Citrus Sinensis ID: 038491


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MFITELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG
cccccccccccccccHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccc
ccHHHHHHcccccccEcEEEEEHHHccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccc
MFITELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYtmpeinesagvvfksfdrvdcepfwkpqrklldnkymsidfpfepvdrddntgpfddYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG
MFITELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWkpqrklldnkYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG
MFITELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG
*******QIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAK*****LLTNNVMEKFKFAW****
***TELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWN***
MFITELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG
****ELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWN***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFITELEQIVATQSSEDLVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
Q55EX9263 Putative methyltransferas no no 0.657 0.365 0.352 1e-08
>sp|Q55EX9|Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum GN=DDB_G0268948 PE=1 SV=2 Back     alignment and function desciption
 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (57%), Gaps = 6/102 (5%)

Query: 3   ITELEQIVATQSSEDLVTIA--LYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEI--NE 58
           ++  E+I     S DL+T+A   +WF+LP FY++ K +L+E   +II W+Y + +I  N 
Sbjct: 92  LSAAEKIDLPSGSVDLITVAQAAHWFNLPVFYEESKRLLRENGSLII-WSYGLMKITNNN 150

Query: 59  SAGVVF-KSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDR 99
            A VV  K +     + +W P+RK +D++Y+ I   FE   R
Sbjct: 151 DAQVVHEKHYYETIGDQYWAPERKYIDDEYVDIKPSFENTTR 192





Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
118488865 263 unknown [Populus trichocarpa x Populus d 1.0 0.555 0.613 8e-49
224090001 263 predicted protein [Populus trichocarpa] 1.0 0.555 0.613 1e-48
190898746178 S-adenosylmethionine-dependent methyltra 1.0 0.820 0.613 1e-48
190898728178 S-adenosylmethionine-dependent methyltra 1.0 0.820 0.613 2e-48
190898734178 S-adenosylmethionine-dependent methyltra 1.0 0.820 0.613 3e-48
190898730178 S-adenosylmethionine-dependent methyltra 1.0 0.820 0.607 6e-48
190898764178 S-adenosylmethionine-dependent methyltra 1.0 0.820 0.613 1e-47
428230426 263 S-adenosylmethionine-dependent methyltra 0.986 0.547 0.544 3e-41
255581373 265 S-adenosylmethionine-dependent methyltra 0.986 0.543 0.525 7e-40
312434889213 S-adenosylmethionine-dependent methyltra 0.986 0.676 0.538 9e-40
>gi|118488865|gb|ABK96242.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 119/158 (75%), Gaps = 12/158 (7%)

Query: 1   MFITELEQIVATQSSEDLVTIA--LYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINE 58
           M + ELEQ V+TQSS DLVTIA  ++WFDLP FY+QVKW+LK+P  VI AW YT+PE+N+
Sbjct: 86  MSMGELEQTVSTQSSVDLVTIAQAMHWFDLPSFYQQVKWVLKKPHGVIAAWCYTIPEVND 145

Query: 59  SAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTGPF----------DD 108
           S   VF  F  +D +P+W+PQRKL+DNKYMSIDFPFEPV+  DNTGPF          D+
Sbjct: 146 SVDSVFNPFYSIDSDPYWEPQRKLVDNKYMSIDFPFEPVEGTDNTGPFKFVTEKMMDLDE 205

Query: 109 YFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG 146
           YF +IR +SAYQTAK K  ELL ++V+E FK AWNEDG
Sbjct: 206 YFTYIRSWSAYQTAKAKGVELLRDDVIESFKRAWNEDG 243




Source: Populus trichocarpa x Populus deltoides

Species: Populus trichocarpa x Populus deltoides

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224090001|ref|XP_002308901.1| predicted protein [Populus trichocarpa] gi|222854877|gb|EEE92424.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|190898746|gb|ACE97886.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] Back     alignment and taxonomy information
>gi|190898728|gb|ACE97877.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898732|gb|ACE97879.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898742|gb|ACE97884.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898744|gb|ACE97885.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898748|gb|ACE97887.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898750|gb|ACE97888.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898756|gb|ACE97891.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898758|gb|ACE97892.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898760|gb|ACE97893.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898766|gb|ACE97896.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898768|gb|ACE97897.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898770|gb|ACE97898.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898772|gb|ACE97899.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898774|gb|ACE97900.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898776|gb|ACE97901.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898778|gb|ACE97902.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898784|gb|ACE97905.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898786|gb|ACE97906.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898788|gb|ACE97907.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898790|gb|ACE97908.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898792|gb|ACE97909.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898796|gb|ACE97911.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] Back     alignment and taxonomy information
>gi|190898734|gb|ACE97880.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898738|gb|ACE97882.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898780|gb|ACE97903.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898782|gb|ACE97904.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] Back     alignment and taxonomy information
>gi|190898730|gb|ACE97878.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898736|gb|ACE97881.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898740|gb|ACE97883.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898752|gb|ACE97889.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898754|gb|ACE97890.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898762|gb|ACE97894.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898794|gb|ACE97910.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] gi|190898798|gb|ACE97912.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] Back     alignment and taxonomy information
>gi|190898764|gb|ACE97895.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula] Back     alignment and taxonomy information
>gi|428230426|gb|AFY98896.1| S-adenosylmethionine-dependent methyltransferase [Jatropha curcas] Back     alignment and taxonomy information
>gi|255581373|ref|XP_002531495.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] gi|223528882|gb|EEF30882.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|312434889|gb|ADQ74922.1| S-adenosylmethionine-dependent methyltransferase [Jatropha curcas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:2040277269 AT2G41380 [Arabidopsis thalian 1.0 0.542 0.438 1.6e-29
TAIR|locus:2127550261 AT4G22530 [Arabidopsis thalian 0.938 0.524 0.296 3e-14
TAIR|locus:2183700261 AT5G10830 "AT5G10830" [Arabido 0.938 0.524 0.284 4.4e-13
TAIR|locus:2098841261 AT3G61210 "AT3G61210" [Arabido 0.952 0.532 0.266 3.2e-11
DICTYBASE|DDB_G0268948263 DDB_G0268948 "putative SAM dep 0.657 0.365 0.352 1.7e-10
TAIR|locus:2080245323 AT3G54150 [Arabidopsis thalian 0.952 0.430 0.266 5.5e-09
DICTYBASE|DDB_G0288011259 DDB_G0288011 "methyltransferas 0.938 0.528 0.277 5.1e-08
UNIPROTKB|Q749F1250 GSU2792 "SAM-dependent methylt 0.643 0.376 0.319 7.8e-08
TIGR_CMR|GSU_2792250 GSU_2792 "conserved hypothetic 0.643 0.376 0.319 7.8e-08
TAIR|locus:2040277 AT2G41380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 327 (120.2 bits), Expect = 1.6e-29, P = 1.6e-29
 Identities = 71/162 (43%), Positives = 99/162 (61%)

Query:     1 MFITELEQIVATQSSEDLVTIA--LYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINE 58
             M  +E+E++VA +SS DLVT+A  L+WFDL  FY  VK +LK+P  VI AW YT PE+N+
Sbjct:    86 MSSSEIEKLVAPESSVDLVTVAQALHWFDLTNFYSNVKHVLKKPNGVIAAWCYTNPEVND 145

Query:    59 SAGVVFKSFDRVDCEPFWKPQRKLLDNKYMSIDFPFEPVDRDDNTG----P--------- 105
             +   VF+ F      P W   R+L+++ Y  I+FPFE VD D++T     P         
Sbjct:   146 AVDKVFQRFYDEKLGPHWDLARRLVEDGYRGIEFPFEKVDNDESTESQSFPVRFVTEKEM 205

Query:   106 -FDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNEDG 146
              F++Y  ++R  SAYQTAK+K  ELLT  +  +F  +W EDG
Sbjct:   206 VFEEYMTYLRSSSAYQTAKEKGLELLTAEMEGEFAGSWKEDG 247




GO:0008152 "metabolic process" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
TAIR|locus:2127550 AT4G22530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183700 AT5G10830 "AT5G10830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098841 AT3G61210 "AT3G61210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268948 DDB_G0268948 "putative SAM dependent methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2080245 AT3G54150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288011 DDB_G0288011 "methyltransferase type 11 domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q749F1 GSU2792 "SAM-dependent methyltransferase, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2792 GSU_2792 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0024027701
hypothetical protein (263 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
KOG3010261 consensus Methyltransferase [General function pred 99.97
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.61
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.51
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.49
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.22
PLN02232160 ubiquinone biosynthesis methyltransferase 99.22
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.05
PLN02233261 ubiquinone biosynthesis methyltransferase 99.02
PRK05785226 hypothetical protein; Provisional 99.0
PLN02244340 tocopherol O-methyltransferase 98.86
KOG4300252 consensus Predicted methyltransferase [General fun 98.73
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.61
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.58
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.49
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.43
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.42
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.42
PLN02490340 MPBQ/MSBQ methyltransferase 98.36
PLN02336475 phosphoethanolamine N-methyltransferase 98.3
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.27
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.26
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.21
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.2
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.09
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.07
TIGR00452314 methyltransferase, putative. Known examples to dat 98.07
KOG2940325 consensus Predicted methyltransferase [General fun 98.05
PRK08317241 hypothetical protein; Provisional 98.05
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.03
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.02
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.01
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.93
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 97.91
PRK06922677 hypothetical protein; Provisional 97.9
PRK11207197 tellurite resistance protein TehB; Provisional 97.86
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.86
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 97.85
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.79
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.77
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 97.76
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.72
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.69
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 97.65
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.62
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 97.61
PLN02336 475 phosphoethanolamine N-methyltransferase 97.61
COG4627185 Uncharacterized protein conserved in bacteria [Fun 97.52
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.51
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.49
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.44
PRK12335287 tellurite resistance protein TehB; Provisional 97.34
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.3
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.18
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.03
PLN03075296 nicotianamine synthase; Provisional 97.0
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 96.98
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 96.97
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 96.96
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 96.96
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 96.96
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 96.93
KOG2361264 consensus Predicted methyltransferase [General fun 96.91
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.91
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 96.9
KOG1331293 consensus Predicted methyltransferase [General fun 96.82
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 96.81
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.79
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 96.76
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 96.72
PRK06202232 hypothetical protein; Provisional 96.7
PRK13699227 putative methylase; Provisional 96.69
COG2521287 Predicted archaeal methyltransferase [General func 96.66
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.63
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 96.61
KOG1270282 consensus Methyltransferases [Coenzyme transport a 96.54
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 96.45
TIGR00438188 rrmJ cell division protein FtsJ. 96.43
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 96.39
COG4106257 Tam Trans-aconitate methyltransferase [General fun 96.38
PTZ00146293 fibrillarin; Provisional 96.35
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.25
PRK11524 284 putative methyltransferase; Provisional 96.24
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.24
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 96.11
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.02
PRK14967223 putative methyltransferase; Provisional 96.0
COG1041347 Predicted DNA modification methylase [DNA replicat 95.97
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 95.94
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 95.93
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 95.92
PRK04266226 fibrillarin; Provisional 95.89
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.76
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 95.71
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 95.61
PRK00811283 spermidine synthase; Provisional 95.59
PRK14901434 16S rRNA methyltransferase B; Provisional 95.57
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 95.56
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 95.55
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 95.51
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 95.49
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 95.42
PRK14968188 putative methyltransferase; Provisional 95.18
PRK04457262 spermidine synthase; Provisional 95.13
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 95.08
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 94.9
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 94.89
PRK14903431 16S rRNA methyltransferase B; Provisional 94.79
PRK14904445 16S rRNA methyltransferase B; Provisional 94.76
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 94.73
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 94.67
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 94.59
PRK13255218 thiopurine S-methyltransferase; Reviewed 94.56
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 94.4
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 94.35
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 94.15
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 93.96
PLN02366308 spermidine synthase 93.89
COG4798238 Predicted methyltransferase [General function pred 93.87
PLN02668386 indole-3-acetate carboxyl methyltransferase 93.86
KOG2899288 consensus Predicted methyltransferase [General fun 93.86
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 93.78
PRK01581374 speE spermidine synthase; Validated 93.76
PRK10901427 16S rRNA methyltransferase B; Provisional 93.74
TIGR03438301 probable methyltransferase. This model represents 93.74
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 93.69
KOG1709271 consensus Guanidinoacetate methyltransferase and r 93.69
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 93.67
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 93.63
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 93.5
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.49
PRK00536262 speE spermidine synthase; Provisional 93.42
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 93.41
COG4123248 Predicted O-methyltransferase [General function pr 93.3
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.15
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 92.38
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 92.36
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 92.36
PRK14902444 16S rRNA methyltransferase B; Provisional 92.27
PRK03612521 spermidine synthase; Provisional 92.02
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 91.89
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 91.85
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 91.52
PRK07402196 precorrin-6B methylase; Provisional 91.42
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 91.11
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 91.07
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 90.73
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 90.68
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 90.63
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 90.62
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 90.58
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 90.27
TIGR00536284 hemK_fam HemK family putative methylases. The gene 90.03
PRK13256226 thiopurine S-methyltransferase; Reviewed 89.7
COG4122219 Predicted O-methyltransferase [General function pr 89.7
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 89.21
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 89.0
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 88.97
PF11899380 DUF3419: Protein of unknown function (DUF3419); In 88.81
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 88.48
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 88.44
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 88.04
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 88.01
PHA03411279 putative methyltransferase; Provisional 87.46
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 86.52
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 86.22
KOG1099294 consensus SAM-dependent methyltransferase/cell div 85.46
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 85.34
COG0421282 SpeE Spermidine synthase [Amino acid transport and 84.13
PF03269177 DUF268: Caenorhabditis protein of unknown function 83.46
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 83.0
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 82.01
PLN02823336 spermine synthase 81.87
PHA03412241 putative methyltransferase; Provisional 81.48
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 81.03
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 80.2
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
Probab=99.97  E-value=5.3e-30  Score=190.33  Aligned_cols=144  Identities=33%  Similarity=0.606  Sum_probs=123.9

Q ss_pred             CcccccccCCCCCCccceEEEe--ccccChhhHHHHHHHHhhCCCceEEEEecC-CCCCCHHHHHHHHHhhhhccCCCc-
Q 038491            1 MFITELEQIVATQSSEDLVTIA--LYWFDLPQFYKQVKWILKEPTRVIIAWTYT-MPEINESAGVVFKSFDRVDCEPFW-   76 (146)
Q Consensus         1 ~~~~~~e~l~~~d~s~Dlv~~a--~hw~D~~~~l~e~~RvLk~pgG~la~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~-   76 (146)
                      ||+.+.++|--+++|+|||+||  +||||+++|+++++||||||||++|+|.|. .....++...++.+++. ...||| 
T Consensus        86 ms~~~~v~L~g~e~SVDlI~~Aqa~HWFdle~fy~~~~rvLRk~Gg~iavW~Y~dd~v~~pE~dsv~~r~~~-~~~p~~r  164 (261)
T KOG3010|consen   86 MSSDEMVDLLGGEESVDLITAAQAVHWFDLERFYKEAYRVLRKDGGLIAVWNYNDDFVDWPEFDSVMLRLYD-STLPYWR  164 (261)
T ss_pred             ccccccccccCCCcceeeehhhhhHHhhchHHHHHHHHHHcCCCCCEEEEEEccCCCcCCHHHHHHHHHHhh-ccCchhh
Confidence            6667777777779999999999  999999999999999999888999999998 43446899999999987 577884 


Q ss_pred             hhhhhhhhhhhccCCCCCCCCccCC----------CccCHHHHHHHHHhHHHHHHHHHcCchhhhHHHHHHHHHhhCCC
Q 038491           77 KPQRKLLDNKYMSIDFPFEPVDRDD----------NTGPFDDYFMFIRLYSAYQTAKDKSSELLTNNVMEKFKFAWNED  145 (146)
Q Consensus        77 ~~~~~~~~~~~~~~~~~f~~i~~~~----------~~~t~~~~~~~l~S~S~~~~~~~~~~~~l~~~~~~~l~~~~~~~  145 (146)
                      .+-+.+..++|.+++|||..+....          .+.++++|.++++|||.+.++++++.+++.+.++.+++++|+++
T Consensus       165 ~~~~n~~fdgy~~~~F~~e~v~~~s~~~~~~l~~~~~lsl~~F~~~~rsws~~~~akek~~e~i~~~~I~e~~~~~~~~  243 (261)
T KOG3010|consen  165 SPLRNLLFDGYKTIEFPFESVGMGSQGKPKTLEIPHTLSLEGFSGFLRSWSAYKEAKEKGLELIADIFIPEFEEAWGED  243 (261)
T ss_pred             hHHHHhhccccccccccccccCCCCCCCceeehhhHHHHHHHHHHHHhCcHHHHHHHhcChHHHHHHHHHHHHhhcccc
Confidence            4667788899999999999874321          24578999999999999999999998878777999999999987



>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
4hg2_A257 The Structure Of A Putative Type Ii Methyltransfera 8e-05
>pdb|4HG2|A Chain A, The Structure Of A Putative Type Ii Methyltransferase From Anaeromyxobacter Dehalogenans. Length = 257 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 28/134 (20%), Positives = 58/134 (43%), Gaps = 13/134 (9%) Query: 18 LVTIALYWFDLPQFYKQVKWILKEPTRVIIAWTYTM----PEINESAGVVFKSFDRVDCE 73 + A +WFDL +F+ +++ + + P V A TY + PE++ ++ D Sbjct: 104 IAAQAXHWFDLDRFWAELRRVAR-PGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARD-- 160 Query: 74 PFWKPQRKLLDNKYMSIDFPF----EPVDRDDNTGPFDDYFMFIRLYSAYQTAKDKSSEL 129 W P+R +++ Y ++ FPF P + P D + ++ +SA + ++ Sbjct: 161 --WPPERVHVESGYRTLPFPFPELEAPPLEIEERWPXDAFLGYLGTWSAVTAHRRRTGAD 218 Query: 130 LTNNVMEKFKFAWN 143 + + AW Sbjct: 219 PLAEIAPALRAAWG 232

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 5e-11
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
 Score = 58.1 bits (140), Expect = 5e-11
 Identities = 26/169 (15%), Positives = 47/169 (27%), Gaps = 34/169 (20%)

Query: 3   ITELEQIVATQSSEDLVTI--ALYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEI--NE 58
              L      +   D++T     +WFD  +F +     L+     I  W Y  P      
Sbjct: 101 FKFLGADSVDKQKIDMITAVECAHWFDFEKFQRSAYANLR-KDGTIAIWGYADPIFPDYP 159

Query: 59  SAGVVFK--SFDRVDCEPFW-KPQRKLLDNKYMSIDFPFEP----------VDRDDNTGP 105
               +     + +    P+W +P R  L N         E            +   +   
Sbjct: 160 EFDDLMIEVPYGKQGLGPYWEQPGRSRLRNMLKDSHLDPELFHDIQVSYFCAEDVRDKVK 219

Query: 106 F----------------DDYFMFIRLYSAYQTAKDKSSELLTNNVMEKF 138
                             ++  ++R +SAY   K         +V + F
Sbjct: 220 LHQHTKKPLLIRKQVTLVEFADYVRTWSAYHQWKQDPKNKDKEDVADWF 268


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.97
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.77
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.97
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.89
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.79
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.74
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.73
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.7
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.57
3f4k_A257 Putative methyltransferase; structural genomics, P 98.52
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.51
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.5
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.47
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.46
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.45
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.43
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.43
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.4
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.4
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.38
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.38
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.37
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.36
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.35
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.34
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.33
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.33
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.32
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.3
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.28
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.28
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.27
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.26
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.26
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.26
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.25
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.24
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.22
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.21
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.18
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.18
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.17
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.16
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.15
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.15
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.15
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.11
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.11
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.11
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.11
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.09
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.09
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.09
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.07
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.07
3ocj_A305 Putative exported protein; structural genomics, PS 98.07
3lcc_A235 Putative methyl chloride transferase; halide methy 98.07
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.06
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.06
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.05
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.05
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.03
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.02
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.02
3cc8_A230 Putative methyltransferase; structural genomics, j 98.01
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.0
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.98
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.98
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 97.97
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.97
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 97.96
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.94
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.9
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.89
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.88
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 97.84
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.83
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 97.83
3m70_A286 Tellurite resistance protein TEHB homolog; structu 97.83
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.81
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.78
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.76
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.75
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.74
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 97.73
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.69
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.69
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.69
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.69
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.67
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.65
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 97.65
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.64
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 97.64
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.63
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.61
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.6
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.6
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.6
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.59
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.59
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 97.58
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.58
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 97.57
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.54
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.54
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.53
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.52
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.52
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 97.51
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 97.5
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.48
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.48
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.47
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.46
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.45
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.45
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 97.43
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.42
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.41
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.4
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.39
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.35
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.34
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.34
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.33
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.33
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.32
2fyt_A340 Protein arginine N-methyltransferase 3; structural 97.31
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.3
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 97.29
3lpm_A259 Putative methyltransferase; structural genomics, p 97.26
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 97.25
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.22
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.21
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.2
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 97.19
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.17
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.16
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.14
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.13
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.1
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.1
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.06
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.06
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.05
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.05
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.04
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 97.04
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.02
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 97.02
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.02
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.01
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 96.99
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 96.98
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.94
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.93
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 96.93
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 96.92
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 96.89
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 96.89
2esr_A177 Methyltransferase; structural genomics, hypothetic 96.88
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 96.86
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.83
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 96.81
2frn_A278 Hypothetical protein PH0793; structural genomics, 96.76
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 96.75
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.74
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 96.74
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.73
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.73
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.72
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 96.7
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.69
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.69
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.68
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 96.66
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 96.65
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.64
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.64
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.58
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 96.56
2b3t_A276 Protein methyltransferase HEMK; translation termin 96.48
2b25_A336 Hypothetical protein; structural genomics, methyl 96.47
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.43
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.4
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 96.37
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.37
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 96.37
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.36
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.33
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.31
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 96.31
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.3
2o07_A304 Spermidine synthase; structural genomics, structur 96.29
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.28
2cmg_A262 Spermidine synthase; transferase, putrescine amino 96.28
2zig_A 297 TTHA0409, putative modification methylase; methylt 96.28
2i7c_A283 Spermidine synthase; transferase, structural genom 96.26
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.26
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 96.24
2pt6_A321 Spermidine synthase; transferase, structural genom 96.18
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.18
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.12
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.1
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.05
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.05
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 95.97
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 95.96
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 95.96
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 95.88
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 95.82
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 95.82
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 95.82
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 95.8
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 95.73
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 95.65
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 95.64
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 95.46
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 95.45
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 95.43
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 95.22
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.06
2h00_A254 Methyltransferase 10 domain containing protein; st 95.06
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 95.0
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 94.92
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 94.9
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 94.49
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 94.22
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 94.17
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 94.07
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 93.89
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 93.74
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 93.53
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 93.34
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 93.27
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 93.04
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 92.78
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 92.71
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 92.31
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 92.27
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 92.16
2b78_A385 Hypothetical protein SMU.776; structure genomics, 92.02
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 92.0
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 91.56
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 91.47
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 90.1
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 90.09
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 89.99
3k6r_A278 Putative transferase PH0793; structural genomics, 89.82
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 89.12
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 88.8
1ne2_A200 Hypothetical protein TA1320; structural genomics, 88.35
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 87.73
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 87.15
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 86.81
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 85.99
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 85.87
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 85.79
2km1_A136 Protein DRE2; yeast, antiapoptotic, protein bindin 85.58
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 84.28
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 83.89
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 83.33
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 82.45
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 82.29
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
Probab=99.97  E-value=4.2e-30  Score=195.09  Aligned_cols=142  Identities=20%  Similarity=0.456  Sum_probs=129.3

Q ss_pred             ccccccCCCCCCccceEEEe--ccccChhhHHHHHHHHhhCCCceEEEEecCCCCCCHHHHHHHHHhhhhccCCCchhhh
Q 038491            3 ITELEQIVATQSSEDLVTIA--LYWFDLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKSFDRVDCEPFWKPQR   80 (146)
Q Consensus         3 ~~~~e~l~~~d~s~Dlv~~a--~hw~D~~~~l~e~~RvLk~pgG~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (146)
                      .+++|++|+++++||+|+|+  +||+|++++++|++|||| |||+|++++|+.+..++.++.++++++...+.++|.+++
T Consensus        87 ~~~~e~~~~~~~sfD~v~~~~~~h~~~~~~~~~e~~rvLk-pgG~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (257)
T 4hg2_A           87 VAPAEDTGLPPASVDVAIAAQAMHWFDLDRFWAELRRVAR-PGAVFAAVTYGLTRVDPEVDAVVDRLYHGLLARDWPPER  165 (257)
T ss_dssp             ECCTTCCCCCSSCEEEEEECSCCTTCCHHHHHHHHHHHEE-EEEEEEEEEECCCBCCHHHHHHHHHHHHTTTGGGCCSCC
T ss_pred             hhhhhhhcccCCcccEEEEeeehhHhhHHHHHHHHHHHcC-CCCEEEEEECCCCCCCHHHHHHHHHHHhcccccccchhh
Confidence            57899999999999999999  999999999999999999 999999999988777899999999998878889999988


Q ss_pred             hhhhhhhccCCCCCCCCccCCC----ccCHHHHHHHHHhHHHHHHHHHc-CchhhhHHHHHHHHHhhCCCC
Q 038491           81 KLLDNKYMSIDFPFEPVDRDDN----TGPFDDYFMFIRLYSAYQTAKDK-SSELLTNNVMEKFKFAWNEDG  146 (146)
Q Consensus        81 ~~~~~~~~~~~~~f~~i~~~~~----~~t~~~~~~~l~S~S~~~~~~~~-~~~~l~~~~~~~l~~~~~~~~  146 (146)
                      ..+++.|+++++||.+++...+    ++|++++++|++|||+|+++.++ +.+++.+ +.++|+++||+++
T Consensus       166 ~~~~~~y~~l~~pf~~~~~~~~~~~~~~tl~~~~~~l~T~S~~~~~~~~~~~d~l~~-~~~~l~~~~g~~~  235 (257)
T 4hg2_A          166 VHVESGYRTLPFPFPELEAPPLEIEERWPMDAFLGYLGTWSAVTAHRRRTGADPLAE-IAPALRAAWGTPE  235 (257)
T ss_dssp             HHHHTTTTTSCCCSCEECCCCCEEEEEECHHHHHHHHTTSHHHHHHHHHHSSCHHHH-HHHHHHHHHSSTT
T ss_pred             hHHHhhhhhCCCCCccceeeEEEEEEEecHHHHHHHHHHHHHHHHHHHHcCccHHHH-HHHHHHHhcCCCC
Confidence            8899999999999998876543    56999999999999999999776 7889998 9999999999763



>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.26
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.17
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.89
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.84
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.83
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.8
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.54
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.38
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.36
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.36
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.31
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.26
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.26
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.23
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.16
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.97
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.97
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.93
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.88
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.88
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.87
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.85
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.79
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.75
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.42
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.42
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.39
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.31
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.3
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.25
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.24
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.17
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.17
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 97.15
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 97.14
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.13
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.1
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.06
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.02
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.86
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 96.81
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.81
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 96.78
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 96.51
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 96.31
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.05
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 95.85
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 95.83
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 95.77
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 95.7
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 95.57
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 95.09
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 94.18
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 93.78
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 93.52
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 93.47
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 92.93
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 92.52
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 92.41
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 92.3
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 92.03
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 91.32
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 91.3
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 90.37
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 88.52
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 88.52
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 87.39
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 85.81
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 85.69
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 84.76
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 84.59
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 84.53
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 83.62
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 82.77
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein YcgJ
species: Bacillus subtilis [TaxId: 1423]
Probab=99.26  E-value=1.9e-12  Score=93.94  Aligned_cols=62  Identities=18%  Similarity=0.183  Sum_probs=50.8

Q ss_pred             ccccccCCCCCCccceEEEe--cccc-ChhhHHHHHHHHhhCCCceEEEEecCCCCCCHHHHHHHHH
Q 038491            3 ITELEQIVATQSSEDLVTIA--LYWF-DLPQFYKQVKWILKEPTRVIIAWTYTMPEINESAGVVFKS   66 (146)
Q Consensus         3 ~~~~e~l~~~d~s~Dlv~~a--~hw~-D~~~~l~e~~RvLk~pgG~la~~~~~~~~~~~~~~~~~~~   66 (146)
                      .+|++++|+++++||+|+|.  +||+ |++.++++++|+|| |||.+++..+..+. .+.+..+++.
T Consensus        70 ~~d~~~~~~~~~~fD~v~~~~~l~~~~d~~~~l~~~~r~Lk-pgG~~~~~~~~~~~-~~~~~~~~~~  134 (234)
T d1xxla_          70 QGTAESLPFPDDSFDIITCRYAAHHFSDVRKAVREVARVLK-QDGRFLLVDHYAPE-DPVLDEFVNH  134 (234)
T ss_dssp             ECBTTBCCSCTTCEEEEEEESCGGGCSCHHHHHHHHHHHEE-EEEEEEEEEECBCS-SHHHHHHHHH
T ss_pred             ccccccccccccccceeeeeceeecccCHHHHHHHHHHeeC-CCcEEEEEEcCCCC-CHHHHHHHHH
Confidence            57899999999999999999  7777 99999999999999 99999987765443 3444444443



>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure