Citrus Sinensis ID: 038441

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
ALKFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICASLPI
ccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccccccccEEEccccccccccHHHHHHHHHHHHHccccccccccHHHHccccccEEccccccccccccccccccccccEEEccccccccccHHHHccccccccccccccccccccccc
cHHHHHEEccccccHHHHcccHcccHHHccEEEcccccccccccccHHHcccHHcHHHHEEEccccccccccccHHHcccEEEEccccccHccccccHHHHHHccEEEccccHHHHccccccccHHHHHEEEccccccccccccHHHHHcccEEccccccccEEccccc
alkfpstlnlfgllkfrlfpEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILdgttirelPLSVELLTGLLLNlkdwqyleslpstinglKSFKILnlsscsklenvpenlgkvesleelDISRTAIRQLPTSIFLLKnlkavdhyhlhhgicaslpi
alkfpstlnlfglLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICASLPI
ALKFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICASLPI
******TLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICA****
ALKFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICASLPI
ALKFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICASLPI
ALKFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALKFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICASLPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.798 0.071 0.372 2e-12
Q40392 1144 TMV resistance protein N N/A no 0.639 0.094 0.394 1e-09
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.775 0.093 0.275 4e-07
Q9LZ25811 Probable disease resistan no no 0.514 0.107 0.375 5e-07
A6H6A4 596 Leucine-rich repeat and I no no 0.621 0.176 0.355 6e-07
O61967 699 Protein lap1 OS=Caenorhab yes no 0.846 0.204 0.305 6e-07
Q9HB75 910 p53-induced protein with yes no 0.828 0.153 0.273 1e-06
P70587 1490 Leucine-rich repeat-conta yes no 0.781 0.088 0.294 2e-06
Q9RBS2 1024 Protein PopC OS=Ralstonia no no 0.745 0.123 0.329 1e-05
Q96RT1 1412 Protein LAP2 OS=Homo sapi no no 0.775 0.092 0.275 2e-05
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 84/145 (57%), Gaps = 10/145 (6%)

Query: 8    LNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSKSMKSLTMLILDGTT 67
            LNL G  K    P ++  +E L VL L G        C KL  F +   ++  L + GT 
Sbjct: 1310 LNLKGCSKLENIPSMVD-LESLEVLNLSG--------CSKLGNFPEISPNVKELYMGGTM 1360

Query: 68   IRELPLSVELLTGL-LLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVE 126
            I+E+P S++ L  L  L+L++ ++L++LP++I  LK  + LNLS C  LE  P++  +++
Sbjct: 1361 IQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMK 1420

Query: 127  SLEELDISRTAIRQLPTSIFLLKNL 151
             L  LD+SRT I++LP+SI  L  L
Sbjct: 1421 CLRFLDLSRTDIKELPSSISYLTAL 1445
Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description
>sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 Back     alignment and function description
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function description
>sp|Q9HB75|PIDD_HUMAN p53-induced protein with a death domain OS=Homo sapiens GN=PIDD PE=1 SV=2 Back     alignment and function description
>sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
224120756 813 hypothetical protein POPTRDRAFT_838042 [ 0.816 0.169 0.503 2e-24
224116210 1017 tir-nbs-lrr resistance protein [Populus 0.804 0.133 0.510 2e-24
224146780 540 predicted protein [Populus trichocarpa] 0.639 0.2 0.571 5e-23
224114331 1119 tir-nbs-lrr resistance protein [Populus 0.804 0.121 0.503 5e-23
224105385 920 tir-nbs-lrr resistance protein [Populus 0.804 0.147 0.510 6e-23
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.639 0.089 0.571 7e-23
105922695 918 TIR-NBS-LRR-TIR type disease resistance 0.804 0.148 0.510 9e-23
224116202 1098 tir-nbs-lrr resistance protein [Populus 0.804 0.123 0.503 1e-22
224126507 1741 tir-nbs-lrr resistance protein [Populus 0.804 0.078 0.483 2e-22
105922306 1778 TIR-NBS-NBS-LRR type disease resistance 0.804 0.076 0.483 2e-22
>gi|224120756|ref|XP_002330944.1| hypothetical protein POPTRDRAFT_838042 [Populus trichocarpa] gi|222873138|gb|EEF10269.1| hypothetical protein POPTRDRAFT_838042 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 96/151 (63%), Gaps = 13/151 (8%)

Query: 8   LNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFSK---SMKSLTMLILD 64
           +NL     FR+ P  +  ME L V  L G        C KLEKF     +M  L  L LD
Sbjct: 519 VNLVNCKSFRILPSNL-EMESLKVFTLDG--------CTKLEKFPDIVGNMNCLMELCLD 569

Query: 65  GTTIRELPLSVELLTGL-LLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLG 123
           GT I EL  S+  L GL +L++ + + LES+PS+I  LKS K L+LS CS+L+N+PENLG
Sbjct: 570 GTGIAELSSSIHHLIGLEVLSMNNCKNLESIPSSIGCLKSLKKLDLSGCSELKNIPENLG 629

Query: 124 KVESLEELDISRTAIRQLPTSIFLLKNLKAV 154
           KVESLEE D+S T+IRQ P SIFLLK+LK +
Sbjct: 630 KVESLEEFDVSGTSIRQPPASIFLLKSLKVL 660

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224116210|ref|XP_002331988.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832112|gb|EEE70589.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224146780|ref|XP_002336335.1| predicted protein [Populus trichocarpa] gi|222834747|gb|EEE73210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114331|ref|XP_002332400.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832723|gb|EEE71200.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105385|ref|XP_002333825.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222838630|gb|EEE76995.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|105922695|gb|ABF81431.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa] gi|105923067|gb|ABF81454.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116202|ref|XP_002331986.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832110|gb|EEE70587.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126507|ref|XP_002319855.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222858231|gb|EEE95778.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|105922306|gb|ABF81409.1| TIR-NBS-NBS-LRR type disease resistance protein [Populus trichocarpa] gi|105922325|gb|ABF81410.1| TIR-NBS-NBS-LRR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.804 0.107 0.350 1e-13
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.798 0.071 0.372 1e-13
TAIR|locus:2827639 1195 AT2G17060 [Arabidopsis thalian 0.863 0.122 0.359 2.5e-13
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.857 0.117 0.368 2.6e-13
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.775 0.109 0.373 4.1e-13
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.798 0.097 0.354 6.2e-13
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.852 0.118 0.354 1.4e-12
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.822 0.089 0.370 3.1e-12
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.846 0.110 0.364 5.2e-12
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.633 0.088 0.422 5.4e-12
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 53/151 (35%), Positives = 83/151 (54%)

Query:     7 TLNLFGLLKFRLFPEIMGRMEHLLVLRLLG-TAIRGLPI-------------CLKLEKFS 52
             ++NL G    +  P+++  ME L+ L L G T++  LP              C + ++F 
Sbjct:   689 SINLEGCTGLKTLPQVLQNMESLMFLNLRGCTSLESLPDITLVGLRTLILSNCSRFKEFK 748

Query:    53 KSMKSLTMLILDGTTIRELPLSVELLTGLL-LNLKDWQYLESLPSTINGLKSFKILNLSS 111
                K+L  L LDGT I+ELP ++  L  L+ L LKD + L SLP +I  LK+ + + LS 
Sbjct:   749 LIAKNLEELYLDGTAIKELPSTIGDLQKLISLKLKDCKNLLSLPDSIGNLKAIQEIILSG 808

Query:   112 CSKLENVPENLGKVESLEELDISRTAIRQLP 142
             CS LE+ PE    ++ L+ L +  TAI+++P
Sbjct:   809 CSSLESFPEVNQNLKHLKTLLLDGTAIKKIP 839
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01550060
hypothetical protein (1281 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 43.3 bits (102), Expect = 3e-05
 Identities = 46/176 (26%), Positives = 68/176 (38%), Gaps = 51/176 (28%)

Query: 45  CLKLEKFSKSMKSLTMLILDGTTIRELPLS----------------------VELLTGLL 82
           C +L+ F     +++ L LD T I E P +                      V+ LT L+
Sbjct: 714 CSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLM 773

Query: 83  ---------LNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPE--NLGKVESL--- 128
                    L L D   L  LPS+I  L   + L + +C  LE +P   NL  +ESL   
Sbjct: 774 TMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLS 833

Query: 129 ---------------EELDISRTAIRQLPTSIFLLKNLKAVDHYHLHHGICASLPI 169
                           +L++SRT I ++P  I    NL  +D    ++    SL I
Sbjct: 834 GCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNI 889

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
KOG0617264 consensus Ras suppressor protein (contains leucine 99.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.72
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.7
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.55
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.51
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.48
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.48
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.46
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.37
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.33
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.27
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.2
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.14
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.92
PLN03150623 hypothetical protein; Provisional 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
PLN03150623 hypothetical protein; Provisional 98.82
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.82
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.8
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.55
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.44
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.43
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.34
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.34
PRK15386 426 type III secretion protein GogB; Provisional 98.33
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.25
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.23
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.2
PRK15386 426 type III secretion protein GogB; Provisional 98.2
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.08
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.05
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.02
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.94
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.93
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.75
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.75
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.5
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.89
KOG4341 483 consensus F-box protein containing LRR [General fu 96.86
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.8
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.69
KOG4341483 consensus F-box protein containing LRR [General fu 96.66
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.25
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.99
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.92
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.52
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.38
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.16
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.09
smart0037026 LRR Leucine-rich repeats, outliers. 95.09
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.45
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.25
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 90.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.45
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.65
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.37
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.17
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.85
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.80  E-value=1e-21  Score=129.89  Aligned_cols=152  Identities=24%  Similarity=0.349  Sum_probs=135.8

Q ss_pred             CCCcEEeeCCccccccCchhhcCCCCccEEEecCCCCCCCCCCCCccccc---cCCCCccEEEeeCCcCccccccccccc
Q 038441            3 KFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRGLPICLKLEKFS---KSMKSLTMLILDGTTIRELPLSVELLT   79 (169)
Q Consensus         3 ~~l~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~l~~~~---~~~~~L~~L~l~~~~~~~lp~~~~~~~   79 (169)
                      ..+++|.+++ +.++.+|+.++.+.+|+.|++..         ++++++|   ..+++|+.|+++-|.+..+|.+|+.++
T Consensus        33 s~ITrLtLSH-NKl~~vppnia~l~nlevln~~n---------nqie~lp~~issl~klr~lnvgmnrl~~lprgfgs~p  102 (264)
T KOG0617|consen   33 SNITRLTLSH-NKLTVVPPNIAELKNLEVLNLSN---------NQIEELPTSISSLPKLRILNVGMNRLNILPRGFGSFP  102 (264)
T ss_pred             hhhhhhhccc-CceeecCCcHHHhhhhhhhhccc---------chhhhcChhhhhchhhhheecchhhhhcCccccCCCc
Confidence            4567888988 46888999999999999999999         6677777   778999999999999999999999999


Q ss_pred             ceE-EEecccccCC-ccccccccCCccCEEecCCCCCCCCcchhhhcCCCCceEeccCCcceecChhhhcCCCcceEEcc
Q 038441           80 GLL-LNLKDWQYLE-SLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLPTSIFLLKNLKAVDHY  157 (169)
Q Consensus        80 ~L~-l~l~~~~~~~-~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~l~~L~~L~~~  157 (169)
                      .|+ +++..|+... .+|+.++.++.|+.|+++. +...-+|..++.+.+|+.|.+..|.+-++|..++.++.|++|+  
T Consensus       103 ~levldltynnl~e~~lpgnff~m~tlralyl~d-ndfe~lp~dvg~lt~lqil~lrdndll~lpkeig~lt~lrelh--  179 (264)
T KOG0617|consen  103 ALEVLDLTYNNLNENSLPGNFFYMTTLRALYLGD-NDFEILPPDVGKLTNLQILSLRDNDLLSLPKEIGDLTRLRELH--  179 (264)
T ss_pred             hhhhhhccccccccccCCcchhHHHHHHHHHhcC-CCcccCChhhhhhcceeEEeeccCchhhCcHHHHHHHHHHHHh--
Confidence            999 9999886654 5788999999999999998 7889999999999999999999999999999999999999999  


Q ss_pred             cccccccccCC
Q 038441          158 HLHHGICASLP  168 (169)
Q Consensus       158 ~l~~~~~~~l~  168 (169)
                       +..+.++-+|
T Consensus       180 -iqgnrl~vlp  189 (264)
T KOG0617|consen  180 -IQGNRLTVLP  189 (264)
T ss_pred             -cccceeeecC
Confidence             7777777666

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
4fcg_A 328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-05
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 9/109 (8%)
Query: 55  MKSLTMLILDGTTIRELPLSVELLTGLLLNLKDWQYLESLPSTINGLKSFKILNLSSCSK 114
           +  L    +D   + ELP + +   GL         L +LP++I  L   + L++ +C +
Sbjct: 103 LSHLQHXTIDAAGLXELPDTXQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPE 162
Query: 115 LENVPENLGKVES---------LEELDISRTAIRQLPTSIFLLKNLKAV 154
           L  +PE L   ++         L+ L +  T IR LP SI  L+NLK++
Sbjct: 163 LTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSL 211

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 73.8 bits (182), Expect = 2e-16
 Identities = 37/157 (23%), Positives = 66/157 (42%), Gaps = 17/157 (10%)

Query: 7   TLNLFGLLKFRLFPEIMGR---------MEHLLVLRLLGTAIRGLPICLKLEKFSKSMKS 57
            L++    +    PE +           + +L  LRL  T IR LP  +       ++++
Sbjct: 154 ELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIA------NLQN 207

Query: 58  LTMLILDGTTIRELPLSVELLTGL-LLNLKDWQYLESLPSTINGLKSFKILNLSSCSKLE 116
           L  L +  + +  L  ++  L  L  L+L+    L + P    G    K L L  CS L 
Sbjct: 208 LKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLL 267

Query: 117 NVPENLGKVESLEELDISR-TAIRQLPTSIFLLKNLK 152
            +P ++ ++  LE+LD+     + +LP+ I  L    
Sbjct: 268 TLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANC 304
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.78
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.76
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.76
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.75
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.75
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.74
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.74
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.74
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.72
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.72
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.72
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.71
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.7
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.7
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.7
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.68
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.68
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.67
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.67
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.67
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.66
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.65
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.65
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.64
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.62
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.62
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.6
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.6
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.58
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.58
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.57
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.56
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.34
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.34
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.25
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.19
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.13
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.01
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.59
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.96
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.59
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.3
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.61
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.08
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.86  E-value=4.1e-21  Score=141.74  Aligned_cols=153  Identities=22%  Similarity=0.308  Sum_probs=97.9

Q ss_pred             CCCCcEEeeCCccccccCchhhcCCCCccEEEecCCCCCC-CCC-------------C----------CCccccc---cC
Q 038441            2 LKFPSTLNLFGLLKFRLFPEIMGRMEHLLVLRLLGTAIRG-LPI-------------C----------LKLEKFS---KS   54 (169)
Q Consensus         2 l~~l~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~-~~~-------------~----------~~l~~~~---~~   54 (169)
                      +++|++|++++|. ++.+|+.+..+++|++|++++|.+.+ ++.             +          +.++.+|   ..
T Consensus       126 l~~L~~L~Ls~n~-l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~  204 (328)
T 4fcg_A          126 FAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIAN  204 (328)
T ss_dssp             GTTCSEEEEESCC-CCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGG
T ss_pred             cCCCCEEECCCCc-cccCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcC
Confidence            4677888887754 55777777778888888887754332 211             0          1122333   44


Q ss_pred             CCCccEEEeeCCcCcccccccccccceE-EEecccccCCccccccccCCccCEEecCCCCCCCCcchhhhcCCCCceEec
Q 038441           55 MKSLTMLILDGTTIRELPLSVELLTGLL-LNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDI  133 (169)
Q Consensus        55 ~~~L~~L~l~~~~~~~lp~~~~~~~~L~-l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l  133 (169)
                      +++|++|++++|.++.+|+.++.+++|+ +++++|+..+.+|..+..+++|++|++++|+..+.+|..+.++++|++|++
T Consensus       205 l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L  284 (328)
T 4fcg_A          205 LQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDL  284 (328)
T ss_dssp             CTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEEC
T ss_pred             CCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeC
Confidence            5566666666666666666666666666 666666566666666666666777777666666666666666777777777


Q ss_pred             cCCcce-ecChhhhcCCCcceEE
Q 038441          134 SRTAIR-QLPTSIFLLKNLKAVD  155 (169)
Q Consensus       134 ~~n~l~-~~~~~~~~l~~L~~L~  155 (169)
                      ++|++. .+|..+..+++++.++
T Consensus       285 ~~n~~~~~iP~~l~~L~~L~~l~  307 (328)
T 4fcg_A          285 RGCVNLSRLPSLIAQLPANCIIL  307 (328)
T ss_dssp             TTCTTCCCCCGGGGGSCTTCEEE
T ss_pred             CCCCchhhccHHHhhccCceEEe
Confidence            776654 6666666677776666
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 39.0 bits (89), Expect = 1e-04
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 83  LNLKDWQYLESLPSTINGLKSFKILNLSSCSKLENVPENLGKVESLEELDISRTAIRQLP 142
           LN+ + + L  LP+    L+    L  S    L  VPE      +L++L +    +R+ P
Sbjct: 289 LNVSNNK-LIELPALPPRLER---LIASFN-HLAEVPELPQ---NLKQLHVEYNPLREFP 340

Query: 143 TSIFLLKNLK 152
                +++L+
Sbjct: 341 DIPESVEDLR 350
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.49
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.48
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.47
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.47
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.96
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.94
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.63
d2ca6a1 344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.63
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.35
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.88
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.44
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.99
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.78  E-value=2.3e-18  Score=121.77  Aligned_cols=142  Identities=20%  Similarity=0.228  Sum_probs=84.2

Q ss_pred             CCCcEEeeCCccccccCc-hhhcCCCCccEEEecCCCCCCCCCCCCccccc--cCCCCccEEEeeCCcCccccccccccc
Q 038441            3 KFPSTLNLFGLLKFRLFP-EIMGRMEHLLVLRLLGTAIRGLPICLKLEKFS--KSMKSLTMLILDGTTIRELPLSVELLT   79 (169)
Q Consensus         3 ~~l~~L~l~~~~~~~~~~-~~~~~l~~L~~L~l~~n~l~~~~~~~~l~~~~--~~~~~L~~L~l~~~~~~~lp~~~~~~~   79 (169)
                      +++++|+++++ .++.+| ..|..+++|++|++++|.++.         ++  ..+++|++|++++|+++..+..+..++
T Consensus        31 ~~l~~L~Ls~N-~i~~l~~~~f~~l~~L~~L~L~~N~l~~---------l~~~~~l~~L~~L~Ls~N~l~~~~~~~~~l~  100 (266)
T d1p9ag_          31 KDTTILHLSEN-LLYTFSLATLMPYTRLTQLNLDRAELTK---------LQVDGTLPVLGTLDLSHNQLQSLPLLGQTLP  100 (266)
T ss_dssp             TTCCEEECTTS-CCSEEEGGGGTTCTTCCEEECTTSCCCE---------EECCSCCTTCCEEECCSSCCSSCCCCTTTCT
T ss_pred             cCCCEEECcCC-cCCCcCHHHhhccccccccccccccccc---------ccccccccccccccccccccccccccccccc
Confidence            46889999885 466666 457889999999999966554         33  456667777777776666665566666


Q ss_pred             ceE-EEecccccCCcccccccc------------------------CCccCEEecCCCCCCCCcc-hhhhcCCCCceEec
Q 038441           80 GLL-LNLKDWQYLESLPSTING------------------------LKSFKILNLSSCSKLENVP-ENLGKVESLEELDI  133 (169)
Q Consensus        80 ~L~-l~l~~~~~~~~~~~~~~~------------------------~~~L~~L~l~~~~~~~~~~-~~~~~l~~L~~L~l  133 (169)
                      +|+ ++++++......+..+..                        +++++.+++++| .+..++ ..+..+++|++|++
T Consensus       101 ~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N-~l~~~~~~~~~~l~~L~~L~L  179 (266)
T d1p9ag_         101 ALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANN-NLTELPAGLLNGLENLDTLLL  179 (266)
T ss_dssp             TCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTS-CCSCCCTTTTTTCTTCCEEEC
T ss_pred             ccccccccccccceeeccccccccccccccccccccceeccccccccccchhcccccc-cccccCccccccccccceeec
Confidence            666 666655333222223333                        444555555542 333332 33455555555555


Q ss_pred             cCCcceecChhhhcCCCcceEE
Q 038441          134 SRTAIRQLPTSIFLLKNLKAVD  155 (169)
Q Consensus       134 ~~n~l~~~~~~~~~l~~L~~L~  155 (169)
                      ++|+++.+|.++..+++|+.|+
T Consensus       180 s~N~L~~lp~~~~~~~~L~~L~  201 (266)
T d1p9ag_         180 QENSLYTIPKGFFGSHLLPFAF  201 (266)
T ss_dssp             CSSCCCCCCTTTTTTCCCSEEE
T ss_pred             ccCCCcccChhHCCCCCCCEEE
Confidence            5555555555555555555555
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure