKR 352

Query: 52  LEQKES----GILPILRLSYYQLPPHLKQCVAYCSIFPKDYPFDSFSLVQFWMAHGLLQS 107
           + +  S     +   + +S   L   +K      SI  KD    +  L   W        
Sbjct: 353 IRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMET---- 408

Query: 108 HNKNEELEDIGMRYLKELLSRSFFHDLTFGMLGMGMFFFKMHDLMHDLALLVAKDEFLVV 167
               EE+ED     L+E +++S       G      F + +HDL  D        +   +
Sbjct: 409 ----EEVED----ILQEFVNKSLLFCDRNG----KSFRYYLHDLQVDFLTEKNCSQLQDL 456

Query: 168 NSDCQSIPKRVRHLSFAAANASRKDFSSLLSDLGR 202
           +   + I +  R+      +  ++D     + L  
Sbjct: 457 HK--KIITQFQRYHQPHTLSPDQEDCMYWYNFLAY 489


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.87
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.86
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.83
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.82
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.7
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.64
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.63
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.53
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.51
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.42
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.39
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.38
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.37
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.36
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.33
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.28
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.19
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.01
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.99
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.87
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.84
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.75
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.6
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.57
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.57
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.52
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.49
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.98
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.86
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.67
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.65
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.6
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.46
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.34
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.27
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 81.31
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.93  E-value=1.8e-25  Score=215.59  Aligned_cols=223  Identities=25%  Similarity=0.384  Sum_probs=182.7

Q ss_pred             CCCcccEEEeCCCCccccCccccCCCCcCeeeccCCCCccccCcceeccccccCchhhhccccCCeeeeccccccccccc
Q 038400          226 KSQFLRVLNLSESAIEVCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEELPKDIRHLTSLRAFALTTKQKSLQESG  305 (504)
Q Consensus       226 ~~~~L~~L~l~~~~~~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~~~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~~~~  305 (504)
                      ....+++|+++++.+..+|..++++++|++|++++|.             +..+|..++++++|++|++++|.+...|..
T Consensus        79 ~~~~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~-------------l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~  145 (328)
T 4fcg_A           79 TQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAG-------------LMELPDTMQQFAGLETLTLARNPLRALPAS  145 (328)
T ss_dssp             TSTTCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSC-------------CCCCCSCGGGGTTCSEEEEESCCCCCCCGG
T ss_pred             cccceeEEEccCCCchhcChhhhhCCCCCEEECCCCC-------------ccchhHHHhccCCCCEEECCCCccccCcHH
Confidence            3577888888888888888888888888888888775             567777788888888888888887777777


Q ss_pred             CCCCCCccEEeeeCCCCcccchhhcCC---------CCcccEEeeccCCCccccCccCCCCCCccEEEeccCCCcccccc
Q 038400          306 IRSLGSLRCLTISGCGDLEHLFEEIDQ---------LRVLRTLSIVCCPRLISLPPAIKYLSSLETLFLYKCESLDLNIN  376 (504)
Q Consensus       306 ~~~l~~L~~L~l~~~~~l~~~~~~~~~---------l~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L~l~~~~~l~~~~~  376 (504)
                      ++++++|++|++++|+....+|..++.         +++|++|++++|. ++.+|..++.+++|++|++++|....+.  
T Consensus       146 l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~-l~~lp~~l~~l~~L~~L~L~~N~l~~l~--  222 (328)
T 4fcg_A          146 IASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTG-IRSLPASIANLQNLKSLKIRNSPLSALG--  222 (328)
T ss_dssp             GGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEEC-CCCCCGGGGGCTTCCEEEEESSCCCCCC--
T ss_pred             HhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCC-cCcchHhhcCCCCCCEEEccCCCCCcCc--
Confidence            888888888888888888888776654         8888888888874 5588888888888888888887643321  


Q ss_pred             ccccCCCCCCCCCCCCCccceEEEccCCCcccchhhhhcCCCCCccEEEeccCCCCCccCcCCCCCCCcceEecccCccC
Q 038400          377 MEMEGEGSNHDRKNTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALPRSLKDLEALETLFILGCPKL  456 (504)
Q Consensus       377 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~c~~l  456 (504)
                                ......++|+.|+++++.....+|.++  ..+++|+.|++++|.....+|..+..+++|++|++++|+.+
T Consensus       223 ----------~~l~~l~~L~~L~Ls~n~~~~~~p~~~--~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~  290 (328)
T 4fcg_A          223 ----------PAIHHLPKLEELDLRGCTALRNYPPIF--GGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNL  290 (328)
T ss_dssp             ----------GGGGGCTTCCEEECTTCTTCCBCCCCT--TCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTC
T ss_pred             ----------hhhccCCCCCEEECcCCcchhhhHHHh--cCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCch
Confidence                      112234578888888887777888777  78899999999999999999999999999999999999999


Q ss_pred             CcCccCCCCCCCcCeEeEeC
Q 038400          457 SSLSEDMHHVTTLKSLTIGG  476 (504)
Q Consensus       457 ~~l~~~~~~l~~L~~L~l~~  476 (504)
                      +.+|..+.++++|+.+++..
T Consensus       291 ~~iP~~l~~L~~L~~l~l~~  310 (328)
T 4fcg_A          291 SRLPSLIAQLPANCIILVPP  310 (328)
T ss_dssp             CCCCGGGGGSCTTCEEECCG
T ss_pred             hhccHHHhhccCceEEeCCH
Confidence            99999999999999998864



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 504
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-13
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 68.3 bits (166), Expect = 2e-13
 Identities = 14/83 (16%), Positives = 25/83 (30%), Gaps = 6/83 (7%)

Query: 2   KCAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLYCSTDEHDWEYLEQKES---- 57
                    +      +  + ++   G P  +          T E   +   + ES    
Sbjct: 196 AYGMPMPVGEKEE--DVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLV 253

Query: 58  GILPILRLSYYQLPPHLKQCVAY 80
           G+  I   SY  L   L++CV  
Sbjct: 254 GVECITPYSYKSLAMALQRCVEV 276


>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query504
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.69
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.69
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.47
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.33
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.19
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.17
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.07
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.95
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.8
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.71
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.69
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.63
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.58
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.44
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.78  E-value=3.7e-19  Score=168.24  Aligned_cols=251  Identities=15%  Similarity=0.155  Sum_probs=149.7

Q ss_pred             CeeEEeeecCCcccchHHHHHHhcCCCcccEEEeCC-CCcc-ccCccccCCCCcCeeeccCCCCccccCcceeccccccC
Q 038400          202 RVRTIVFSTDDEKISQSFVESCISKSQFLRVLNLSE-SAIE-VCPRKIGNLKHMRYLDLSGNSKIKKLPKSIYCLELEEL  279 (504)
Q Consensus       202 ~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~-~~~~-~lp~~~~~l~~L~~L~l~~~~~~~~lp~~~~~~~l~~l  279 (504)
                      +++.|++.++...... .++..+.++++|++|+|++ |.+. .+|..++++++|++|++++|.             +..+
T Consensus        51 ~v~~L~L~~~~l~g~~-~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~-------------l~~~  116 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPY-PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTN-------------VSGA  116 (313)
T ss_dssp             CEEEEEEECCCCSSCE-ECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEEC-------------CEEE
T ss_pred             EEEEEECCCCCCCCCC-CCChHHhcCccccccccccccccccccccccccccccchhhhcccc-------------cccc
Confidence            4666666655432111 1223466667777777765 4554 566667777777777776654             2222


Q ss_pred             -chhhhccccCCeeeecccccc-cccccCCCCCCccEEeeeCCCCcccchhhcCCCCcc-cEEeeccCCCccccCccCCC
Q 038400          280 -PKDIRHLTSLRAFALTTKQKS-LQESGIRSLGSLRCLTISGCGDLEHLFEEIDQLRVL-RTLSIVCCPRLISLPPAIKY  356 (504)
Q Consensus       280 -p~~i~~l~~L~~L~l~~~~~~-~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L-~~L~l~~~~~l~~l~~~l~~  356 (504)
                       |..+..+.+|++++++.|... ..|..+.++++|+.+++++|.....+|..++.+.++ +.+.+.+|......|..+..
T Consensus       117 ~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~  196 (313)
T d1ogqa_         117 IPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN  196 (313)
T ss_dssp             CCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG
T ss_pred             ccccccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccc
Confidence             233556666666666655433 234556666667777766665555666666666554 55666655433344444444


Q ss_pred             CCCccEEEeccCCCccccccccccCCCCCCCCCCCCCccceEEEccCCCcccchhhhhcCCCCCccEEEeccCCCCCccC
Q 038400          357 LSSLETLFLYKCESLDLNINMEMEGEGSNHDRKNTRPHLRRVVIGEITQLLELPQWLLQGSTDTLQNLLIIDCPNFMALP  436 (504)
Q Consensus       357 l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~  436 (504)
                      +.. ..+++..+......           ........+++.+.+.++. +...+..+  ..+++|+.|++++|.....+|
T Consensus       197 l~~-~~l~l~~~~~~~~~-----------~~~~~~~~~l~~l~~~~~~-l~~~~~~~--~~~~~L~~L~Ls~N~l~g~iP  261 (313)
T d1ogqa_         197 LNL-AFVDLSRNMLEGDA-----------SVLFGSDKNTQKIHLAKNS-LAFDLGKV--GLSKNLNGLDLRNNRIYGTLP  261 (313)
T ss_dssp             CCC-SEEECCSSEEEECC-----------GGGCCTTSCCSEEECCSSE-ECCBGGGC--CCCTTCCEEECCSSCCEECCC
T ss_pred             ccc-cccccccccccccc-----------ccccccccccccccccccc-cccccccc--ccccccccccCccCeecccCC
Confidence            433 34555544322110           1112233477888887754 33333344  567888999998885444788


Q ss_pred             cCCCCCCCcceEecccCccCCcCccCCCCCCCcCeEeEeCCCchhh
Q 038400          437 RSLKDLEALETLFILGCPKLSSLSEDMHHVTTLKSLTIGGCPALSE  482 (504)
Q Consensus       437 ~~~~~l~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~c~~l~~  482 (504)
                      .+++.+++|++|++++|.....+|. +.++++|+.+++.+++.+..
T Consensus       262 ~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g  306 (313)
T d1ogqa_         262 QGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             GGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEES
T ss_pred             hHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccC
Confidence            8888899999999988754336774 56788888888888876543



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure