Citrus Sinensis ID: 038551


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFESLY
cEEEcccccccccccEEEEccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHHHcccccEEccccccccccccHHHHcccccccEEEccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHcccccccccccHHHHccccccccccccccccccccccEEEEEcccccEEEccccccccccHHccccccHHHHHcccccccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEcHHHHHHcccccHHccccccccccccc
cEEEEEccccccccEEEEEccccccccccHHHHHHHHHHHHHcccHHcccccccccccEEEEEEccccccccHHHHHHcccEEEEEccccccHccccHHHHHHHcEEEEccccccHHHccHHHHHHHHHHHHcccccHcHcHccHHHHHccHccEEEEEEccccccccccccccccccHHHHHHHHHHHHHcEcEEEEccHHHHHHHHccccHHcHHHEEEEHHHcccccccEEEccHcHHcccEEEEEccccEEEEEEccccccEEEEEccccHcHcEEEEEcccHHHHEEcccHHHHHHcccccccHEEccccccccccccccccccccccEEEEEccHHHHHHcccccHHHHHHccccccccc
MTLRIASTINKEKENFLVLAGvglteapsigmwkETTRMSLMQNAIQNlteiptcprlrtlflpsnhlgtvsnnfFHSMASLRVLILSYNrslenlplgifnlvslqhldiswtgittLPIELKYLVNLKClnleytfrlsripqQVISDLKMLRALRMFECgfnveleadsilfgdsEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCrlgsistqclclrhlnnsnslSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMactcsqyqacprgltkfeehplkrlecaelkelpldcnhglEQKIIIKGQEHWWNElqwddlstqnaflpcfesly
mtlriastinkekenfLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYtfrlsripqQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFESLY
MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSevlveellvlkhlnllTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFESLY
************KENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCF****
MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFESLY
MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFESLY
MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFESL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFESLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query366 2.2.26 [Sep-21-2011]
Q9SH22884 Probable disease resistan yes no 0.907 0.375 0.319 4e-33
Q8RXS5888 Probable disease resistan no no 0.956 0.394 0.322 7e-32
Q9SI85893 Probable disease resistan no no 0.907 0.371 0.306 5e-30
O64973889 Disease resistance protei no no 0.928 0.382 0.297 1e-28
Q9FLB4874 Putative disease resistan no no 0.939 0.393 0.297 1e-27
Q9FG91848 Probable disease resistan no no 0.666 0.287 0.359 2e-26
Q940K0889 Probable disease resistan no no 0.390 0.160 0.496 6e-26
O64789925 Probable disease resistan no no 0.390 0.154 0.489 8e-26
Q9C8T9898 Putative disease resistan no no 0.918 0.374 0.317 2e-25
O22727 967 Probable disease resistan no no 0.368 0.139 0.489 2e-25
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function desciption
 Score =  142 bits (358), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 135/423 (31%), Positives = 196/423 (46%), Gaps = 91/423 (21%)

Query: 1   MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRT 60
           M L IAS +  +KE F+V AGVG+ E P I  W    RMSLM+N I +L     C  L T
Sbjct: 482 MALWIASELGIQKEAFIVRAGVGVREIPKIKNWNVVRRMSLMENKIHHLVGSYECMELTT 541

Query: 61  LFLPSNHLG-------TVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISW 113
           L L     G       T+S+ FF+ M  L VL LS+N+SL  LP  I NLVSL++L++ +
Sbjct: 542 LLLGKREYGSIRSQLKTISSEFFNCMPKLAVLDLSHNKSLFELPEEISNLVSLKYLNLLY 601

Query: 114 TGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSI 173
           T I+ LP  ++ L  +  LNLEYT +L  I    IS L  L+ L++F      +L     
Sbjct: 602 TEISHLPKGIQELKKIIHLNLEYTRKLESITG--ISSLHNLKVLKLFRSRLPWDLNT--- 656

Query: 174 LFGDSEVLVEELLVLKHLNLLTITL----QSFGALQRLLSYCRLGSISTQCLCLRHLNNS 229
                   V+EL  L+HL +LT T+    + F +  RLLS+ RL  I        + ++ 
Sbjct: 657 --------VKELETLEHLEILTTTIDPRAKQFLSSHRLLSHSRLLEI--------YGSSV 700

Query: 230 NSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIR--EICGFHSLQKV--------- 278
           +SL+       RHL +L +  + L E +I +  +  I+   IC F SL  V         
Sbjct: 701 SSLN-------RHLESLSVSTDKLREFQIKSCSISEIKMGGICNFLSLVDVNIFNCEGLR 753

Query: 279 -------FYKILKI---EARDMACTCSQYQAC---PRGLTKFEE------HPLKRL---- 315
                    KI  +    A+D+    ++ +AC     G+  F E      H L +L    
Sbjct: 754 ELTFLIFAPKIRSLSVWHAKDLEDIINEEKACEGEESGILPFPELNFLTLHDLPKLKKIY 813

Query: 316 ---------------ECAELKELPLDCNHGLEQK---IIIKGQEHWWNELQWDDLSTQNA 357
                          EC  L++LPLD   G + +   II      W+  ++W D +T+  
Sbjct: 814 WRPLPFLCLEEINIRECPNLRKLPLDSTSGKQGENGCIIRNKDSRWFEGVKWADEATKKR 873

Query: 358 FLP 360
           FLP
Sbjct: 874 FLP 876




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
24461866 890 NBS-LRR type disease resistance protein 0.975 0.401 0.430 1e-70
24461865 892 NBS-LRR type disease resistance protein 0.991 0.406 0.434 1e-66
24461861 890 NBS-LRR type disease resistance protein 0.978 0.402 0.426 5e-63
24461863 889 NBS-LRR type disease resistance protein 0.980 0.403 0.393 6e-58
224122896 820 cc-nbs-lrr resistance protein [Populus t 0.950 0.424 0.371 3e-56
24461864 899 NBS-LRR type disease resistance protein 0.991 0.403 0.387 2e-55
359482672 905 PREDICTED: probable disease resistance p 0.975 0.394 0.381 9e-53
225442867 893 PREDICTED: probable disease resistance p 0.945 0.387 0.375 2e-51
147852651 882 hypothetical protein VITISV_017542 [Viti 0.887 0.368 0.379 2e-49
359482674 991 PREDICTED: probable disease resistance p 0.948 0.350 0.372 2e-48
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 180/418 (43%), Positives = 237/418 (56%), Gaps = 61/418 (14%)

Query: 1   MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRT 60
           M L IA  I KEK+NFLV AGVGL EAP +  W++  R+SLM N I NL+E+ TCP L T
Sbjct: 480 MALWIACAIEKEKDNFLVYAGVGLIEAPDVSGWEKARRLSLMHNQITNLSEVATCPHLLT 539

Query: 61  LFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLP 120
           LFL  N L  + N+FF  M SL+VL L+ + SL NLP GI  LVSLQHLD+S + I  LP
Sbjct: 540 LFLNENELQMIHNDFFRFMPSLKVLNLA-DSSLTNLPEGISKLVSLQHLDLSKSSIEELP 598

Query: 121 IELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNV--ELEADSILFGDS 178
           +ELK LVNLKCLNLEYT+ L+ IP+Q+IS+L  L  LRMF    +       DSILFG  
Sbjct: 599 LELKALVNLKCLNLEYTWSLTTIPRQLISNLSRLHVLRMFAASHSAFDRASEDSILFGGG 658

Query: 179 EVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFA 238
           E++VEELL LK+L +++ TL+S   LQ  LS  +L S  T+ L L+  N+S SL V A A
Sbjct: 659 ELIVEELLGLKYLEVISFTLRSSHGLQSFLSSHKLRS-CTRALLLQCFNDSTSLEVSALA 717

Query: 239 SLRHLRTLQLY-FNDLEELKIDAGELKRIREICGFHSLQKVFYKILKIEA-RDMA----- 291
            L+ L  L +     LEELK+D    + +++   FHSL+KV  +IL     +D+      
Sbjct: 718 DLKQLNRLWITECKKLEELKMDY--TREVQQFV-FHSLKKV--EILACSKLKDLTFLVFA 772

Query: 292 --CTCSQYQACPR-----GLTKFEE--------HPLKRLE-------------------- 316
                 +   CP       + KF E        +P  +L+                    
Sbjct: 773 PNLESIELMGCPAMEEMVSMGKFAEVPEVVANLNPFAKLQNLKLFGATNLKSIYWKPLPF 832

Query: 317 ----------CAELKELPLDCNHGLEQKIIIKGQEHWWNELQWDDLSTQNAFLPCFES 364
                     C +LK+LPLD N   E+ I+I G   WW +L+W D +T+NAFLPCF+S
Sbjct: 833 PHLKSMSFSHCYKLKKLPLDSNSARERNIVISGTRRWWEQLEWVDEATRNAFLPCFDS 890




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|224122896|ref|XP_002318943.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857319|gb|EEE94866.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.674 0.278 0.377 3.7e-34
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.434 0.179 0.440 7.8e-31
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.461 0.221 0.488 8e-31
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.461 0.174 0.471 2.1e-30
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.461 0.187 0.477 4.2e-30
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.428 0.177 0.468 1.5e-29
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.715 0.299 0.327 2.1e-29
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.461 0.189 0.413 4.4e-27
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.743 0.319 0.341 4.3e-25
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.453 0.185 0.426 6e-25
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 3.7e-34, Sum P(2) = 3.7e-34
 Identities = 99/262 (37%), Positives = 133/262 (50%)

Query:     1 MTLRIASTINKEKENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRT 60
             M L IAS   K+KENF+V AG+     P I  WK   R+SLM N I+++ + P  P+L T
Sbjct:   478 MALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLIT 537

Query:    61 LFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLP 120
             L L  N LG +S++FF  M  L VL LS NR L +LP  I   VSLQ+L +S T I   P
Sbjct:   538 LLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWP 597

Query:   121 IELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSXX 180
               L  L  L  LNLEYT  +  I    IS L  L+ LR+F  GF      D  +  +   
Sbjct:   598 AGLVELRKLLYLNLEYTRMVESICG--ISGLTSLKVLRLFVSGF----PEDPCVLNE--- 648

Query:   181 XXXXXXXXXXXXXXTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASL 240
                           TITL     L++ LS  RL S  T+ L + +LN  +S+  F  A++
Sbjct:   649 ----LQLLENLQTLTITLGLASILEQFLSNQRLASC-TRALRIENLNPQSSVISFV-ATM 702

Query:   241 RHLRTLQLYFNDLEELKIDAGE 262
               L+ L    +D+ E+K+   E
Sbjct:   703 DSLQELHFADSDIWEIKVKRNE 724


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XIII000034
cc-nbs-lrr resistance protein (820 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 45.2 bits (108), Expect = 8e-07
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 57  RLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIF-NLVSLQHLDISWTG 115
            L++L L +N L  + +  F  + +L+VL LS N +L ++    F  L SL+ LD+S   
Sbjct: 1   NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGN-NLTSISPEAFSGLPSLRSLDLSGNN 59

Query: 116 I 116
           +
Sbjct: 60  L 60


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 366
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.81
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.75
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.72
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.55
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.49
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.44
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.43
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.23
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.22
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG4341483 consensus F-box protein containing LRR [General fu 98.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.83
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.81
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.74
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.73
KOG4341483 consensus F-box protein containing LRR [General fu 98.68
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.65
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.63
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.58
PLN03150623 hypothetical protein; Provisional 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.49
PLN03150623 hypothetical protein; Provisional 98.46
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.34
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.96
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.86
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.86
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.67
PRK15386426 type III secretion protein GogB; Provisional 97.66
PRK15386426 type III secretion protein GogB; Provisional 97.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.43
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.28
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.1
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.03
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.54
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.47
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.88
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.8
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.39
smart0037026 LRR Leucine-rich repeats, outliers. 91.65
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.65
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.76
KOG4308478 consensus LRR-containing protein [Function unknown 85.84
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.69
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.42
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.90  E-value=3.2e-23  Score=215.67  Aligned_cols=182  Identities=22%  Similarity=0.260  Sum_probs=127.3

Q ss_pred             eeeeccC-cCCccEEEecCCCcccC--CCCCCCCcccEEEcccCCccc-cCCC--CCCCCccEEEccCCCCc-cccchhh
Q 038551            4 RIASTIN-KEKENFLVLAGVGLTEA--PSIGMWKETTRMSLMQNAIQN-LTEI--PTCPRLRTLFLPSNHLG-TVSNNFF   76 (366)
Q Consensus         4 ~~~~~~~-~~~~~~~~~~~~~~~~~--~~~~~~~~L~~L~l~~~~~~~-l~~~--~~~~~L~~L~l~~~~~~-~i~~~~~   76 (366)
                      |-++.|. ......+++.++++...  +.+..+++|+.|++++|.+.. +|..  ..+.+|++|++++|.+. .+|.   
T Consensus        60 w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---  136 (968)
T PLN00113         60 WQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---  136 (968)
T ss_pred             CcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc---
Confidence            4444443 24556667777776655  457788999999999998874 6655  47888888888888775 3443   


Q ss_pred             cCCCCCCEEEccCCCCCCCcchhhcCCCCCcEEEccccccc-cccccccCCCCCCEEEcccccccCccChhhhcCCcCCc
Q 038551           77 HSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGIT-TLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLR  155 (366)
Q Consensus        77 ~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~~~-~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~  155 (366)
                      ..+++|++|++++|...+.+|..++++++|++|++++|.+. .+|..+.++++|++|++++|...+.+|.. +.++++|+
T Consensus       137 ~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~  215 (968)
T PLN00113        137 GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLK  215 (968)
T ss_pred             cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCcc
Confidence            34677888888877555567777777788888888777665 56666777777888888776666666665 67777777


Q ss_pred             EEEeecCCccccccccccccCCchhhhhhhhcCcccceeeeccccch
Q 038551          156 ALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITLQSFG  202 (366)
Q Consensus       156 ~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~  202 (366)
                      +|++.+|.+.+             ..+..+..+++|+.|++++|...
T Consensus       216 ~L~L~~n~l~~-------------~~p~~l~~l~~L~~L~L~~n~l~  249 (968)
T PLN00113        216 WIYLGYNNLSG-------------EIPYEIGGLTSLNHLDLVYNNLT  249 (968)
T ss_pred             EEECcCCccCC-------------cCChhHhcCCCCCEEECcCceec
Confidence            77777777765             44555666666666666666554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-06
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Iteration: 1

Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 77/279 (27%), Positives = 117/279 (41%), Gaps = 66/279 (23%) Query: 47 QNLTEIPT--CPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRSLENLPLGIFN-L 103 + LT IP+ + L L SN L ++ + FH + LR+L L+ N+ L+ LP GIF L Sbjct: 26 KKLTAIPSNIPADTKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNK-LQTLPAGIFKEL 84 Query: 104 VSLQHLDISWTGITTLPIEL-KYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFEC 162 +L+ L ++ + LPI + LVNL L L+ +L +P +V L L L + Sbjct: 85 KNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRN-QLKSLPPRVFDSLTKLTYLSL--- 140 Query: 163 GFNVELEADSILFGDSXXXXXXXXXXXXXXXXTITLQSF--GALQRLLSYCRLGSISTQC 220 G+N LQS G +L S L Sbjct: 141 GYN-------------------------------ELQSLPKGVFDKLTSLKEL------- 162 Query: 221 LCLRHLNNS-NSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIREICGFHSLQKVF 279 R NN + AF L L+TL K+D +LKR+ E F SL+K+ Sbjct: 163 ---RLYNNQLKRVPEGAFDKLTELKTL----------KLDNNQLKRVPE-GAFDSLEKL- 207 Query: 280 YKILKIEARDMACTCSQYQACPRGLTKFEEHPLKRLECA 318 K+L+++ CTC+ + L K + L ++ A Sbjct: 208 -KMLQLQENPWDCTCNGIIYMAKWLKKKADEGLGGVDTA 245

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-04
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
 Score = 98.3 bits (245), Expect = 8e-23
 Identities = 71/254 (27%), Positives = 108/254 (42%), Gaps = 24/254 (9%)

Query: 23  GLTEAPSIGMWKETTRMSLMQNAIQNLTE--IPTCPRLRTLFLPSNHLGTVSNNFFHSMA 80
                P  G+  ET  + L +N I+ L +    + P L  L L  N +  V    F+++ 
Sbjct: 22  RFVAVPE-GIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLF 80

Query: 81  SLRVLILSYNRSLENLPLGIF-NLVSLQHLDISWTGITTLPIEL-KYLVNLKCLNLEYTF 138
           +LR L L  NR L+ +PLG+F  L +L  LDIS   I  L   + + L NLK L +    
Sbjct: 81  NLRTLGLRSNR-LKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDN- 138

Query: 139 RLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVLKHLNLLTITL 198
            L  I  +  S L  L  L + +C     +  ++        L+   L L+HLN+  I  
Sbjct: 139 DLVYISHRAFSGLNSLEQLTLEKCNLT-SIPTEA--LSHLHGLIV--LRLRHLNINAIRD 193

Query: 199 QSFGALQRL----LSYCRLGSIST----QCLCLRHLN-NSNSLSVF---AFASLRHLRTL 246
            SF  L RL    +S+       T      L L  L+    +L+     A   L +LR L
Sbjct: 194 YSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFL 253

Query: 247 QLYFNDLEELKIDA 260
            L +N +  ++   
Sbjct: 254 NLSYNPISTIEGSM 267


>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.91
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.66
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.6
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.27
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.21
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.03
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.96
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.94
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.49
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.4
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.75
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.61
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.85
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.94  E-value=7.4e-25  Score=200.80  Aligned_cols=272  Identities=17%  Similarity=0.215  Sum_probs=155.5

Q ss_pred             CccEEEecCCCcccCCCCCCCCcccEEEcccCCccccCCCCCCCCccEEEccCCCCccccchhhcCCCCCCEEEccCCCC
Q 038551           13 KENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRS   92 (366)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~i~~~~~~~l~~L~~L~l~~~~~   92 (366)
                      ..+.+.+.++.+.+++.+..+++|+.|++++|.++.++....+++|++|++++|.+..++.  +..+++|++|++++| .
T Consensus        45 ~L~~L~l~~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~L~~L~L~~n~i~~~~~--~~~l~~L~~L~l~~n-~  121 (347)
T 4fmz_A           45 SITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISA--LQNLTNLRELYLNED-N  121 (347)
T ss_dssp             TCSEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG--GTTCTTCSEEECTTS-C
T ss_pred             cccEEEEeCCccccchhhhhcCCccEEEccCCccccchhhhcCCcCCEEEccCCcccCchH--HcCCCcCCEEECcCC-c
Confidence            4456666666666666666677777777777777666555666777777777776666543  666777777777776 4


Q ss_pred             CCCcchhhcCCCCCcEEEccccccccccccccCCCCCCEEEcccccccCccChhhhcCCcCCcEEEeecCCccccccccc
Q 038551           93 LENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADS  172 (366)
Q Consensus        93 ~~~l~~~~~~l~~L~~L~l~~~~~~~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~  172 (366)
                      ++.++. +..+++|++|++++|.....+..+..+++|++|++++| .+...+.  +..+++|++|++.+|.+..      
T Consensus       122 i~~~~~-~~~l~~L~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~-~~~~~~~--~~~l~~L~~L~l~~n~l~~------  191 (347)
T 4fmz_A          122 ISDISP-LANLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTES-KVKDVTP--IANLTDLYSLSLNYNQIED------  191 (347)
T ss_dssp             CCCCGG-GTTCTTCCEEECTTCTTCCCCGGGTTCTTCCEEECCSS-CCCCCGG--GGGCTTCSEEECTTSCCCC------
T ss_pred             ccCchh-hccCCceeEEECCCCCCcccccchhhCCCCcEEEecCC-CcCCchh--hccCCCCCEEEccCCcccc------
Confidence            555554 66667777777777643333333666777777777763 3444433  5566677777777776653      


Q ss_pred             cccCCchhhhhhhhcCcccceeeeccccchhhHhHhhhcccCcccceeeeccccCCCCCcchhhhccCCcCcEEEeccCc
Q 038551          173 ILFGDSEVLVEELLVLKHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFND  252 (366)
Q Consensus       173 ~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~~~~~l~~l~l~~L~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~  252 (366)
                               ...+..+++|+.+++++|.+..++.+..+.+     ++.|++.++.-.....   +..+++|++|++++|.
T Consensus       192 ---------~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~-----L~~L~l~~n~l~~~~~---~~~l~~L~~L~l~~n~  254 (347)
T 4fmz_A          192 ---------ISPLASLTSLHYFTAYVNQITDITPVANMTR-----LNSLKIGNNKITDLSP---LANLSQLTWLEIGTNQ  254 (347)
T ss_dssp             ---------CGGGGGCTTCCEEECCSSCCCCCGGGGGCTT-----CCEEECCSSCCCCCGG---GTTCTTCCEEECCSSC
T ss_pred             ---------cccccCCCccceeecccCCCCCCchhhcCCc-----CCEEEccCCccCCCcc---hhcCCCCCEEECCCCc
Confidence                     1115556666666666666655544332332     3334444432221111   5566667777776666


Q ss_pred             cceEeccccccccccccCCCCCcceeeeecccceeEEeeccCccccccccccceEEeecCc--------ccCCccccccc
Q 038551          253 LEELKIDAGELKRIREICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLK--------RLECAELKELP  324 (366)
Q Consensus       253 l~~l~~~~~~~~~~~~~~~~~~L~~L~l~l~~l~~L~l~~~c~~l~~~~~~L~~L~l~~~~--------~~~~~~L~~L~  324 (366)
                      ++.++.  .        ..+++|+.|+++-..+     . .-+.+..+++ |++|++++|+        +..+++|+.|+
T Consensus       255 l~~~~~--~--------~~l~~L~~L~l~~n~l-----~-~~~~~~~l~~-L~~L~L~~n~l~~~~~~~l~~l~~L~~L~  317 (347)
T 4fmz_A          255 ISDINA--V--------KDLTKLKMLNVGSNQI-----S-DISVLNNLSQ-LNSLFLNNNQLGNEDMEVIGGLTNLTTLF  317 (347)
T ss_dssp             CCCCGG--G--------TTCTTCCEEECCSSCC-----C-CCGGGGGCTT-CSEEECCSSCCCGGGHHHHHTCTTCSEEE
T ss_pred             cCCChh--H--------hcCCCcCEEEccCCcc-----C-CChhhcCCCC-CCEEECcCCcCCCcChhHhhccccCCEEE
Confidence            555421  1        4456666666541110     0 0111222455 6666666655        34556666666


Q ss_pred             CCCCCCC
Q 038551          325 LDCNHGL  331 (366)
Q Consensus       325 l~~n~~~  331 (366)
                      +++|.+.
T Consensus       318 L~~n~l~  324 (347)
T 4fmz_A          318 LSQNHIT  324 (347)
T ss_dssp             CCSSSCC
T ss_pred             ccCCccc
Confidence            6666554



>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 366
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 47.7 bits (112), Expect = 1e-06
 Identities = 24/120 (20%), Positives = 49/120 (40%), Gaps = 5/120 (4%)

Query: 17  LVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFF 76
           L L    ++    +      T + L +N +++++ I     L  L L  N++  +S    
Sbjct: 268 LKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--V 325

Query: 77  HSMASLRVLILSYNRSLENLPLGIFNLVSLQHLDISWTGITTLPIELKYLVNLKCLNLEY 136
            S+  L+ L  + N+ + ++   + NL ++  L      I+ L   L  L  +  L L  
Sbjct: 326 SSLTKLQRLFFANNK-VSDVS-SLANLTNINWLSAGHNQISDL-TPLANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.52
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.16
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.98
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.93
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.92
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.37
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.88
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.86  E-value=1.9e-20  Score=171.21  Aligned_cols=269  Identities=18%  Similarity=0.282  Sum_probs=153.9

Q ss_pred             CccEEEecCCCcccCCCCCCCCcccEEEcccCCccccCCCCCCCCccEEEccCCCCccccchhhcCCCCCCEEEccCCCC
Q 038551           13 KENFLVLAGVGLTEAPSIGMWKETTRMSLMQNAIQNLTEIPTCPRLRTLFLPSNHLGTVSNNFFHSMASLRVLILSYNRS   92 (366)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~i~~~~~~~l~~L~~L~l~~~~~   92 (366)
                      +.+.+.+.++++.+++.++.+++|++|++++|.++++++...+++|++|++++|.+..+++  +..+++|+.|+++++ .
T Consensus        45 ~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~--l~~l~~L~~L~~~~~-~  121 (384)
T d2omza2          45 QVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP--LANLTNLTGLTLFNN-Q  121 (384)
T ss_dssp             TCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSS-C
T ss_pred             CCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc--ccccccccccccccc-c
Confidence            5667788888888888888899999999999999988777889999999999999888775  778999999998877 3


Q ss_pred             CCCcch----------------------------------------------------------------hhcCCCCCcE
Q 038551           93 LENLPL----------------------------------------------------------------GIFNLVSLQH  108 (366)
Q Consensus        93 ~~~l~~----------------------------------------------------------------~~~~l~~L~~  108 (366)
                      .+.++.                                                                .+..+++++.
T Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  201 (384)
T d2omza2         122 ITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLES  201 (384)
T ss_dssp             CCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTCSE
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccccccce
Confidence            332211                                                                1222344445


Q ss_pred             EEccccccccccccccCCCCCCEEEcccccccCccChhhhcCCcCCcEEEeecCCccccccccccccCCchhhhhhhhcC
Q 038551          109 LDISWTGITTLPIELKYLVNLKCLNLEYTFRLSRIPQQVISDLKMLRALRMFECGFNVELEADSILFGDSEVLVEELLVL  188 (366)
Q Consensus       109 L~l~~~~~~~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~l  188 (366)
                      ++++++.++.++. ...+++|++|++++ +.+..++.  +..+++|+.+++.+|.+.+               ...+..+
T Consensus       202 l~l~~n~i~~~~~-~~~~~~L~~L~l~~-n~l~~~~~--l~~l~~L~~L~l~~n~l~~---------------~~~~~~~  262 (384)
T d2omza2         202 LIATNNQISDITP-LGILTNLDELSLNG-NQLKDIGT--LASLTNLTDLDLANNQISN---------------LAPLSGL  262 (384)
T ss_dssp             EECCSSCCCCCGG-GGGCTTCCEEECCS-SCCCCCGG--GGGCTTCSEEECCSSCCCC---------------CGGGTTC
T ss_pred             eeccCCccCCCCc-ccccCCCCEEECCC-CCCCCcch--hhcccccchhccccCccCC---------------CCccccc
Confidence            5555544444332 23444555555555 23333332  4455555555555555443               1124445


Q ss_pred             cccceeeeccccchhhHhHhhhcccCcccceeeeccccCCCCCcchhhhccCCcCcEEEeccCccceEeccccccccccc
Q 038551          189 KHLNLLTITLQSFGALQRLLSYCRLGSISTQCLCLRHLNNSNSLSVFAFASLRHLRTLQLYFNDLEELKIDAGELKRIRE  268 (366)
Q Consensus       189 ~~L~~L~l~~~~~~~~~~l~~~~~l~~l~l~~L~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~l~~~~~~~~~~~~  268 (366)
                      ++|+.++++++....++.+.....+.     .+..+.+.-..   +..+..+++++.|++++|+++.++.          
T Consensus       263 ~~L~~L~l~~~~l~~~~~~~~~~~l~-----~l~~~~n~l~~---~~~~~~~~~l~~L~ls~n~l~~l~~----------  324 (384)
T d2omza2         263 TKLTELKLGANQISNISPLAGLTALT-----NLELNENQLED---ISPISNLKNLTYLTLYFNNISDISP----------  324 (384)
T ss_dssp             TTCSEEECCSSCCCCCGGGTTCTTCS-----EEECCSSCCSC---CGGGGGCTTCSEEECCSSCCSCCGG----------
T ss_pred             ccCCEeeccCcccCCCCccccccccc-----ccccccccccc---ccccchhcccCeEECCCCCCCCCcc----------
Confidence            55666666555555444333222221     22222221111   1125556666666666666654421          


Q ss_pred             cCCCCCcceeeeecccceeEEeeccCccccccccccceEEeecCc------ccCCcccccccCCCC
Q 038551          269 ICGFHSLQKVFYKILKIEARDMACTCSQYQACPRGLTKFEEHPLK------RLECAELKELPLDCN  328 (366)
Q Consensus       269 ~~~~~~L~~L~l~l~~l~~L~l~~~c~~l~~~~~~L~~L~l~~~~------~~~~~~L~~L~l~~n  328 (366)
                      ...+++|+.|+++-..++      +.+.+..+|+ |++|++++|+      +.++++|+.|++++|
T Consensus       325 l~~l~~L~~L~L~~n~l~------~l~~l~~l~~-L~~L~l~~N~l~~l~~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         325 VSSLTKLQRLFFANNKVS------DVSSLANLTN-INWLSAGHNQISDLTPLANLTRITQLGLNDQ  383 (384)
T ss_dssp             GGGCTTCCEEECCSSCCC------CCGGGGGCTT-CCEEECCSSCCCBCGGGTTCTTCSEEECCCE
T ss_pred             cccCCCCCEEECCCCCCC------CChhHcCCCC-CCEEECCCCcCCCChhhccCCCCCEeeCCCC
Confidence            034566666655411111      1112333555 6777766666      455666666666654



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure