Citrus Sinensis ID: 038680

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
LRCRRRLSLRSGLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLFL
cccccccccccccEEEEEcccEEEEEcccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcc
ccccEEEEEEcccEEEEEcccEEEEEEccccccccEEcccccEEEEcccccccHccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEEccccccccccHHHHHHHHHcHHHHcccccHHccccccHHHHHHHHHHHHHHcc
lrcrrrlslRSGLTKLMRRKCSiallsptpwstcarcflheHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLesyhkgssttfaiqdgpeagqtvphvhihvlprkagdfekndeIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLFL
lrcrrrlslrsgltklmrrkcsiallsptpwstCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVlprkagdfeKNDEIYDAIEVKekelqqkldldkerkdrsleemnqeadqyrslfl
lrcrrrlslrsgltklMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLFL
***********GLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESY******TFAI*******QTVPHVHIHVLPRKAGDFEKNDEIYDAI*************************************
********LRSGLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKEL***************EEMNQEADQYRSLFL
LRCRRRLSLRSGLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLFL
LRCRRRLSLRSGLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKE**************S**EMN*****YR**FL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LRCRRRLSLRSGLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPHVHIHVLPRKAGDFEKNDEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q86KK2149 Bis(5'-adenosyl)-triphosp yes no 0.658 0.711 0.512 2e-28
Q1KZG4149 Bis(5'-adenosyl)-triphosp yes no 0.552 0.597 0.573 1e-26
O89106150 Bis(5'-adenosyl)-triphosp yes no 0.552 0.593 0.573 1e-25
P49789147 Bis(5'-adenosyl)-triphosp yes no 0.552 0.605 0.584 1e-25
O76463440 Nitrilase and fragile his yes no 0.683 0.25 0.512 4e-25
Q9JIX3150 Bis(5'-adenosyl)-triphosp yes no 0.670 0.72 0.452 6e-25
P49776182 Bis(5'-nucleosyl)-tetraph yes no 0.881 0.780 0.358 9e-23
O76464460 Nitrilase and fragile his yes no 0.732 0.256 0.382 2e-19
P49775206 Bis(5'-adenosyl)-triphosp yes no 0.633 0.495 0.342 1e-10
C8Z5L6206 Bis(5'-adenosyl)-triphosp N/A no 0.633 0.495 0.342 1e-10
>sp|Q86KK2|FHIT_DICDI Bis(5'-adenosyl)-triphosphatase OS=Dictyostelium discoideum GN=fhit PE=3 SV=1 Back     alignment and function desciption
 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 76/119 (63%), Gaps = 13/119 (10%)

Query: 42  HVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPH 101
           HVLVC +R   R  DLT +E TDLWL+AQ++   +E +  G   TFAIQDG  AGQTV H
Sbjct: 36  HVLVCPKRIVPRVKDLTKEEFTDLWLSAQRISSVVEEHFNGDGITFAIQDGKNAGQTVEH 95

Query: 102 VHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 160
           VHIH++PRK  DFE ND+IY+ IE             KER+ RS EEM +E+ + R LF
Sbjct: 96  VHIHIIPRKKFDFENNDQIYNEIE-------------KEREPRSYEEMEKESSELRPLF 141
Cleaves A-5'-PPP-5'A to yield AMP and ADP.
Dictyostelium discoideum (taxid: 44689)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 2EC: 9
>sp|Q1KZG4|FHIT_BOVIN Bis(5'-adenosyl)-triphosphatase OS=Bos taurus GN=FHIT PE=2 SV=1 Back     alignment and function description
>sp|O89106|FHIT_MOUSE Bis(5'-adenosyl)-triphosphatase OS=Mus musculus GN=Fhit PE=2 SV=3 Back     alignment and function description
>sp|P49789|FHIT_HUMAN Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens GN=FHIT PE=1 SV=3 Back     alignment and function description
>sp|O76463|NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JIX3|FHIT_RAT Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus GN=Fhit PE=1 SV=1 Back     alignment and function description
>sp|P49776|APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aph1 PE=1 SV=2 Back     alignment and function description
>sp|O76464|NFT1_DROME Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster GN=NitFhit PE=1 SV=1 Back     alignment and function description
>sp|P49775|HNT2_YEAST Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT2 PE=1 SV=2 Back     alignment and function description
>sp|C8Z5L6|HNT2_YEAS8 Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HNT2 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
356539734150 PREDICTED: bis(5'-adenosyl)-triphosphata 0.813 0.873 0.778 7e-55
351726772157 uncharacterized protein LOC100305764 [Gl 0.782 0.802 0.785 2e-53
224146587209 predicted protein [Populus trichocarpa] 0.782 0.602 0.769 3e-52
118487777159 unknown [Populus trichocarpa] 0.782 0.792 0.769 9e-52
357155456162 PREDICTED: bis(5'-adenosyl)-triphosphata 0.819 0.814 0.711 1e-50
449495038158 PREDICTED: bis(5'-adenosyl)-triphosphata 0.782 0.797 0.769 2e-50
30697031180 bis(5'-adenosyl)-triphosphatase [Arabido 0.968 0.866 0.619 5e-50
359478482189 PREDICTED: bis(5'-adenosyl)-triphosphata 0.776 0.661 0.752 6e-50
27808510180 At5g58240 [Arabidopsis thaliana] gi|1107 0.968 0.866 0.619 7e-50
42573722160 bis(5'-adenosyl)-triphosphatase [Arabido 0.776 0.781 0.744 3e-49
>gi|356539734|ref|XP_003538349.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Glycine max] Back     alignment and taxonomy information
 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 102/131 (77%), Positives = 116/131 (88%)

Query: 31  WSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQ 90
           +ST     +  HVL+CS+RE KRF DLTADET+DLWLTAQKVGKQLESYHK SS T AIQ
Sbjct: 20  YSTNLSYAMFLHVLICSKREVKRFVDLTADETSDLWLTAQKVGKQLESYHKASSLTLAIQ 79

Query: 91  DGPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMN 150
           DGP+AGQ VPHVHIH++PRK+GDFEKNDEIYDAI+ KEKEL+QKLDLDKERKDRSLE+M+
Sbjct: 80  DGPQAGQMVPHVHIHLIPRKSGDFEKNDEIYDAIDEKEKELKQKLDLDKERKDRSLEDMS 139

Query: 151 QEADQYRSLFL 161
           QEAD+YR LFL
Sbjct: 140 QEADEYRKLFL 150

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351726772|ref|NP_001236370.1| uncharacterized protein LOC100305764 [Glycine max] gi|255626549|gb|ACU13619.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224146587|ref|XP_002326061.1| predicted protein [Populus trichocarpa] gi|222862936|gb|EEF00443.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118487777|gb|ABK95712.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357155456|ref|XP_003577126.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|449495038|ref|XP_004159717.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30697031|ref|NP_200632.2| bis(5'-adenosyl)-triphosphatase [Arabidopsis thaliana] gi|332009640|gb|AED97023.1| bis(5'-adenosyl)-triphosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359478482|ref|XP_002275721.2| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|27808510|gb|AAO24535.1| At5g58240 [Arabidopsis thaliana] gi|110736300|dbj|BAF00120.1| bis(5'-adenosyl)-triphosphatase-like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42573722|ref|NP_974957.1| bis(5'-adenosyl)-triphosphatase [Arabidopsis thaliana] gi|8777325|dbj|BAA96915.1| bis(5'-adenosyl)-triphosphatase-like protein [Arabidopsis thaliana] gi|332009639|gb|AED97022.1| bis(5'-adenosyl)-triphosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
TAIR|locus:2161313180 FHIT "FRAGILE HISTIDINE TRIAD" 0.776 0.694 0.744 4.2e-47
ZFIN|ZDB-GENE-040426-1703150 fhit "fragile histidine triad 0.708 0.76 0.546 3.4e-29
UNIPROTKB|Q1KZG4149 FHIT "Bis(5'-adenosyl)-triphos 0.708 0.765 0.521 2.2e-27
UNIPROTKB|F1PWA0131 FHIT "Uncharacterized protein" 0.701 0.862 0.525 1.9e-26
UNIPROTKB|F1LRT5150 Fhit "Bis(5'-adenosyl)-triphos 0.708 0.76 0.495 3.2e-26
DICTYBASE|DDB_G0274257149 fhit "bis(5'-adenosyl)-triphos 0.658 0.711 0.512 5.2e-26
RGD|620448150 Fhit "fragile histidine triad" 0.708 0.76 0.487 6.6e-26
UNIPROTKB|P49789147 FHIT "Bis(5'-adenosyl)-triphos 0.695 0.761 0.521 8.4e-26
MGI|MGI:1277947150 Fhit "fragile histidine triad 0.708 0.76 0.504 8.4e-26
UNIPROTKB|F1NA30147 FHIT "Uncharacterized protein" 0.695 0.761 0.487 2e-24
TAIR|locus:2161313 FHIT "FRAGILE HISTIDINE TRIAD" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 493 (178.6 bits), Expect = 4.2e-47, P = 4.2e-47
 Identities = 93/125 (74%), Positives = 105/125 (84%)

Query:    36 RCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEA 95
             R  L  HVLVC RR   RF DLTADET+DLWLTAQKVG +LE++H  SS T AIQDGP+A
Sbjct:    54 RPLLPAHVLVCPRRLVPRFTDLTADETSDLWLTAQKVGSKLETFHNASSLTLAIQDGPQA 113

Query:    96 GQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQ 155
             GQTVPHVHIH+LPRK GDFEKNDEIYDA++ KEKEL+QKLDLDK+R DRS++EM  EA Q
Sbjct:   114 GQTVPHVHIHILPRKGGDFEKNDEIYDALDEKEKELKQKLDLDKDRVDRSIQEMADEASQ 173

Query:   156 YRSLF 160
             YRSLF
Sbjct:   174 YRSLF 178
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0009117 "nucleotide metabolic process" evidence=ISS
GO:0047710 "bis(5'-adenosyl)-triphosphatase activity" evidence=ISS
GO:0043530 "adenosine 5'-monophosphoramidase activity" evidence=IDA
GO:0047627 "adenylylsulfatase activity" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
ZFIN|ZDB-GENE-040426-1703 fhit "fragile histidine triad gene" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KZG4 FHIT "Bis(5'-adenosyl)-triphosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWA0 FHIT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRT5 Fhit "Bis(5'-adenosyl)-triphosphatase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274257 fhit "bis(5'-adenosyl)-triphosphatase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|620448 Fhit "fragile histidine triad" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P49789 FHIT "Bis(5'-adenosyl)-triphosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1277947 Fhit "fragile histidine triad gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA30 FHIT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86KK2FHIT_DICDI3, ., 6, ., 1, ., 2, 90.51260.65830.7114yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.921
3rd Layer3.6.1.29LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
cd01275126 cd01275, FHIT, FHIT (fragile histidine family): FH 3e-33
pfam0123097 pfam01230, HIT, HIT domain 4e-20
cd0046886 cd00468, HIT_like, HIT family: HIT (Histidine tria 1e-19
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy 6e-17
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucl 4e-15
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 9e-10
>gnl|CDD|238606 cd01275, FHIT, FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information 
 Score =  113 bits (285), Expect = 3e-33
 Identities = 34/90 (37%), Positives = 43/90 (47%), Gaps = 1/90 (1%)

Query: 42  HVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPH 101
           HVLV   R   R  DLT +E  DL+   Q   K L+  +K       I DG   G  VPH
Sbjct: 36  HVLVVPYRHVPRLEDLTPEEIADLFKLVQLAMKALKVVYKPDGFNIGINDGKAGGGIVPH 95

Query: 102 VHIHVLPRKAGDFEKND-EIYDAIEVKEKE 130
           VHIH++PR  GD       IY  +  ++ E
Sbjct: 96  VHIHIVPRWNGDTNFMPVIIYTKVLPEDLE 125

Fhit plays a very important role in the development of tumours. Infact, Fhit deletions are among the earliest and most frequent genetic alterations in the development of tumours. Length = 126
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|238263 cd00468, HIT_like, HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
KOG3379150 consensus Diadenosine polyphosphate hydrolase and 100.0
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.97
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.95
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.95
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.95
PRK10687119 purine nucleoside phosphoramidase; Provisional 99.94
cd01276104 PKCI_related Protein Kinase C Interacting protein 99.93
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.93
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.89
KOG3275127 consensus Zinc-binding protein of the histidine tr 99.87
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.87
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 99.86
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.85
PLN02643336 ADP-glucose phosphorylase 99.84
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.62
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 99.56
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 99.48
KOG2958354 consensus Galactose-1-phosphate uridylyltransferas 99.47
KOG4359166 consensus Protein kinase C inhibitor-like protein 99.25
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 98.77
KOG2476528 consensus Uncharacterized conserved protein [Funct 97.92
KOG0562184 consensus Predicted hydrolase (HIT family) [Genera 97.77
KOG3969310 consensus Uncharacterized conserved protein [Funct 97.53
COG4360298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr 97.49
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 97.31
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 97.09
PLN02643 336 ADP-glucose phosphorylase 96.61
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 96.46
KOG2477628 consensus Uncharacterized conserved protein [Funct 96.43
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 96.4
TIGR00672250 cdh CDP-diacylglycerol pyrophosphatase, bacterial 96.39
PRK11720 346 galactose-1-phosphate uridylyltransferase; Provisi 96.06
PF02611222 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: 95.76
COG5075305 Uncharacterized conserved protein [Function unknow 95.45
TIGR00209 347 galT_1 galactose-1-phosphate uridylyltransferase, 94.9
KOG2720 431 consensus Predicted hydrolase (HIT family) [Genera 94.68
PF01087183 GalP_UDP_transf: Galactose-1-phosphate uridyl tran 94.62
COG2134252 Cdh CDP-diacylglycerol pyrophosphatase [Lipid meta 94.48
PF01076196 Mob_Pre: Plasmid recombination enzyme; InterPro: I 82.63
>KOG3379 consensus Diadenosine polyphosphate hydrolase and related proteins of the histidine triad (HIT) family [Nucleotide transport and metabolism; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-32  Score=201.87  Aligned_cols=134  Identities=53%  Similarity=0.749  Sum_probs=125.8

Q ss_pred             ceEEEEcCcEEEEeCCCCccccCCccCcEEEEEEeccccCCccCCCHHHHHHHHHHHHHHHHHHHhhcCCCceEEEEecC
Q 038680           13 LTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDG   92 (161)
Q Consensus        13 ~r~i~e~e~~~a~~~~~P~~~~~~~~~~Gh~LIiPk~Hv~~l~~L~~ee~~~l~~~~~~v~~~l~~~~~~~~~ni~~~~~   92 (161)
                      -.++|++++.+||.+..|..       |||+||+|+|-+..+.||+.+|..+|+..++.+.+.|++.++..++|+++.+|
T Consensus        17 ~~VFykT~~sfafvNlkPvv-------pgHVLv~P~R~vpRl~dLt~~E~aDlF~t~~~v~~~lek~~~~ts~ti~iQDG   89 (150)
T KOG3379|consen   17 DHVFYKTKHSFAFVNLKPVV-------PGHVLVSPLRVVPRLTDLTAAETADLFTTVQKVQRVLEKHYNATSLTIAIQDG   89 (150)
T ss_pred             ceEEEeccceEEEEeccccc-------cceEEEeccccccccccCCcHHHHHHHHHHHHHHHHHHHHhcccceEEEeccc
Confidence            36899999999999999987       99999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccCeEEEEEeecCCCCCCCCchhhhhhHHHHHHHhhhcCCCccCcCCCHHHHHHHHHHHHhhc
Q 038680           93 PEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF  160 (161)
Q Consensus        93 ~~ag~~v~HlH~HIIPR~~~d~~~~~~iy~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~  160 (161)
                      +.|||+|+|+|+||+||+.||+..++.||+.|++-+++       .+.|+.|+.|||++||..||..|
T Consensus        90 ~~AGQTVpHvHvHIlPR~~gDf~~Nd~IY~~L~~~~~e-------~~~r~~Rs~eEM~eEA~~lr~~~  150 (150)
T KOG3379|consen   90 PEAGQTVPHVHVHILPRKAGDFGDNDLIYDELDKHEKE-------LEDRKPRSLEEMAEEAQRLREYF  150 (150)
T ss_pred             cccCcccceeEEEEccccccccccchHHHHHHHhcccc-------cccCCcchHHHHHHHHHHHHhhC
Confidence            99999999999999999999999999999999865432       26789999999999999999875

>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>KOG3275 consensus Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG2958 consensus Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG4359 consensus Protein kinase C inhibitor-like protein [General function prediction only] Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0562 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>KOG3969 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>KOG2477 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>KOG2720 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] Back     alignment and domain information
>PF01076 Mob_Pre: Plasmid recombination enzyme; InterPro: IPR001668 With some plasmids, recombination can occur in a site specific manner that is independent of RecA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1fhi_A147 Substrate Analog (Ib2) Complex With The Fragile His 1e-26
3fit_A147 Fhit (Fragile Histidine Triad Protein) In Complex W 3e-26
1ems_A440 Crystal Structure Of The C. Elegans Nitfhit Protein 4e-26
2fhi_A147 Substrate Analog (Ib2) Complex With The His 96 Asn 7e-26
3o0m_A149 Crystal Structure Of A Zn-Bound Histidine Triad Fam 5e-06
3ano_A218 Crystal Structure Of A Novel Diadenosine 5',5'''-P1 2e-04
3l7x_A173 The Crystal Structure Of Smu.412c From Streptococcu 6e-04
>pdb|1FHI|A Chain A, Substrate Analog (Ib2) Complex With The Fragile Histidine Triad Protein, Fhit Length = 147 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%)
Query: 42  HVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPH 101
           HVLVC  R  +RF DL  DE  DL+ T Q+VG  +E +  G+S TF++QDGPEAGQTV H
Sbjct: 35  HVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKH 94
Query: 102 VHIHVLPRKAGDFEKNDEIYDAIEVKEKE 130
           VH+HVLPRKAGDF +ND IY+ ++  +KE
Sbjct: 95  VHVHVLPRKAGDFHRNDSIYEELQKHDKE 123
>pdb|3FIT|A Chain A, Fhit (Fragile Histidine Triad Protein) In Complex With AdenosineSULFATE AMP ANALOG Length = 147 Back     alignment and structure
>pdb|1EMS|A Chain A, Crystal Structure Of The C. Elegans Nitfhit Protein Length = 440 Back     alignment and structure
>pdb|2FHI|A Chain A, Substrate Analog (Ib2) Complex With The His 96 Asn Substitution Of The Fragile Histidine Triad Protein, Fhit Length = 147 Back     alignment and structure
>pdb|3O0M|A Chain A, Crystal Structure Of A Zn-Bound Histidine Triad Family Protein From Mycobacterium Smegmatis Length = 149 Back     alignment and structure
>pdb|3ANO|A Chain A, Crystal Structure Of A Novel Diadenosine 5',5'''-P1,P4-Tetraphosphate Phosphorylase From Mycobacterium Tuberculosis H37rv Length = 218 Back     alignment and structure
>pdb|3L7X|A Chain A, The Crystal Structure Of Smu.412c From Streptococcus Mutans Ua159 Length = 173 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 2e-46
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 3e-43
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 9e-22
2eo4_A149 150AA long hypothetical histidine triad nucleotid 3e-20
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 9e-18
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 6e-17
3imi_A147 HIT family protein; structural genomics, infectiou 7e-16
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 1e-15
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 5e-15
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 1e-14
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 2e-14
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 1e-13
3r6f_A135 HIT family protein; structural genomics, seattle s 3e-13
3ksv_A149 Uncharacterized protein; HIT family, structural ge 5e-13
3nrd_A135 Histidine triad (HIT) protein; structural genomics 2e-11
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 2e-10
3ohe_A137 Histidine triad (HIT) protein; structural genomics 6e-10
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 3e-09
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 3e-09
4egu_A119 Histidine triad (HIT) protein; structural genomics 4e-09
3oj7_A117 Putative histidine triad family protein; hydrolase 7e-09
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 1e-08
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Length = 147 Back     alignment and structure
 Score =  147 bits (372), Expect = 2e-46
 Identities = 62/119 (52%), Positives = 76/119 (63%), Gaps = 7/119 (5%)

Query: 42  HVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPH 101
           HVLVC  R  +RF DL  DE  DL+ T Q+VG  +E +  G+S TF++QDGPEAGQTV H
Sbjct: 35  HVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKH 94

Query: 102 VHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 160
           VH+HVLPRKAGDF +ND IY+ ++  +KE       D     RS EEM  EA   R  F
Sbjct: 95  VHVHVLPRKAGDFHRNDSIYEELQKHDKE-------DFPASWRSEEEMAAEAAALRVYF 146
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Length = 440 Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Length = 218 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Length = 154 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Length = 149 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Length = 135 Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Length = 149 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Length = 137 Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 100.0
3ksv_A149 Uncharacterized protein; HIT family, structural ge 99.98
3imi_A147 HIT family protein; structural genomics, infectiou 99.97
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.97
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 99.97
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.97
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.97
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 99.97
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.96
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.96
3r6f_A135 HIT family protein; structural genomics, seattle s 99.96
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.96
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.96
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.96
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.95
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 99.95
4egu_A119 Histidine triad (HIT) protein; structural genomics 99.95
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.95
3oj7_A117 Putative histidine triad family protein; hydrolase 99.94
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 99.94
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.94
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 99.92
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.89
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.88
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.51
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 98.96
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 98.93
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 98.49
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 96.23
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 96.08
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-34  Score=214.75  Aligned_cols=135  Identities=48%  Similarity=0.739  Sum_probs=110.5

Q ss_pred             CceEEEEcCcEEEEeCCCCccccCCccCcEEEEEEeccccCCccCCCHHHHHHHHHHHHHHHHHHHhhcCCCceEEEEec
Q 038680           12 GLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQD   91 (161)
Q Consensus        12 ~~r~i~e~e~~~a~~~~~P~~~~~~~~~~Gh~LIiPk~Hv~~l~~L~~ee~~~l~~~~~~v~~~l~~~~~~~~~ni~~~~   91 (161)
                      +.++|||+++++||+|.+|.+       |||+||+||+|+.++.+|+++++.+|+.+++++++++++.+++++||+++|+
T Consensus        12 ~~~iv~e~~~~~a~~d~~p~~-------pgh~LViPk~h~~~~~dL~~~e~~~l~~~~~~v~~~l~~~~~~~~~ni~~n~   84 (147)
T 1fit_A           12 PSVVFLKTELSFALVNRKPVV-------PGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQD   84 (147)
T ss_dssp             GGGEEEECSSEEEEECSSCSS-------TTCEEEEESSCCSSGGGSCHHHHHHHHHHHHHHHHHHHHHTTCSEEEEEECC
T ss_pred             CcEEEEECCCEEEEECCCCCC-------CcEEEEEEccccCChhhCCHHHHHHHHHHHHHHHHHHHHhcCCCCEEEEEec
Confidence            568999999999999999988       9999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCccCeEEEEEeecCCCCCCCCchhhhhhHHHHHHHhhhcCCCccCcCCCHHHHHHHHHHHHhhc
Q 038680           92 GPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF  160 (161)
Q Consensus        92 ~~~ag~~v~HlH~HIIPR~~~d~~~~~~iy~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~  160 (161)
                      |+.+||+|+|+|+|||||+.+|..+++++|+.+.....       .+..++.+++|||+++|++||+.|
T Consensus        85 g~~agq~v~HlH~HiiPr~~~d~~~~~~v~~~~~~~~~-------~~~~~~~~~~~e~~~~a~~lr~~l  146 (147)
T 1fit_A           85 GPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDK-------EDFPASWRSEEEMAAEAAALRVYF  146 (147)
T ss_dssp             SGGGTCCSSSCCEEEEEECTTC---------------------------CCCCCHHHHHHHHHHHHHTT
T ss_pred             CCccCCCccEEEEEEECCcCCCCCCcchHHHHhhhccc-------ccccccCCCHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999998752210       012456789999999999999876
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1fita_146 d.13.1.1 (A:) FHIT (fragile histidine triad protei 3e-25
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te 1e-19
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 2e-12
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 5e-10
d1y23a_139 d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] 8e-09
d2oika1139 d.13.1.1 (A:6-144) Histidine triad protein Mfla250 7e-07
d1guqa2171 d.13.1.2 (A:178-348) Galactose-1-phosphate uridyly 4e-05
d1z84a2156 d.13.1.2 (A:196-351) Galactose-1-phosphate uridyly 7e-04
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: FHIT (fragile histidine triad protein)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 92.2 bits (228), Expect = 3e-25
 Identities = 62/119 (52%), Positives = 76/119 (63%), Gaps = 7/119 (5%)

Query: 42  HVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQDGPEAGQTVPH 101
           HVLVC  R  +RF DL  DE  DL+ T Q+VG  +E +  G+S TF++QDGPEAGQTV H
Sbjct: 34  HVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKH 93

Query: 102 VHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLF 160
           VH+HVLPRKAGDF +ND IY+ ++  +KE       D     RS EEM  EA   R  F
Sbjct: 94  VHVHVLPRKAGDFHRNDSIYEELQKHDKE-------DFPASWRSEEEMAAEAAALRVYF 145
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Length = 139 Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 100.0
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 100.0
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 99.97
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.96
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 99.94
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 99.94
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.92
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.89
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.32
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 97.56
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichi 96.95
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 96.86
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: FHIT (fragile histidine triad protein)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.8e-36  Score=221.87  Aligned_cols=136  Identities=49%  Similarity=0.745  Sum_probs=111.3

Q ss_pred             CceEEEEcCcEEEEeCCCCccccCCccCcEEEEEEeccccCCccCCCHHHHHHHHHHHHHHHHHHHhhcCCCceEEEEec
Q 038680           12 GLTKLMRRKCSIALLSPTPWSTCARCFLHEHVLVCSRREAKRFADLTADETTDLWLTAQKVGKQLESYHKGSSTTFAIQD   91 (161)
Q Consensus        12 ~~r~i~e~e~~~a~~~~~P~~~~~~~~~~Gh~LIiPk~Hv~~l~~L~~ee~~~l~~~~~~v~~~l~~~~~~~~~ni~~~~   91 (161)
                      ..++||||++++||+|++|.+       +||+||+||+|+.++.+|+++++.+++.+++.+.+++++.++++++|+++|+
T Consensus        11 p~~ii~e~e~~~afld~~P~~-------pgH~LViPk~H~~~l~dL~~~e~~~l~~~~~~v~~~l~~~~~~~~~ni~~~~   83 (146)
T d1fita_          11 PSVVFLKTELSFALVNRKPVV-------PGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQD   83 (146)
T ss_dssp             GGGEEEECSSEEEEECSSCSS-------TTCEEEEESSCCSSGGGSCHHHHHHHHHHHHHHHHHHHHHTTCSEEEEEECC
T ss_pred             cceEEEECCCEEEEECCCCCC-------CcEEEEEecceehHHHHhhHHHHHHHHHHHHHHHHHHHhhcccceEEEEEcc
Confidence            567999999999999999998       9999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCccCeEEEEEeecCCCCCCCCchhhhhhHHHHHHHhhhcCCCccCcCCCHHHHHHHHHHHHhhcC
Q 038680           92 GPEAGQTVPHVHIHVLPRKAGDFEKNDEIYDAIEVKEKELQQKLDLDKERKDRSLEEMNQEADQYRSLFL  161 (161)
Q Consensus        92 ~~~ag~~v~HlH~HIIPR~~~d~~~~~~iy~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~  161 (161)
                      |+.+||+|+|+|+|||||+.||+.+++.+|+.+...+.+       +-+++.++.|||+++|++||+.|.
T Consensus        84 g~~agq~v~HlH~HiiPR~~gD~~~~~~~~~~~~~~~~~-------~~~~~~r~~ee~~~~a~~lr~~~~  146 (146)
T d1fita_          84 GPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKE-------DFPASWRSEEEMAAEAAALRVYFQ  146 (146)
T ss_dssp             SGGGTCCSSSCCEEEEEECTTC---------------------------CCCCCHHHHHHHHHHHHHTTC
T ss_pred             ccccCCCCCEEEEEEecCcCCCcccccchhhhhhhhchh-------hhhhccCCHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999888899877654321       234566889999999999999873
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure