Citrus Sinensis ID: 038616
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 431 | ||||||
| 255574424 | 475 | hypothetical protein RCOM_0146500 [Ricin | 0.781 | 0.709 | 0.327 | 4e-28 | |
| 224076050 | 435 | predicted protein [Populus trichocarpa] | 0.728 | 0.721 | 0.290 | 1e-23 | |
| 356536552 | 325 | PREDICTED: uncharacterized protein LOC10 | 0.232 | 0.307 | 0.454 | 4e-16 | |
| 255647072 | 325 | unknown [Glycine max] | 0.232 | 0.307 | 0.454 | 4e-16 | |
| 297812445 | 340 | zinc finger family protein [Arabidopsis | 0.245 | 0.311 | 0.421 | 4e-14 | |
| 147819102 | 299 | hypothetical protein VITISV_011729 [Viti | 0.155 | 0.224 | 0.623 | 6e-14 | |
| 15226613 | 329 | C2H2-like zinc finger protein [Arabidops | 0.266 | 0.349 | 0.372 | 6e-13 | |
| 297832510 | 333 | hypothetical protein ARALYDRAFT_900233 [ | 0.278 | 0.360 | 0.370 | 9e-13 | |
| 297836188 | 330 | zinc finger family protein [Arabidopsis | 0.278 | 0.363 | 0.377 | 1e-12 | |
| 91805447 | 301 | zinc finger family protein [Arabidopsis | 0.245 | 0.352 | 0.398 | 2e-12 |
| >gi|255574424|ref|XP_002528125.1| hypothetical protein RCOM_0146500 [Ricinus communis] gi|223532464|gb|EEF34255.1| hypothetical protein RCOM_0146500 [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 132 bits (332), Expect = 4e-28, Method: Compositional matrix adjust.
Identities = 135/412 (32%), Positives = 194/412 (47%), Gaps = 75/412 (18%)
Query: 1 MSFNFNSFNSQPN---FGFNSSRA---LPNFGSNFHNDNGQGFDFNYSNVGQNHVNYGQN 54
M+ N NSFN PN FG + L + SN +N G F S + +G N
Sbjct: 1 MAGNLNSFN--PNSLDFGLINDAMDHFLLSLNSNLDQNNVNGSTFINSQL------FGSN 52
Query: 55 ELIPQRNSQPT-------IGAGQLGLSQRVSDVIRRNNFSPSYPRRVQVQSVIDYYPVEN 107
+I + PT + GQLGLSQR+S+V RR +P RVQV S IDY+PV+
Sbjct: 53 SIISVHQNNPTPQADHARVSHGQLGLSQRLSEV-RRTYVAP---HRVQVHSFIDYFPVQQ 108
Query: 108 QPGVA----EVAVTEVVKT-KFLTSSASTRDRILAPNDHMISSSHQQPFLRNRNFLLSNQ 162
Q EV VTE+V+T KFLTS+ + + PND I H Q +N +SN
Sbjct: 109 QNQSICPQHEVTVTEIVRTTKFLTSTPKM-EPLFTPND--IFHPHDQHNFQNHGLPISN- 164
Query: 163 PNQLSDQNYESIYDSPSFLQNWSQNPLTTQNNNEQPFHNTFQNTTQNKSMSPSSTMSSQV 222
N+ S+ S F +S P N N+ NT+ + P + +
Sbjct: 165 -----ILNHHSLIKSEPF---YSPYPSLESNKNQ--MMNTYDGDMNGDLVQPLALTGQEH 214
Query: 223 NNSFPDNNDVPAQNILNQNPRQHQPNNLPVAKHDCEEILDPEPLSVLAPQSQNP-SH--- 278
N ++ ++P Q P+ +H ++ + V + + N SH
Sbjct: 215 TNHL----------MMPKSPVQQFPH-----RHTNPPAINLHEIKVESDTNGNLLSHRKR 259
Query: 279 -DHDL-VGDLIYAPRK-------MSEESSDDEDEDEEGDGVIHSLSRKKYGPYICPKCIQ 329
DH + V LI R+ + ++D D E DG HSL +KYGPY CPKC
Sbjct: 260 ADHMMTVKYLIQQLRRTHPNASNLQTNTADMGSSDTEDDGRTHSLPHEKYGPYTCPKCRN 319
Query: 330 EFLTSQSFAAHVASAHYRFETAAERKKRLAAKYKKKNILRMARSSNGSLTIV 381
F SQ+FAAH+ + HY+ E++ +RKKRLAAKYK+KN+ + R G +T++
Sbjct: 320 VFSVSQTFAAHMLT-HYKNESSDQRKKRLAAKYKRKNLRLVYRR--GGMTLL 368
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224076050|ref|XP_002304889.1| predicted protein [Populus trichocarpa] gi|222842321|gb|EEE79868.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356536552|ref|XP_003536801.1| PREDICTED: uncharacterized protein LOC100788426 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255647072|gb|ACU24004.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297812445|ref|XP_002874106.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297319943|gb|EFH50365.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|147819102|emb|CAN71222.1| hypothetical protein VITISV_011729 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15226613|ref|NP_179176.1| C2H2-like zinc finger protein [Arabidopsis thaliana] gi|4335740|gb|AAD17418.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana] gi|225898108|dbj|BAH30386.1| hypothetical protein [Arabidopsis thaliana] gi|330251340|gb|AEC06434.1| C2H2-like zinc finger protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297832510|ref|XP_002884137.1| hypothetical protein ARALYDRAFT_900233 [Arabidopsis lyrata subsp. lyrata] gi|297329977|gb|EFH60396.1| hypothetical protein ARALYDRAFT_900233 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297836188|ref|XP_002885976.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297331816|gb|EFH62235.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|91805447|gb|ABE65452.1| zinc finger family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 431 | ||||||
| TAIR|locus:2046318 | 251 | AT2G18490 "AT2G18490" [Arabido | 0.090 | 0.155 | 0.675 | 6.9e-10 | |
| TAIR|locus:2053598 | 329 | AT2G15740 "AT2G15740" [Arabido | 0.088 | 0.115 | 0.641 | 4.9e-09 | |
| TAIR|locus:2163857 | 300 | AT5G42640 "AT5G42640" [Arabido | 0.088 | 0.126 | 0.615 | 8.1e-08 | |
| TAIR|locus:2172716 | 324 | AT5G22990 "AT5G22990" [Arabido | 0.090 | 0.120 | 0.615 | 4.3e-07 | |
| DICTYBASE|DDB_G0287057 | 953 | gtaN "GATA zinc finger domain- | 0.313 | 0.141 | 0.264 | 0.00072 |
| TAIR|locus:2046318 AT2G18490 "AT2G18490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 137 (53.3 bits), Expect = 6.9e-10, Sum P(3) = 6.9e-10
Identities = 27/40 (67%), Positives = 30/40 (75%)
Query: 311 IHSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHYRFET 350
IHSL KKYGPY CPKC F TSQ FAAH++S HY+ ET
Sbjct: 158 IHSLPYKKYGPYTCPKCNSIFDTSQKFAAHMSS-HYKSET 196
|
|
| TAIR|locus:2053598 AT2G15740 "AT2G15740" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163857 AT5G42640 "AT5G42640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2172716 AT5G22990 "AT5G22990" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0287057 gtaN "GATA zinc finger domain-containing protein 14" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| PHA00616 | 44 | hypothetical protein | 97.08 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.01 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 96.83 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.59 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 95.93 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 94.6 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 94.18 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 93.29 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 93.26 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 92.79 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 92.65 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 92.05 | |
| COG4049 | 65 | Uncharacterized protein containing archaeal-type C | 91.58 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 91.4 | |
| PHA00732 | 79 | hypothetical protein | 87.92 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 86.53 | |
| PHA00733 | 128 | hypothetical protein | 85.87 |
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
Probab=97.08 E-value=0.00028 Score=52.62 Aligned_cols=27 Identities=26% Similarity=0.482 Sum_probs=24.4
Q ss_pred cccCcccchhhhhhHHHHHHHhhhccc
Q 038616 321 PYICPKCIQEFLTSQSFAAHVASAHYR 347 (431)
Q Consensus 321 PYtCPKCN~VFdTSQkFAAHmsS~HYK 347 (431)
||.||.|+++|...+.+..|+.+.|-.
T Consensus 1 pYqC~~CG~~F~~~s~l~~H~r~~hg~ 27 (44)
T PHA00616 1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ 27 (44)
T ss_pred CCccchhhHHHhhHHHHHHHHHHhcCC
Confidence 899999999999999999999985543
|
|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 431 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 54.9 bits (131), Expect = 4e-08
Identities = 40/354 (11%), Positives = 88/354 (24%), Gaps = 117/354 (33%)
Query: 141 HMISSSHQQPFLRNRNFLLSNQP----------------NQLSDQNYESIYDSPSFLQN- 183
HM + + + + ++ L + + LS + + I S +
Sbjct: 6 HMDFETGEHQY-QYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGT 64
Query: 184 ----WSQNPLTTQNNN---------EQPFHNTFQNTTQNKSMSPSSTM---SSQVNNSFP 227
W+ L ++ + + + + + PS Q + +
Sbjct: 65 LRLFWT---LLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYN 121
Query: 228 DNNDVPAQNILNQNPRQHQPNNLPVAKHDCEEILDPEPL-----------SVLAPQSQNP 276
DN N+ R L L P + +A
Sbjct: 122 DNQVFAKYNV----SRLQPYLKL----RQALLELRPAKNVLIDGVLGSGKTWVA------ 167
Query: 277 SHDHDLVGDLIYAPRKMSEESSDDEDEDEEGDGVIHSLSRKKYGPYICPKCIQEFLTS-- 334
+ + D I L+ P+ + E L
Sbjct: 168 ------------------LDVCLSYKVQCKMDFKIFWLN---LKNCNSPETVLEMLQKLL 206
Query: 335 -------QSFAAHVASAHYRFETAAERKKRLAAKYKKKN---ILRMARSSN-------GS 377
S + H ++ R + +RL +N +L +++
Sbjct: 207 YQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSC 266
Query: 378 LTIVHGRSFKNIADWRRKEKRAAVKIEDGDDQVQKQGEDGLTIGGIAVKEEALA 431
++ R FK + D+ + ++ LT +E +
Sbjct: 267 KILLTTR-FKQVTDFLSAATTTHISLDH--------HSMTLT------PDEVKS 305
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 97.46 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.45 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.39 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.27 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.23 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.22 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 97.22 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 97.22 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 97.17 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.17 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 97.17 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.16 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 96.21 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.13 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.13 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.12 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 97.12 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.11 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 97.1 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.1 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 97.09 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.09 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.09 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.09 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.08 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 97.08 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.08 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.08 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 97.08 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.07 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.07 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.07 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.07 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.07 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.07 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 97.07 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.06 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 97.06 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.05 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.04 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 97.04 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 97.03 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 97.03 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 97.01 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 97.01 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.01 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 97.0 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 97.0 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 97.0 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.99 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 96.99 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.99 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.99 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.99 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.99 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.98 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.98 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.98 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.98 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.98 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 96.98 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.97 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 96.97 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 96.96 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.96 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.95 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.95 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.94 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.94 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.93 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.93 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.93 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.93 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.92 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 96.92 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.92 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 96.91 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.91 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 96.91 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 96.91 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 96.91 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.9 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.9 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.9 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.9 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.9 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.89 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 96.89 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.89 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.89 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.88 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.88 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 96.88 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 96.88 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.88 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.87 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 96.87 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 96.86 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.86 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.85 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 96.84 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.84 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.83 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.83 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.82 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.82 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.81 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.81 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 96.81 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.8 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 96.79 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 96.78 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 95.79 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.74 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.73 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.71 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 96.71 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.7 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 96.7 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 96.69 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 96.69 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 96.68 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 96.68 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 95.71 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 96.66 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 96.65 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 96.64 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 96.61 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 96.55 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 96.52 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 96.51 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 96.46 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 96.45 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 96.45 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 96.44 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 96.35 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.35 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 96.33 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 96.3 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.27 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.26 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 96.26 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 96.23 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 96.21 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 96.15 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 96.15 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 96.14 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.09 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 96.09 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 96.08 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 96.04 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 96.04 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 96.04 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 96.04 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 95.96 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 95.9 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 95.9 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 95.89 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 95.85 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 95.82 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 95.82 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 95.8 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 95.78 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 95.75 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 95.62 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 95.6 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 95.6 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 95.59 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 95.58 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 95.55 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 95.53 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 95.51 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 95.47 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 95.36 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 95.35 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 95.3 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 95.23 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 95.22 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 95.1 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 95.05 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 95.01 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 94.93 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 94.92 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 94.87 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 94.84 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 94.82 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 94.77 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 94.7 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 94.68 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 94.68 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 94.67 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 94.62 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 94.37 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 94.32 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 94.27 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 94.16 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 94.14 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 94.03 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 93.96 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 93.94 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 93.94 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 93.87 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 93.77 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 93.75 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 93.71 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 93.68 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 93.62 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 93.57 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 93.56 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 93.52 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 93.39 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 93.32 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 93.25 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 93.03 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 92.73 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 92.56 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 92.34 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 92.31 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 92.13 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 91.42 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 91.34 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 91.32 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 90.61 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 90.31 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 90.12 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 90.01 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 89.83 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 89.74 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 88.37 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 87.16 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 83.98 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 81.37 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 80.03 |
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
Probab=97.46 E-value=6.5e-05 Score=45.82 Aligned_cols=33 Identities=27% Similarity=0.571 Sum_probs=28.0
Q ss_pred eccccccCcccCcccchhhhhhHHHHHHHhhhcc
Q 038616 313 SLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHY 346 (431)
Q Consensus 313 SLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HY 346 (431)
..-|....||.|+.|++.|.++..|..||.. |-
T Consensus 3 ~~~h~~~k~~~C~~C~k~f~~~~~l~~H~~~-H~ 35 (37)
T 1p7a_A 3 TRGSTGIKPFQCPDCDRSFSRSDHLALHRKR-HM 35 (37)
T ss_dssp SSTTCCSSSBCCTTTCCCBSSHHHHHHHHGG-GT
T ss_pred CCcCCCCCCccCCCCCcccCcHHHHHHHHHH-hc
Confidence 3345677899999999999999999999985 74
|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 97.22 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 97.21 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 97.19 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 97.14 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 97.03 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 96.99 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.71 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 96.63 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 96.53 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 96.39 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 96.36 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.33 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.29 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 96.02 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 95.84 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 95.6 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 95.33 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 95.07 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 94.92 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 94.63 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 94.47 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 93.72 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 93.31 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 93.04 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 91.44 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 89.52 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 88.46 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 85.66 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 85.21 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 81.34 |
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.22 E-value=6.9e-05 Score=50.11 Aligned_cols=34 Identities=21% Similarity=0.460 Sum_probs=30.1
Q ss_pred eeccccccCcccCcccchhhhhhHHHHHHHhhhcc
Q 038616 312 HSLSRKKYGPYICPKCIQEFLTSQSFAAHVASAHY 346 (431)
Q Consensus 312 HSLP~~KyGPYtCPKCN~VFdTSQkFAAHmsS~HY 346 (431)
|..-|....||+|+.|+|.|..+..|..|+.. |-
T Consensus 3 H~~~Ht~ekpy~C~~CgK~F~~~s~L~~H~r~-Ht 36 (38)
T d2cota2 3 SEWQQRERRRYKCDECGKSFSHSSDLSKHRRT-HT 36 (38)
T ss_dssp CCSCCCCSCSSBCSSSCCBCSCHHHHHHHHTT-TC
T ss_pred cCcccCCCCCEecCCCCceeeCHHHHHHhCcc-CC
Confidence 55667889999999999999999999999984 73
|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|