Citrus Sinensis ID: 038651

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MQRRPPSSSPADSSSLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPPNPQ
cccccEEEcccccHHHHHHHHccccccccccccccHHHHcccccccccccEEEEEEcccccccHHHHHHHHHHccccEEEEEccccccccEEEccccccccccHHEEEEEcccccccEEEccccccHHHHHcccEEccccccccccccccEEEEccccEEEccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccHHHHHHHHccccEEEEEEEcccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHccccccc
ccEEEEEEccccHHHHHHHHccccccEEcccccHHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccccccEEEEccHHcccccHHHHHHHHHHccccEEEEcccccEEEEcccEEEEEcccccccccccEEccccccEEEEEccEEEEcccccccccHHHHHHHcccccccccccccccccccccccccEEEEEcccHHHHHHHcHHHHHHHHHcccccEEEEEEccccHHHHcccccHHHccccccHHHHHHHHHcccccEEccccccEEEEEEEEcccccHHHHHHHHHHHHHHcccccccc
mqrrppssspadssslldhliaepgsrdvgccnelnagyaadgsARARAVGAYVVTFIVGRLSIINAIAgaysenfpAATITALLKAVkpamiggpklsvSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKkailmqpdrivvanglllpnrntsayesyhriyvphgiplksnaheplmlsgnTAVIAEtgdswfncqkdvdvstmLRCEQKNIIFLInngnytieveihdgpynvienwNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGsrvsaannrppnpq
mqrrppssspadssSLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLkwgsrvsaannrppnpq
MQRRppssspadsssLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPPNPQ
*******************LIA**GSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWG**************
MQRRPPSSSPADSSSLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLK***********LSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKW***************
**************SLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPPNPQ
MQRRPPSSSPADSSSLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANN******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRRPPSSSPADSSSLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEFADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPLMLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPPNPQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query324 2.2.26 [Sep-21-2011]
P51851405 Pyruvate decarboxylase is N/A no 0.743 0.595 0.519 2e-83
A2XFI3606 Pyruvate decarboxylase is N/A no 0.759 0.405 0.490 1e-82
Q10MW3605 Pyruvate decarboxylase is no no 0.759 0.406 0.480 7e-81
Q0DHF6605 Pyruvate decarboxylase is no no 0.743 0.398 0.486 5e-80
P28516610 Pyruvate decarboxylase is N/A no 0.743 0.395 0.486 8e-80
A2Y5L9605 Pyruvate decarboxylase is N/A no 0.743 0.398 0.483 3e-79
P51850593 Pyruvate decarboxylase is N/A no 0.743 0.406 0.466 6e-77
A2YQ76587 Pyruvate decarboxylase is N/A no 0.759 0.419 0.456 2e-72
Q0D3D2587 Pyruvate decarboxylase is no no 0.759 0.419 0.453 5e-72
P51845418 Pyruvate decarboxylase is N/A no 0.515 0.399 0.439 1e-46
>sp|P51851|PDC2_PEA Pyruvate decarboxylase isozyme 2 (Fragment) OS=Pisum sativum GN=PDC2 PE=2 SV=1 Back     alignment and function desciption
 Score =  308 bits (790), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 186/358 (51%), Positives = 203/358 (56%), Gaps = 117/358 (32%)

Query: 84  LLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGM---------------- 127
           L KAVKP ++GGPKL V+KA+ AFVELADA GYA AVMPSAKGM                
Sbjct: 48  LNKAVKPVLVGGPKLRVAKASDAFVELADASGYALAVMPSAKGMVPEHHPHFIGTYWGAV 107

Query: 128 -------IVEFADAYIFVESIFNDYSSVGYSLLLNK-KAILMQPDRIVVAN----GLLLP 175
                  IVE ADAY+F   IFNDYSSVGYSLLL K KAI++ PDR+V+AN    G +L 
Sbjct: 108 STAFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVMPDRVVIANGPAFGCVLM 167

Query: 176 N-----------RNTSAYESYHRIYVPHGIPLKSNAHEPL-----------MLSGNTAVI 213
           N            N  AYE+YHRI+VP G PLKS + EPL           MLS  TAVI
Sbjct: 168 NDFLKALAKRLKHNNVAYENYHRIFVPDGTPLKSASKEPLRVNVMFQHIQKMLSSETAVI 227

Query: 214 AETGDSWFNCQK------------------------------------------------ 225
           AETGDSWFNCQK                                                
Sbjct: 228 AETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQV 287

Query: 226 -DVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQN------- 277
              DVSTMLRC QK IIFLINNG YTIEVEIHDGPYNVI+NWNYTGLV+A  N       
Sbjct: 288 TAQDVSTMLRCGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWT 347

Query: 278 -----------AIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPPNPQ 324
                      AI  A   KKD LCFIE IVHKDDT KELL+WGSRVSAAN+RPPNPQ
Sbjct: 348 TKVFCEEELVEAIAKATGPKKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ 405

Pisum sativum (taxid: 3888)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|A2XFI3|PDC2_ORYSI Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2 Back     alignment and function description
>sp|Q10MW3|PDC2_ORYSJ Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1 Back     alignment and function description
>sp|Q0DHF6|PDC1_ORYSJ Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1 Back     alignment and function description
>sp|P28516|PDC1_MAIZE Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PDC1 PE=2 SV=1 Back     alignment and function description
>sp|A2Y5L9|PDC1_ORYSI Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1 Back     alignment and function description
>sp|P51850|PDC1_PEA Pyruvate decarboxylase isozyme 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1 Back     alignment and function description
>sp|A2YQ76|PDC3_ORYSI Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=2 SV=2 Back     alignment and function description
>sp|Q0D3D2|PDC3_ORYSJ Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1 Back     alignment and function description
>sp|P51845|PDC1_TOBAC Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
225439520 605 PREDICTED: pyruvate decarboxylase isozym 0.743 0.398 0.519 4e-85
10732644 575 pyruvate decarboxylase 1 [Vitis vinifera 0.743 0.419 0.519 4e-85
297745869 577 unnamed protein product [Vitis vinifera] 0.743 0.417 0.516 5e-85
29373077 606 pyruvate decarboxylase 1 [Lotus cornicul 0.759 0.405 0.520 7e-85
225434532 607 PREDICTED: pyruvate decarboxylase isozym 0.743 0.397 0.516 8e-85
209167920 482 putative pyruvate decarboxylase 2 [Diosp 0.743 0.5 0.519 2e-84
255579310 607 pyruvate decarboxylase, putative [Ricinu 0.743 0.397 0.516 4e-84
60656563 588 pyruvate decarboxylase 2 [Petunia x hybr 0.759 0.418 0.506 8e-84
449483536 605 PREDICTED: pyruvate decarboxylase isozym 0.743 0.398 0.508 1e-83
15234062 607 pyruvate decarboxylase [Arabidopsis thal 0.759 0.405 0.523 1e-83
>gi|225439520|ref|XP_002272615.1| PREDICTED: pyruvate decarboxylase isozyme 2 [Vitis vinifera] gi|296081122|emb|CBI18254.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  320 bits (821), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 186/358 (51%), Positives = 207/358 (57%), Gaps = 117/358 (32%)

Query: 84  LLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGM---------------- 127
           L KAVKP M+GGPKL V+KA  AFVELADACGY  AVMPSAKG+                
Sbjct: 248 LNKAVKPVMVGGPKLRVAKACEAFVELADACGYPVAVMPSAKGLVPECHPRFIGTYWGAV 307

Query: 128 -------IVEFADAYIFVESIFNDYSSVGYSLLLNK-KAILMQPDRIVVANG-----LLL 174
                  IVE AD+YIF   IFNDYSSVGYSLLL K KAIL+QP+R+V+ NG     +L+
Sbjct: 308 STAFCAEIVESADSYIFAGPIFNDYSSVGYSLLLKKDKAILVQPERVVIGNGPAFGCILM 367

Query: 175 PNR----------NTSAYESYHRIYVPHGIPLKSNAHEPL-----------MLSGNTAVI 213
            +           NT+AYE+YHRIYVP G PL+S+  EPL           MLS  TAVI
Sbjct: 368 KDFLKALSKRLKCNTTAYENYHRIYVPEGQPLRSDPKEPLRVNVLFQHIQKMLSSETAVI 427

Query: 214 AETGDSWFNCQK------------------------------------------------ 225
           AETGDSWFNCQK                                                
Sbjct: 428 AETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAVPNKRVISCIGDGSFQV 487

Query: 226 -DVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQ-------- 276
              DVSTM+RCEQ+ IIFLINNG YTIEVEIHDGPYNVI+NWNYTGLV+A          
Sbjct: 488 TAQDVSTMIRCEQRTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGKCWT 547

Query: 277 ----------NAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPPNPQ 324
                     NAIETA   KKDC CFIE I HKDDT KELL+WGSRVSAAN+RPPNPQ
Sbjct: 548 TKVVCEEDLINAIETATGSKKDCFCFIEVIAHKDDTSKELLEWGSRVSAANSRPPNPQ 605

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|10732644|gb|AAG22488.1|AF195868_1 pyruvate decarboxylase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745869|emb|CBI15925.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|29373077|gb|AAO72533.1| pyruvate decarboxylase 1 [Lotus corniculatus] Back     alignment and taxonomy information
>gi|225434532|ref|XP_002276535.1| PREDICTED: pyruvate decarboxylase isozyme 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|209167920|gb|ACI41984.1| putative pyruvate decarboxylase 2 [Diospyros kaki] Back     alignment and taxonomy information
>gi|255579310|ref|XP_002530500.1| pyruvate decarboxylase, putative [Ricinus communis] gi|223529957|gb|EEF31884.1| pyruvate decarboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|60656563|gb|AAX33299.1| pyruvate decarboxylase 2 [Petunia x hybrida] Back     alignment and taxonomy information
>gi|449483536|ref|XP_004156618.1| PREDICTED: pyruvate decarboxylase isozyme 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15234062|ref|NP_195033.1| pyruvate decarboxylase [Arabidopsis thaliana] gi|3688188|emb|CAA21216.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana] gi|7270254|emb|CAB80024.1| pyruvate decarboxylase-1 (Pdc1) [Arabidopsis thaliana] gi|17979051|gb|AAL49793.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana] gi|21689675|gb|AAM67459.1| putative pyruvate decarboxylase-1 Pdc1 [Arabidopsis thaliana] gi|332660769|gb|AEE86169.1| pyruvate decarboxylase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
TAIR|locus:2123827 607 AT4G33070 [Arabidopsis thalian 0.203 0.108 0.727 9.9e-81
TAIR|locus:2179132 603 AT5G01320 [Arabidopsis thalian 0.203 0.109 0.742 2.6e-78
TAIR|locus:2160170 607 PDC2 "pyruvate decarboxylase-2 0.203 0.108 0.742 2.4e-70
TAIR|locus:2179147 592 PDC3 "pyruvate decarboxylase-3 0.203 0.111 0.712 4.9e-61
POMBASE|SPAC1F8.07c 569 SPAC1F8.07c "pyruvate decarbox 0.206 0.117 0.462 6.3e-28
POMBASE|SPAC186.09572 SPAC186.09 "pyruvate decarboxy 0.203 0.115 0.571 3.6e-27
TIGR_CMR|BA_2486 561 BA_2486 "indolepyruvate decarb 0.203 0.117 0.530 3e-19
UNIPROTKB|O53865 560 kdc "Alpha-keto-acid decarboxy 0.200 0.116 0.584 2e-17
ASPGD|ASPL0000075405 568 pdcA [Emericella nidulans (tax 0.185 0.105 0.639 3.3e-17
UNIPROTKB|G4MWQ1 609 MGG_01892 "Pyruvate decarboxyl 0.231 0.123 0.512 2.6e-16
TAIR|locus:2123827 AT4G33070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 9.9e-81, Sum P(4) = 9.9e-81
 Identities = 48/66 (72%), Positives = 53/66 (80%)

Query:    16 LLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSEN 75
             LLDHL+AEP    +GCCNELNAGYAADG AR+R VGA VVTF VG LS++NAIAGAYSEN
Sbjct:    74 LLDHLMAEPDLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSEN 133

Query:    76 FPAATI 81
              P   I
Sbjct:   134 LPLICI 139
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004737 "pyruvate decarboxylase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016740 "transferase activity" evidence=IEA
GO:0016831 "carboxy-lyase activity" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0001666 "response to hypoxia" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2179132 AT5G01320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160170 PDC2 "pyruvate decarboxylase-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179147 PDC3 "pyruvate decarboxylase-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC1F8.07c SPAC1F8.07c "pyruvate decarboxylase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
POMBASE|SPAC186.09 SPAC186.09 "pyruvate decarboxylase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2486 BA_2486 "indolepyruvate decarboxylase, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|O53865 kdc "Alpha-keto-acid decarboxylase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
ASPGD|ASPL0000075405 pdcA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MWQ1 MGG_01892 "Pyruvate decarboxylase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
PLN02573578 PLN02573, PLN02573, pyruvate decarboxylase 1e-135
PLN02573 578 PLN02573, PLN02573, pyruvate decarboxylase 3e-32
cd07038162 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) b 3e-27
cd02005183 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP 1e-26
COG3961 557 COG3961, COG3961, Pyruvate decarboxylase and relat 1e-22
COG3961557 COG3961, COG3961, Pyruvate decarboxylase and relat 3e-22
TIGR03393 539 TIGR03393, indolpyr_decarb, indolepyruvate decarbo 5e-17
pfam02776172 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate en 7e-10
cd06586154 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding 8e-10
TIGR03394 535 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylp 1e-05
cd07035155 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) bindin 2e-05
TIGR03393539 TIGR03393, indolpyr_decarb, indolepyruvate decarbo 7e-05
pfam00205136 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate en 0.003
>gnl|CDD|215311 PLN02573, PLN02573, pyruvate decarboxylase Back     alignment and domain information 
 Score =  395 bits (1016), Expect = e-135
 Identities = 185/365 (50%), Positives = 205/365 (56%), Gaps = 121/365 (33%)

Query: 79  ATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGM----------- 127
           A    L KAVKP ++GGPKL V+KA  AFVELADA GY  AVMPSAKG+           
Sbjct: 216 AAAEFLNKAVKPVLVGGPKLRVAKACKAFVELADASGYPVAVMPSAKGLVPEHHPHFIGT 275

Query: 128 ------------IVEFADAYIFVESIFNDYSSVGYSLLLNK-KAILMQPDRIVVANGLLL 174
                       IVE ADAY+F   IFNDYSSVGYSLLL K KAI++QPDR+ + NG   
Sbjct: 276 YWGAVSTPFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVQPDRVTIGNGPAF 335

Query: 175 P---------------NRNTSAYESYHRIYVPHGIPLKSNAHEPL-----------MLSG 208
                            +NT+AYE+Y RI+VP G PLKS   EPL           MLSG
Sbjct: 336 GCVLMKDFLEALAKRVKKNTTAYENYKRIFVPEGEPLKSEPGEPLRVNVLFKHIQKMLSG 395

Query: 209 NTAVIAETGDSWFNCQK------------------------------------------- 225
           +TAVIAETGDSWFNCQK                                           
Sbjct: 396 DTAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQAAPDKRVIACIGD 455

Query: 226 --------DVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQN 277
                   DV  STM+RC QK+IIFLINNG YTIEVEIHDGPYNVI+NWNYTGLV+A  N
Sbjct: 456 GSFQVTAQDV--STMIRCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHN 513

Query: 278 ------------------AIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNR 319
                             AI TA  EKKDCLCFIE IVHKDDT KELL+WGSRVSAAN+R
Sbjct: 514 GEGKCWTAKVRTEEELIEAIATATGEKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSR 573

Query: 320 PPNPQ 324
           PPNPQ
Sbjct: 574 PPNPQ 578

Length = 578
>gnl|CDD|215311 PLN02573, PLN02573, pyruvate decarboxylase Back     alignment and domain information
>gnl|CDD|132921 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>gnl|CDD|238963 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|132434 TIGR03393, indolpyr_decarb, indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>gnl|CDD|217224 pfam02776, TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|132435 TIGR03394, indol_phenyl_DC, indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>gnl|CDD|132918 cd07035, TPP_PYR_POX_like, Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>gnl|CDD|132434 TIGR03393, indolpyr_decarb, indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>gnl|CDD|215786 pfam00205, TPP_enzyme_M, Thiamine pyrophosphate enzyme, central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 324
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 100.0
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 100.0
PLN02573578 pyruvate decarboxylase 100.0
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 100.0
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 100.0
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 100.0
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 100.0
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 100.0
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK11269591 glyoxylate carboligase; Provisional 100.0
PRK08617552 acetolactate synthase; Reviewed 100.0
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK08322547 acetolactate synthase; Reviewed 100.0
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 100.0
KOG1184561 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 100.0
PRK05858542 hypothetical protein; Provisional 100.0
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 100.0
PLN02470585 acetolactate synthase 100.0
PRK08155564 acetolactate synthase catalytic subunit; Validated 100.0
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 100.0
CHL00099585 ilvB acetohydroxyacid synthase large subunit 100.0
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 100.0
PRK08199557 thiamine pyrophosphate protein; Validated 100.0
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 100.0
PRK07064544 hypothetical protein; Provisional 100.0
PRK08273597 thiamine pyrophosphate protein; Provisional 100.0
PRK12474518 hypothetical protein; Provisional 100.0
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 100.0
PRK06457549 pyruvate dehydrogenase; Provisional 100.0
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 100.0
PRK09124574 pyruvate dehydrogenase; Provisional 100.0
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 100.0
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 100.0
PRK06154565 hypothetical protein; Provisional 100.0
PRK08611576 pyruvate oxidase; Provisional 100.0
PRK07524535 hypothetical protein; Provisional 100.0
PRK07586514 hypothetical protein; Validated 100.0
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 100.0
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 100.0
PRK06546578 pyruvate dehydrogenase; Provisional 100.0
KOG4166675 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PRK08266542 hypothetical protein; Provisional 100.0
PRK08327569 acetolactate synthase catalytic subunit; Validated 100.0
PRK06112578 acetolactate synthase catalytic subunit; Validated 100.0
PRK07092530 benzoylformate decarboxylase; Reviewed 100.0
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 100.0
KOG1185571 consensus Thiamine pyrophosphate-requiring enzyme 100.0
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
COG3962617 Acetolactate synthase [Amino acid transport and me 100.0
COG3960592 Glyoxylate carboligase [General function predictio 100.0
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 100.0
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 99.89
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 99.87
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 99.86
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 99.81
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.79
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.78
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.77
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 99.77
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.76
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 99.74
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 99.73
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 99.73
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.72
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.72
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.7
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.68
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.68
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.66
PRK06163202 hypothetical protein; Provisional 99.66
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.64
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 99.63
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.59
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 99.58
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.57
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.56
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.55
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.54
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.54
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.53
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.51
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.51
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.46
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.46
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.46
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.41
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.38
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.33
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.28
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.28
TIGR00315162 cdhB CO dehydrogenase/acetyl-CoA synthase complex, 99.21
PRK00945171 acetyl-CoA decarbonylase/synthase complex subunit 99.11
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 99.01
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 98.91
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 98.86
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 98.8
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 98.79
PRK05899 624 transketolase; Reviewed 98.55
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 98.49
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 97.93
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 97.9
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 97.83
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 97.82
COG1880170 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon 97.81
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 97.14
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 97.0
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 96.97
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 96.94
PF02552167 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA sy 96.51
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 96.45
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 96.44
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 96.26
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 96.17
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 96.08
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 96.08
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 95.96
PRK08366390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 95.85
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 95.8
PLN02790 654 transketolase 95.56
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 95.45
PRK12753 663 transketolase; Reviewed 95.08
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 95.01
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 94.91
PRK12754 663 transketolase; Reviewed 94.81
PTZ00089 661 transketolase; Provisional 94.77
PRK09622407 porA pyruvate flavodoxin oxidoreductase subunit al 94.73
PRK08367394 porA pyruvate ferredoxin oxidoreductase subunit al 94.72
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and relate 94.45
TIGR021761165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 93.55
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 93.53
PF02233463 PNTB: NAD(P) transhydrogenase beta subunit; InterP 92.26
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 91.86
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 91.38
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 91.04
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 90.83
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [E 89.63
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 88.95
PRK09444462 pntB pyridine nucleotide transhydrogenase; Provisi 85.61
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 85.61
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 84.14
COG0552340 FtsY Signal recognition particle GTPase [Intracell 82.77
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 82.67
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 82.65
KOG0225394 consensus Pyruvate dehydrogenase E1, alpha subunit 82.53
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 81.93
KOG0780 483 consensus Signal recognition particle, subunit Srp 81.77
cd02761415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the 80.68
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 80.47
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 80.12
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-63  Score=502.10  Aligned_cols=288  Identities=25%  Similarity=0.323  Sum_probs=239.0

Q ss_pred             CcCCCC-chHHHHhhhcCCCCeEeecCchHHHHHHHHHHhhhcC-ceEEEEeCCcchHHHHHHHHHHhhcCCcchhhhh-
Q 038651            7 SSSPAD-SSSLLDHLIAEPGSRDVGCCNELNAGYAADGSARARA-VGAYVVTFIVGRLSIINAIAGAYSENFPAATITA-   83 (324)
Q Consensus         7 ~~~pG~-~~~l~dal~~~~~i~~i~~rhE~~A~~aAdgYaR~tg-~gv~~~t~GpG~~N~~tgla~A~~d~~Pvl~It~-   83 (324)
                      ..+||+ ++++||+|+++ +|++|.+||||+|+||||||||+|| +|||++|+|||+||++|||++|+.|++|||+||+ 
T Consensus        21 FGiPG~~i~~~~dal~~~-~i~~I~~RHEq~Aa~mAdgyar~TGkpgV~~~tsGPGatN~~tgla~A~~d~~Pll~itGq   99 (550)
T COG0028          21 FGIPGGSILPLYDALYDS-GIRHILVRHEQGAAFAADGYARATGKPGVCLVTSGPGATNLLTGLADAYMDSVPLLAITGQ   99 (550)
T ss_pred             EeCCCccHHHHHHHHHhC-CCcEEEeccHHHHHHHHHHHHHHcCCCEEEEECCCCcHHHHHHHHHHHHhcCCCEEEEeCC
Confidence            468999 99999999986 8999999999999999999999999 9999999999999999999999999999999963 


Q ss_pred             --------------------------------------------------------------------------------
Q 038651           84 --------------------------------------------------------------------------------   83 (324)
Q Consensus        84 --------------------------------------------------------------------------------   83 (324)
                                                                                                      
T Consensus       100 v~~~~~g~~afQe~D~~~l~~p~tk~~~~v~~~~~ip~~i~~Af~~A~sgrpGpv~i~iP~Dv~~~~~~~~~~~~~~~~~  179 (550)
T COG0028         100 VPTSLIGTDAFQEVDQVGLFRPITKYNFEVRSPEDIPEVVARAFRIALSGRPGPVVVDLPKDVLAAEAEEPGPEPAILPP  179 (550)
T ss_pred             ccccccCcchhhhcchhhHhhhhheeEEEeCCHHHHHHHHHHHHHHHhcCCCceEEEEcChhHhhccccccccccccccc
Confidence                                                                                            


Q ss_pred             -----------------hhcCCCcEEEECCCCCccchHHHHHHHHHHhCCcEEecCCCCCc-------------------
Q 038651           84 -----------------LLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGM-------------------  127 (324)
Q Consensus        84 -----------------L~~AkrPvIl~G~g~~~~~a~~~l~~lae~l~~Pv~tt~~gkg~-------------------  127 (324)
                                       |++||||+|++|+|+.++++.+++++|+|++++||++|++|||+                   
T Consensus       180 ~~p~~~~~~~i~~aa~~L~~AkrPvIl~G~G~~~a~a~~~l~~lae~~~~Pv~~t~~gkg~~p~~hp~~lG~~g~~g~~~  259 (550)
T COG0028         180 YRPAPPPPEAIRKAAELLAEAKRPVILAGGGVRRAGASEELRELAEKLGAPVVTTLMGKGAVPEDHPLSLGMLGMHGTKA  259 (550)
T ss_pred             CCCCCCcHHHHHHHHHHHHhCCCCEEEECCCccccccHHHHHHHHHHHCCCEEEccCcCccCCCCCccccccccccccHH
Confidence                             89999999999999999999999999999999999999999998                   


Q ss_pred             ---cccCCcEEEEEcCccCCcccccccccCCCC-EEEEcCCccccccCCChh------h---HHHHHH-------Hhhhh
Q 038651          128 ---IVEFADAYIFVESIFNDYSSVGYSLLLNKK-AILMQPDRIVVANGLLLP------N---RNTSAY-------ESYHR  187 (324)
Q Consensus       128 ---~l~~aDlvl~lG~~~~~~~t~~~~~~~~~~-iI~id~d~~~i~~~~~~~------d---~l~~~~-------~~~~~  187 (324)
                         ++++|||||+||+||+|+.++ |..+.++. +||||+|+.+++ ++...      |   +|+++.       ..|..
T Consensus       260 a~~~~~~aDlll~vG~rf~~~~~~-~~~f~~~~~ii~iDidp~ei~-k~~~~~~~i~gD~~~~l~~L~~~l~~~~~~~~~  337 (550)
T COG0028         260 ANEALEEADLLLAVGARFDDRVTG-YSGFAPPAAIIHIDIDPAEIG-KNYPVDVPIVGDAKATLEALLEELKPERAAWLE  337 (550)
T ss_pred             HHHHhhcCCEEEEecCCCcccccc-hhhhCCcCCEEEEeCChHHhC-CCCCCCeeEeccHHHHHHHHHHhhhhcchHHHH
Confidence               678999999999999999888 66555443 999999999998 32222      2   233221       11210


Q ss_pred             -------ccC-----C----CCCCC-------C-------------------------CCCCCCE---------------
Q 038651          188 -------IYV-----P----HGIPL-------K-------------------------SNAHEPL---------------  204 (324)
Q Consensus       188 -------~~~-----~----~~~~~-------~-------------------------~~~~~~l---------------  204 (324)
                             .+.     .    ...+.       .                         ..|...+               
T Consensus       338 ~~~~~~~~~~~~~~~~~~~~~~~p~~v~~~l~~~~~~daiv~~d~G~~~~w~a~~~~~~~p~~~~~s~~~GtMG~glPaA  417 (550)
T COG0028         338 ELLEARAAYRDLALEELADDGIKPQYVIKVLRELLPDDAIVVTDVGQHQMWAARYFDFYRPRRFLTSGGLGTMGFGLPAA  417 (550)
T ss_pred             HHHHHHHhhhhhhhhccCCCccCHHHHHHHHHHhCCCCeEEEeCCcHHHHHHHHhcccCCCCcEEcCCCCccccchHHHH
Confidence                   000     0    00000       0                         0111111               


Q ss_pred             ----EecCCCeEEEecCchHHhhhHHHHHHHHHHhCCCeEEEEEeCCchhhhhhhh----CC--CCCCCCCCCHHHHHHH
Q 038651          205 ----MLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIH----DG--PYNVIENWNYTGLVEA  274 (324)
Q Consensus       205 ----~~~~~~~vv~d~G~~~~~~~~~qEL~Ta~r~~lpviivV~NN~~yg~~~~~~----~~--~~~~l~~~df~~lA~a  274 (324)
                          ...|++.|++.+||++|.|+ .|||+|++||++|+++||+||++|++++..|    ..  ...++.++.|+++||+
T Consensus       418 IGAkla~P~r~Vv~i~GDG~F~m~-~qEL~Ta~r~~lpv~ivv~nN~~~g~v~~~q~~~~~~~~~~~~~~~~~f~klAea  496 (550)
T COG0028         418 IGAKLAAPDRKVVAIAGDGGFMMN-GQELETAVRYGLPVKIVVLNNGGYGMVRQWQELFYGGRYSGTDLGNPDFVKLAEA  496 (550)
T ss_pred             HHHHhhCCCCcEEEEEcccHHhcc-HHHHHHHHHhCCCEEEEEEECCccccchHHHHHhcCCCcceeecCCccHHHHHHH
Confidence                56788999999999999998 4999999999999999999999999999876    22  2356665559999999


Q ss_pred             HHH-------------HHHHhHHhCCCCeEEEEEEecCC
Q 038651          275 FQN-------------AIETAAVEKKDCLCFIEAIVHKD  300 (324)
Q Consensus       275 ~G~-------------al~~a~~~~~~~p~lIeV~id~~  300 (324)
                      ||+             +|++|+  ++++|+||||.+|++
T Consensus       497 ~G~~g~~v~~~~el~~al~~al--~~~~p~lidv~id~~  533 (550)
T COG0028         497 YGAKGIRVETPEELEEALEEAL--ASDGPVLIDVVVDPE  533 (550)
T ss_pred             cCCeeEEeCCHHHHHHHHHHHH--hCCCCEEEEEEecCc
Confidence            999             888885  899999999999998

>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>COG1880 CdhB CO dehydrogenase/acetyl-CoA synthase epsilon subunit [Energy production and conversion] Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PF02552 CO_dh: CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit; InterPro: IPR003704 Carbon monoxide dehydrogenase (Cdh) from Methanosarcina mazei (Methanosarcina frisia) Go1 is a Ni2+-, Fe2+-, and S2-containing alpha2beta2 heterotetramer [] Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>PF02233 PNTB: NAD(P) transhydrogenase beta subunit; InterPro: IPR012136 NAD(P) transhydrogenase catalyses the transfer of reducing equivalents between NAD(H) and NADP(H), coupled to the translocation of protons across a membrane [] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
2wva_A568 Structural Insights Into The Pre-Reaction State Of 3e-29
3oe1_A568 Pyruvate Decarboxylase Variant Glu473asp From Z. Mo 1e-28
1zpd_A568 Pyruvate Decarboxylase From Zymomonas Mobilis Lengt 2e-28
2vbi_A566 Holostructure Of Pyruvate Decarboxylase From Acetob 1e-25
1ovm_A 552 Crystal Structure Of Indolepyruvate Decarboxylase F 2e-12
1ovm_A552 Crystal Structure Of Indolepyruvate Decarboxylase F 3e-04
2vbf_A 570 The Holostructure Of The Branched-Chain Keto Acid D 6e-12
2vbf_A570 The Holostructure Of The Branched-Chain Keto Acid D 6e-05
2vjy_A 563 Pyruvate Decarboxylase From Kluyveromyces Lactis In 2e-10
2vjy_A563 Pyruvate Decarboxylase From Kluyveromyces Lactis In 1e-04
2w93_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 2e-09
2w93_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 4e-04
2vk8_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 2e-09
2vk8_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 3e-04
1qpb_A 563 Pyruvate Decarboyxlase From Yeast (Form B) Complexe 2e-09
1qpb_A563 Pyruvate Decarboyxlase From Yeast (Form B) Complexe 2e-04
1pvd_A 555 Crystal Structure Of The Thiamin Diphosphate Depend 2e-09
1pvd_A555 Crystal Structure Of The Thiamin Diphosphate Depend 2e-04
1pyd_A 556 Catalytic Centers In The Thiamin Diphosphate Depend 2e-09
1pyd_A556 Catalytic Centers In The Thiamin Diphosphate Depend 2e-04
2vk1_A 563 Crystal Structure Of The Saccharomyces Cerevisiae P 2e-09
2vk1_A563 Crystal Structure Of The Saccharomyces Cerevisiae P 1e-04
>pdb|2WVA|A Chain A, Structural Insights Into The Pre-Reaction State Of Pyruvate Decarboxylase From Zymomonas Mobilis Length = 568 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (314), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 106/356 (29%), Positives = 148/356 (41%), Gaps = 126/356 (35%)
Query: 89  KPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGMIVEF----------------- 131
           K A++ G KL  + A  A V+ ADA G A A M +AK    E                  
Sbjct: 211 KVAVLVGSKLRAAGAEEAAVKFADALGGAVATMAAAKSFFPEENPHYIGTSWGEVSYPGV 270
Query: 132 ------ADAYIFVESIFNDYSSVGYSLLLNKKAILMQPDRIVVANGLLLPN--------- 176
                 ADA I +  +FNDYS+ G++ + + K +++   R VV NG+  P+         
Sbjct: 271 EKTMKEADAVIALAPVFNDYSTTGWTDIPDPKKLVLAEPRSVVVNGIRFPSVHLKDYLTR 330
Query: 177 ------RNTSA---YESYHRIYVPHGIPLKSNAHEPL-----------MLSGNTAVIAET 216
                 + T A   ++S +   +    P   +A  PL           +L+ NT VIAET
Sbjct: 331 LAQKVSKKTGALDFFKSLNAGELKKAAPADPSA--PLVNAEIARQVEALLTPNTTVIAET 388
Query: 217 GDSWFNCQK-------------------------------------------------DV 227
           GDSWFN Q+                                                   
Sbjct: 389 GDSWFNAQRMKLPNGARVEYEMQWGHIGWSVPAAFGYAVGAPERRNILMVGDGSFQLTAQ 448
Query: 228 DVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQ----------- 276
           +V+ M+R +   IIFLINN  YTIEV IHDGPYN I+NW+Y GL+E F            
Sbjct: 449 EVAQMVRLKLPVIIFLINNYGYTIEVMIHDGPYNNIKNWDYAGLMEVFNGNGGYDSGAGK 508
Query: 277 -----------NAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPP 321
                       AI+  A+   D    IE  + ++D  +EL+KWG RV+AAN+R P
Sbjct: 509 GLKAKTGGELAEAIKV-ALANTDGPTLIECFIGREDCTEELVKWGKRVAAANSRKP 563
>pdb|3OE1|A Chain A, Pyruvate Decarboxylase Variant Glu473asp From Z. Mobilis In Complex With Reaction Intermediate 2-Lactyl-Thdp Length = 568 Back     alignment and structure
>pdb|1ZPD|A Chain A, Pyruvate Decarboxylase From Zymomonas Mobilis Length = 568 Back     alignment and structure
>pdb|2VBI|A Chain A, Holostructure Of Pyruvate Decarboxylase From Acetobacter Pasteurianus Length = 566 Back     alignment and structure
>pdb|1OVM|A Chain A, Crystal Structure Of Indolepyruvate Decarboxylase From Enterobacter Cloacae Length = 552 Back     alignment and structure
>pdb|1OVM|A Chain A, Crystal Structure Of Indolepyruvate Decarboxylase From Enterobacter Cloacae Length = 552 Back     alignment and structure
>pdb|2VBF|A Chain A, The Holostructure Of The Branched-Chain Keto Acid Decarboxylase (Kdca) From Lactococcus Lactis Length = 570 Back     alignment and structure
>pdb|2VBF|A Chain A, The Holostructure Of The Branched-Chain Keto Acid Decarboxylase (Kdca) From Lactococcus Lactis Length = 570 Back     alignment and structure
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In Complex With The Substrate Analogue Methyl Acetylphosphonate Length = 563 Back     alignment and structure
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In Complex With The Substrate Analogue Methyl Acetylphosphonate Length = 563 Back     alignment and structure
>pdb|2W93|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With The Surrogate Pyruvamide Length = 563 Back     alignment and structure
>pdb|2W93|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With The Surrogate Pyruvamide Length = 563 Back     alignment and structure
>pdb|2VK8|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|2VK8|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant E477q In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|1QPB|A Chain A, Pyruvate Decarboyxlase From Yeast (Form B) Complexed With Pyruvamide Length = 563 Back     alignment and structure
>pdb|1QPB|A Chain A, Pyruvate Decarboyxlase From Yeast (Form B) Complexed With Pyruvamide Length = 563 Back     alignment and structure
>pdb|1PVD|A Chain A, Crystal Structure Of The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase From The Yeast Saccharomyces Cerevisiae At 2.3 Angstroms Resolution Length = 555 Back     alignment and structure
>pdb|1PVD|A Chain A, Crystal Structure Of The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase From The Yeast Saccharomyces Cerevisiae At 2.3 Angstroms Resolution Length = 555 Back     alignment and structure
>pdb|1PYD|A Chain A, Catalytic Centers In The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase At 2.4 Angstroms Resolution Length = 556 Back     alignment and structure
>pdb|1PYD|A Chain A, Catalytic Centers In The Thiamin Diphosphate Dependent Enzyme Pyruvate Decarboxylase At 2.4 Angstroms Resolution Length = 556 Back     alignment and structure
>pdb|2VK1|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant D28a In Complex With Its Substrate Length = 563 Back     alignment and structure
>pdb|2VK1|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Pyruvate Decarboxylase Variant D28a In Complex With Its Substrate Length = 563 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 2e-46
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 2e-23
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 5e-34
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 1e-24
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 1e-21
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 3e-33
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 1e-24
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 6e-22
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 3e-32
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 8e-24
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 4e-19
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 2e-27
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 8e-24
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 1e-17
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 1e-21
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 7e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
 Score =  163 bits (416), Expect = 2e-46
 Identities = 60/355 (16%), Positives = 101/355 (28%), Gaps = 119/355 (33%)

Query: 78  AATITALLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKG----------- 126
           +    +L  A KP +I G ++          +           +   K            
Sbjct: 219 SKIEESLKNAQKPVVIAGHEVISFGLEKTVTQFVSETKLPITTLNFGKSAVDESLPSFLG 278

Query: 127 ------------MIVEFADAYIFVESIFNDYSSVGYSLLL-NKKAILMQPDRIVVANG-- 171
                         VE AD  + +     D S+  ++  L   K I +  D  ++ N   
Sbjct: 279 IYNGKLSEISLKNFVESADFILMLGVKLTDSSTGAFTHHLDENKMISLNIDEGIIFNKVV 338

Query: 172 --------------LLLPNRNTSAYESYHRIYVPHGIPLKSNAHEPL------MLSGNTA 211
                         L          +  +  ++P   PL     + L      +   N  
Sbjct: 339 EDFDFRAVVSSLSELKGIEYEGQYIDKQYEEFIPSSAPLS---QDRLWQAVESLTQSNET 395

Query: 212 VIAETGDSWFNCQ-----------------------------------KDV--------- 227
           ++AE G S+F                                                  
Sbjct: 396 IVAEQGTSFFGASTIFLKSNSRFIGQPLWGSIGYTFPAALGSQIADKESRHLLFIGDGSL 455

Query: 228 -----DVSTMLRCEQKNIIFLINNGNYTIEVEIHDG--PYNVIENWNYTGLVEAF----- 275
                ++   +R +   I F+INN  YT+E EIH     YN I  WNY+ L E F     
Sbjct: 456 QLTVQELGLSIREKLNPICFIINNDGYTVEREIHGPTQSYNDIPMWNYSKLPETFGATED 515

Query: 276 -------------QNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAAN 317
                         + ++  A    + + +IE ++ K+D  K L K G   +  N
Sbjct: 516 RVVSKIVRTENEFVSVMKE-AQADVNRMYWIELVLEKEDAPKLLKKMGKLFAEQN 569
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 100.0
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 100.0
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 100.0
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 100.0
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 100.0
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 100.0
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 100.0
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 100.0
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 100.0
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 100.0
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 100.0
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 100.0
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 100.0
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 100.0
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 100.0
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 100.0
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 100.0
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 100.0
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 100.0
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 100.0
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 100.0
3cf4_G170 Acetyl-COA decarboxylase/synthase epsilon subunit; 99.53
1ytl_A174 Acetyl-COA decarboxylase/synthase complex epsilon 99.52
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 99.04
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 98.85
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 98.69
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 98.63
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 98.57
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 98.52
3uk1_A 711 Transketolase; structural genomics, seattle struct 98.49
3l84_A 632 Transketolase; TKT, structural genomics, center fo 98.47
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 98.46
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 98.44
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 98.37
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 98.36
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 98.36
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 98.3
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 98.29
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 98.29
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 98.29
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 98.21
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 98.04
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 97.44
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 97.27
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 96.31
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 96.3
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 91.47
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 90.79
1pno_A180 NAD(P) transhydrogenase subunit beta; nucleotide b 87.93
1d4o_A184 NADP(H) transhydrogenase; nucleotide-binding fold, 87.65
2fsv_C203 NAD(P) transhydrogenase subunit beta; NAD(P) trans 87.01
1djl_A207 Transhydrogenase DIII; rossmann fold dinucleotide 86.94
2bru_C186 NAD(P) transhydrogenase subunit beta; paramagnetic 82.82
1e2b_A106 Enzyme IIB-cellobiose; phosphotransferase system, 82.73
1tvm_A113 PTS system, galactitol-specific IIB component; pho 80.58
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-54  Score=438.34  Aligned_cols=312  Identities=40%  Similarity=0.625  Sum_probs=255.3

Q ss_pred             CcCCCC-chHHHHhhhcCCCCeEeecCchHHHHHHHHHHhhhcCceEEEEeCCcchHHHHHHHHHHhhcCCcchhhhh--
Q 038651            7 SSSPAD-SSSLLDHLIAEPGSRDVGCCNELNAGYAADGSARARAVGAYVVTFIVGRLSIINAIAGAYSENFPAATITA--   83 (324)
Q Consensus         7 ~~~pG~-~~~l~dal~~~~~i~~i~~rhE~~A~~aAdgYaR~tg~gv~~~t~GpG~~N~~tgla~A~~d~~Pvl~It~--   83 (324)
                      ..+||+ +++|+|+|.++++|++|.+|||++|+||||||||+||+|||++|+|||++|++|||++||.|++|||+||+  
T Consensus        22 fg~PG~~~~~l~~al~~~~~i~~i~~~~E~~Aa~~A~Gyar~tg~~v~~~TsGpG~~N~~~gia~A~~~~vPll~itg~~  101 (568)
T 2wvg_A           22 FAVAGDYNLVLLDNLLLNKNMEQVYCCNELNCGFSAEGYARAKGAAAAVVTYSVGALSAFDAIGGAYAENLPVILISGAP  101 (568)
T ss_dssp             EECCCTTTHHHHHHHHTCTTSEEEECSSHHHHHHHHHHHHHHHSCEEEEECTTTTHHHHHHHHHHHHHTTCCEEEEEEEC
T ss_pred             EeCCCCccHHHHHHHhccCCceEeccCcHHHHHHHHHHHHHhhCCeEEEEeCCCCHHHHHHHHHHHhhhCCCEEEEeCCC
Confidence            368999 99999999876689999999999999999999999999999999999999999999999999999999942  


Q ss_pred             --------------------------------------------------------------------------------
Q 038651           84 --------------------------------------------------------------------------------   83 (324)
Q Consensus        84 --------------------------------------------------------------------------------   83 (324)
                                                                                                      
T Consensus       102 ~~~~~~~~~~~~~~~g~~~~~d~~~~~~~~tk~~~~v~~~~~~~~~l~~A~~~A~~~~GPV~l~iP~dv~~~~~~~~~~~  181 (568)
T 2wvg_A          102 NNNDHAAGHVLHHALGKTDYHYQLEMAKNITAAAEAIYTPEEAPAKIDHVIKTALREKKPVYLEIACNIASMPCAAPGPA  181 (568)
T ss_dssp             CGGGTTTTCBCTTSCSSSCCCHHHHHHTTSCSCEEEECSGGGHHHHHHHHHHHHHHHTCCEEEEEEGGGTTSEECEECCT
T ss_pred             ChhHhccCcceeeeccccchHHHHHHHHhhEeEEEEeCCHHHHHHHHHHHHHHHHhCCCCEEEEechhHhcCcccCCCcc
Confidence                                                                                            


Q ss_pred             ------------------------hhcCCCcEEEECCCCCccchHHHHHHHHHHhCCcEEecCCCCCc------------
Q 038651           84 ------------------------LLKAVKPAMIGGPKLSVSKATIAFVELADACGYAFAVMPSAKGM------------  127 (324)
Q Consensus        84 ------------------------L~~AkrPvIl~G~g~~~~~a~~~l~~lae~l~~Pv~tt~~gkg~------------  127 (324)
                                              |++||||+|++|+|+.++++.+++++|+|++|+||++|++|||+            
T Consensus       182 ~~~~~~~~~~~~~~~~~i~~~~~~l~~a~rpvil~G~g~~~~~a~~~l~~lae~~~~Pv~~t~~~kg~~~~~~p~~~G~~  261 (568)
T 2wvg_A          182 SALFNDEASDEASLNAAVEETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFADALGGAVATMAAAKSFFPEENPHYIGTS  261 (568)
T ss_dssp             HHHHCCCCCCHHHHHHHHHHHHHHHTTCCCEEEEECTTTTTTTCHHHHHHHHHHHCCEEEEEGGGTTSSCTTSTTEEEEE
T ss_pred             cccccCCCCCccccHHHHHHHHHHHHhCCCCEEEECccccccchHHHHHHHHHHhCCCEEEchhcCccCCCCCCceeccc
Confidence                                    67899999999999999999999999999999999999999986            


Q ss_pred             -----------cccCCcEEEEEcCccCCcccccccccCCCC-EEEEcCCccccccCCChh-----hHHHHHHH-------
Q 038651          128 -----------IVEFADAYIFVESIFNDYSSVGYSLLLNKK-AILMQPDRIVVANGLLLP-----NRNTSAYE-------  183 (324)
Q Consensus       128 -----------~l~~aDlvl~lG~~~~~~~t~~~~~~~~~~-iI~id~d~~~i~~~~~~~-----d~l~~~~~-------  183 (324)
                                 ++++||+||++|++++++.++.|....+.. +||||+|+.+++ +..+.     ++|+++.+       
T Consensus       262 ~g~~~~~~~~~~l~~aDlvl~iG~~~~~~~~~~~~~~~~~~~~i~id~d~~~~~-~~~~~~~~~~~~l~~L~~~l~~~~~  340 (568)
T 2wvg_A          262 WGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPDPKKLVLAEPRSVVVN-GIRFPSVHLKDYLTRLAQKVSKKTG  340 (568)
T ss_dssp             CGGGSCTTHHHHHHHCSEEEEESCCCBTTTTTTTTCCCCTTTEEEECSSEEEET-TEEEESCCHHHHHHHHHHHCCCCCH
T ss_pred             cCCcCCHHHHHHHHhCCEEEEECCCcccccccccccCCCCCcEEEEeCChhhcC-CeecCCCCHHHHHHHHHHhcccccc
Confidence                       457899999999999998887776554444 999999999987 33222     34443321       


Q ss_pred             h---hhhccC-C---C-----CCCC----------CCCCCCC------------------------E-------------
Q 038651          184 S---YHRIYV-P---H-----GIPL----------KSNAHEP------------------------L-------------  204 (324)
Q Consensus       184 ~---~~~~~~-~---~-----~~~~----------~~~~~~~------------------------l-------------  204 (324)
                      .   |.+... .   .     ....          ...+.+.                        +             
T Consensus       341 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~iv~~d~G~~~~~~~~~~~~~~~~~~~~~~~g~~G~~l~  420 (568)
T 2wvg_A          341 ALDFFKSLNAGELKKAAPADPSAPLVNAEIARQVEALLTPNTTVIAETGDSWFNAQRMKLPNGARVEYEMQWGHIGWSVP  420 (568)
T ss_dssp             HHHHHHHTTCCSCCCCCCCCTTSBCCHHHHHHHHHTTCCTTEEEEECSSHHHHHHHTCCCCTTCEEECCTTTCCTTTHHH
T ss_pred             chhhhhhhhhhcccccccCCCCCccCHHHHHHHHHHhCCCCCEEEEcCcHHHHHHhhcccCCCCeEEeCCCcchhhhHHH
Confidence            1   111100 0   0     0000          0000000                        0             


Q ss_pred             ------EecCCCeEEEecCchHHhhhHHHHHHHHHHhCCCeEEEEEeCCchhhhhhhhCCCCCCCCCCCHHHHHHHHH--
Q 038651          205 ------MLSGNTAVIAETGDSWFNCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAFQ--  276 (324)
Q Consensus       205 ------~~~~~~~vv~d~G~~~~~~~~~qEL~Ta~r~~lpviivV~NN~~yg~~~~~~~~~~~~l~~~df~~lA~a~G--  276 (324)
                            +..|+..|++.+||++|.+. +|||+|++++++|+++||+||++|++++.+++..|.+++++||.++|++||  
T Consensus       421 ~A~G~ala~~~~~vv~i~GDGs~~~~-~~el~ta~~~~l~~~ivv~NN~~~~~~~~~~~~~~~~~~~~d~~~~a~a~G~~  499 (568)
T 2wvg_A          421 AAFGYAVGAPERRNILMVGDGSFQLT-AQEVAQMVRLKLPVIIFLINNYGYTIEVMIHDGPYNNIKNWDYAGLMEVFNGN  499 (568)
T ss_dssp             HHHHHHHHCTTSEEEEEEEHHHHHHH-GGGHHHHHHTTCCCEEEEEECSSCHHHHTTSCCGGGCCCCCCHHHHHHHHHCT
T ss_pred             HHHHHHHhCCCCcEEEEEcChhHhcc-HHHHHHHHHcCCCcEEEEEECCcceEeeeeccCCCcCCCCCCHHHHHHHhCCC
Confidence                  33467888888899988876 599999999999999999999999999987766677888899999999998  


Q ss_pred             --------H------------HHHHhHHhCC-CCeEEEEEEecCCCCcHHHHHHHHHhhhhcCCCCC
Q 038651          277 --------N------------AIETAAVEKK-DCLCFIEAIVHKDDTGKELLKWGSRVSAANNRPPN  322 (324)
Q Consensus       277 --------~------------al~~a~~~~~-~~p~lIeV~id~~~~~~~~~~~~~~~~~~~~~~~~  322 (324)
                              -            +|++++  +. ++|+||||++++++.++.+.++.+.++..++.+|+
T Consensus       500 ~~~~~~~~~~~~v~~~~el~~al~~a~--~~~~gp~liev~~~~~~~~~~~~~~~~~~~~~~~~~~~  564 (568)
T 2wvg_A          500 GGYDSGAGKGLKAKTGGELAEAIKVAL--ANTDGPTLIECFIGREDCTEELVKWGKRVAAANSRKPV  564 (568)
T ss_dssp             TSSSCCCCEEEEESBHHHHHHHHHHHH--HCCSSCEEEEEECCTTCCCHHHHHHHHHHHHHHHCCCC
T ss_pred             cccccCCcceEEeCCHHHHHHHHHHHH--hcCCCcEEEEEEcCccccCHHHHHHHHHhHhhccCCcc
Confidence                    2            666664  44 89999999999999999999999999888776654
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1ytl_A Acetyl-COA decarboxylase/synthase complex epsilon 2; structural genomics; 1.80A {Archaeoglobus fulgidus} SCOP: c.31.1.6 Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1pno_A NAD(P) transhydrogenase subunit beta; nucleotide binding fold, oxidoreductase; HET: NAP; 2.10A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1pnq_A* 1xlt_C* 2oor_C* 1ptj_C* 2oo5_C* Back     alignment and structure
>1d4o_A NADP(H) transhydrogenase; nucleotide-binding fold, protein-NADP(H) complex, inverted binding of NADP(H), oxidoreductase; HET: NAP; 1.21A {Bos taurus} SCOP: c.31.1.4 Back     alignment and structure
>2fsv_C NAD(P) transhydrogenase subunit beta; NAD(P) transhydrogenase subunits, oxidoreductas; HET: NAD NAP; 2.30A {Rhodospirillum rubrum} SCOP: c.31.1.4 PDB: 1e3t_A* 1hzz_C* 1nm5_C* 1u28_C* 1u2d_C* 1u2g_C* 2fr8_C* 2frd_C* Back     alignment and structure
>1djl_A Transhydrogenase DIII; rossmann fold dinucleotide binding fold reverse binding of N oxidoreductase; HET: NAP; 2.00A {Homo sapiens} SCOP: c.31.1.4 PDB: 1pt9_A* 1u31_A* Back     alignment and structure
>1e2b_A Enzyme IIB-cellobiose; phosphotransferase system, transferas transport, phosphorylation; NMR {Escherichia coli} SCOP: c.44.2.1 PDB: 1iib_A 1h9c_A* 2wwv_D 2wy2_D Back     alignment and structure
>1tvm_A PTS system, galactitol-specific IIB component; phosphotransferase system (PTS), P-loop; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 324
d1zpda3204 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymom 2e-09
d1pvda3196 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker 7e-07
d1ybha2195 c.36.1.5 (A:86-280) Acetohydroxyacid synthase cata 2e-04
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 204 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase PP module
domain: Pyruvate decarboxylase
species: Zymomonas mobilis [TaxId: 542]

 Score = 54.5 bits (130), Expect = 2e-09
 Identities = 49/122 (40%), Positives = 65/122 (53%), Gaps = 23/122 (18%)

Query: 222 NCQKDVDVSTMLRCEQKNIIFLINNGNYTIEVEIHDGPYNVIENWNYTGLVEAF------ 275
                 +V+ M+R +   IIFLINN  YTIEV IHDGPYN I+NW+Y GL+E F      
Sbjct: 81  FQLTAQEVAQMVRLKLPVIIFLINNYGYTIEVMIHDGPYNNIKNWDYAGLMEVFNGNGGY 140

Query: 276 ----------------QNAIETAAVEKKDCLCFIEAIVHKDDTGKELLKWGSRVSAANNR 319
                             AI+  A+   D    IE  + ++D  +EL+KWG RV+AAN+R
Sbjct: 141 DSGAAKGLKAKTGGELAEAIK-VALANTDGPTLIECFIGREDCTEELVKWGKRVAAANSR 199

Query: 320 PP 321
            P
Sbjct: 200 KP 201
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.87
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.86
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.86
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 99.86
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.86
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.85
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 99.85
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.85
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 99.84
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 99.83
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.83
d1ovma1161 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.83
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 99.82
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.81
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.81
d1zpda1175 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.81
d1pvda1179 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.8
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.79
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 99.79
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.77
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.77
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 99.75
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 99.75
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.74
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.73
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.73
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 99.73
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 99.72
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.7
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.7
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.68
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.68
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 99.63
d1ytla1158 Acetyl-CoA decarbonylase/synthase complex epsilon 99.42
d2c42a2 447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 97.43
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 97.03
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 96.97
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 96.89
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 96.89
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 96.81
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 96.8
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 90.58
d1pnoa_180 Transhydrogenase domain III (dIII) {Rhodospirillum 90.06
d1okkd2207 GTPase domain of the signal recognition particle r 89.34
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 88.45
d1vmaa2213 GTPase domain of the signal recognition particle r 87.4
d1d4oa_177 Transhydrogenase domain III (dIII) {Cow (Bos tauru 86.85
d2qy9a2211 GTPase domain of the signal recognition particle r 86.29
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 84.63
d1j8yf2211 GTPase domain of the signal sequence recognition p 83.6
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 82.2
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase Pyr module
domain: Pyruvate oxidase
species: Lactobacillus plantarum [TaxId: 1590]

Probab=99.87  E-value=4.2e-23  Score=176.50  Aligned_cols=76  Identities=18%  Similarity=0.243  Sum_probs=71.9

Q ss_pred             cCCCC-chHHHHhhhc-CCCCeEeecCchHHHHHHHHHHhhhcC-ceEEEEeCCcchHHHHHHHHHHhhcCCcchhhhh
Q 038651            8 SSPAD-SSSLLDHLIA-EPGSRDVGCCNELNAGYAADGSARARA-VGAYVVTFIVGRLSIINAIAGAYSENFPAATITA   83 (324)
Q Consensus         8 ~~pG~-~~~l~dal~~-~~~i~~i~~rhE~~A~~aAdgYaR~tg-~gv~~~t~GpG~~N~~tgla~A~~d~~Pvl~It~   83 (324)
                      .+||+ +++|+|+|.+ .++|++|.+|||++|+||||||+|+|| +|||++|+|||++|+++||++||.|++|||+||+
T Consensus        23 gipG~~~~~l~dal~~~~~~i~~i~~r~E~~A~~~A~gyar~tgk~gv~~~t~GpG~~N~~~gl~~A~~~~~P~l~i~g  101 (174)
T d2ez9a2          23 GIPGGSINSIMDALSAERDRIHYIQVRHEEVGAMAAAADAKLTGKIGVCFGSAGPGGTHLMNGLYDAREDHVPVLALIG  101 (174)
T ss_dssp             ECCCGGGHHHHHHHHHTTTTSEEEECSSHHHHHHHHHHHHHHHSSCEEEEECTTHHHHTTHHHHHHHHHTTCCEEEEEE
T ss_pred             EECCHhHHHHHHHHHhcCCCcEEEEecccchhHHHHHHHHhhcCceeEEeecccccccchhhhHHHHHhcCccceeeec
Confidence            58999 9999999964 357999999999999999999999999 9999999999999999999999999999999975
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure