Citrus Sinensis ID: 038714

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MASSSSLAPLTVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNIEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAIIRDQNAENSLRGNENMVKQQLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMWRRMQISSSNSDEKGNHDYQVTVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSINGKHKIIQILKNN
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHccccEEEEEEEccccccccccEEEEEEccHHHHHHHHccccEEEEEEcccEEEEEEcccc
cccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEEccHHHHHHHHccccEEEEEEcccEEEEEEEccc
masssslapltvtKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSciqsdesfpfslqnievipltqsitksrvslsffRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAiirdqnaenslrgnENMVKQQlsdygpivpvMSYYDAVVQRQHDVLRNEVDEMWRRMqisssnsdekgnhdyqvtvppdertifltfskgypisenEIRDFFIRKFGECFEAINMQevassteqPLFARLVMDSASFMDVVLGgkskakfsingKHKIIQILKNN
masssslapltVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNIEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNkaiirdqnaenslrgNENMVKQQLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMWRRMQisssnsdekgnhdYQVTVPPDERTIFLTfskgypiseNEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKskakfsingkhkiiqilknn
MASSSSLAPLTVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNIEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAIIRDQNAENSLRGNENMVKQQLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMWRRMQISSSNSDEKGNHDYQVTVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSINGKHKIIQILKNN
**********TVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNIEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAIIR*****************QLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMW********************TVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSINGKHKIIQI****
************TKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDES*******IEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEV***********************************MSYYDAVVQRQHDVLRNEVDEMWRRMQI***********DYQVTVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQ********PLFARLVMDSASFMDVVLGGKSKAKFSINGKHKIIQILKN*
********PLTVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNIEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAIIRDQNAENSLRGNENMVKQQLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMWRRMQIS*********HDYQVTVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSINGKHKIIQILKNN
******LAPLTVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNIEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAIIRDQNAENSLRGNENMVKQQLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMWRRMQISSSNSDEKGNHDYQVTVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSINGKHKIIQILKNN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSLAPLTVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNIEVIPLTQSITKSRVSLSFFRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAIIRDQNAENSLRGNENMVKQQLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMWRRMQISSSNSDEKGNHDYQVTVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSINGKHKIIQILKNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
224098077373 predicted protein [Populus trichocarpa] 0.890 0.761 0.488 3e-69
224112943368 predicted protein [Populus trichocarpa] 0.893 0.774 0.469 1e-67
255565850400 hypothetical protein RCOM_1069440 [Ricin 0.949 0.757 0.421 9e-67
225449180345 PREDICTED: uncharacterized protein LOC10 0.931 0.860 0.443 1e-65
449452176338 PREDICTED: uncharacterized protein LOC10 0.937 0.884 0.411 5e-57
297738566312 unnamed protein product [Vitis vinifera] 0.833 0.852 0.394 9e-51
147801241 928 hypothetical protein VITISV_041246 [Viti 0.824 0.283 0.407 1e-50
255550453342 conserved hypothetical protein [Ricinus 0.896 0.836 0.361 4e-46
357515811310 hypothetical protein MTR_8g045420 [Medic 0.836 0.861 0.358 9e-45
388496560319 unknown [Lotus japonicus] 0.890 0.890 0.359 4e-43
>gi|224098077|ref|XP_002311116.1| predicted protein [Populus trichocarpa] gi|222850936|gb|EEE88483.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  268 bits (685), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 164/336 (48%), Positives = 210/336 (62%), Gaps = 52/336 (15%)

Query: 12  VTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRD-LVNTLLTWPD 70
           VT E+FK FH IDR L+T+L+  L R+  ESMQV+ALWIWLE     RD LV+ +L+ PD
Sbjct: 17  VTPEEFKIFHTIDRTLYTRLIVNLDRDPAESMQVMALWIWLEKEA--RDNLVDKMLSLPD 74

Query: 71  TLITSLADEAVLCLSCIQSDESFPFSLQNI-EVIPLTQSITKSRVSLSFFRDNRLKILHA 129
            LI SLADEAVLCL+CI++D  F FS +++ + +PLTQ +TK+ +SL FF DNRL IL A
Sbjct: 75  ALINSLADEAVLCLNCIETDR-FHFSPESMNDKVPLTQQLTKTGLSLRFFHDNRLGILRA 133

Query: 130 VTKNVIEVCARAFEDLVLHEVQNKAIIRDQN--AENSLRGNENMVKQQLSDYGPIV-PVM 186
           +TK + EVCARAFED+    ++ KA  +  N  AEN + G E      L+ YGP + PV+
Sbjct: 134 LTKIIDEVCARAFEDISRQVIEKKAAGKGNNIVAENVI-GQEG---NPLNYYGPAINPVL 189

Query: 187 SY--------------------------------YDAVVQRQHDVLRNEVDEMWRRMQIS 214
            Y                                YD  VQRQ     N +  +  R++I 
Sbjct: 190 CYNSAAAAAGVYGLGISTPQFMAPNIGILPAYDPYDLSVQRQITSTEN-IAGVLNRIKI- 247

Query: 215 SSNSDEKGNHDYQVTVPPDERTIFLTFSKGYPISENEIRDFFIRKFGECFEAINMQEVAS 274
             N D +G  D    V  D RT+FLTFSKGYPISE+EIRDFF +K G+C EAI MQEV S
Sbjct: 248 -INGDHQGEKD----VYADNRTVFLTFSKGYPISEDEIRDFFTKKHGDCIEAIYMQEV-S 301

Query: 275 STEQPLFARLVMDSASFMDVVLGGKSKAKFSINGKH 310
           + EQPL+ARLV+ SA+ +  VL G+SKAKF+INGKH
Sbjct: 302 AEEQPLYARLVVTSAAVIHSVLQGQSKAKFTINGKH 337

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224112943|ref|XP_002316340.1| predicted protein [Populus trichocarpa] gi|222865380|gb|EEF02511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255565850|ref|XP_002523914.1| hypothetical protein RCOM_1069440 [Ricinus communis] gi|223536844|gb|EEF38483.1| hypothetical protein RCOM_1069440 [Ricinus communis] Back     alignment and taxonomy information
>gi|225449180|ref|XP_002275553.1| PREDICTED: uncharacterized protein LOC100251393 [Vitis vinifera] gi|296086081|emb|CBI31522.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449452176|ref|XP_004143836.1| PREDICTED: uncharacterized protein LOC101221230 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297738566|emb|CBI27811.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147801241|emb|CAN72326.1| hypothetical protein VITISV_041246 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255550453|ref|XP_002516277.1| conserved hypothetical protein [Ricinus communis] gi|223544763|gb|EEF46279.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357515811|ref|XP_003628194.1| hypothetical protein MTR_8g045420 [Medicago truncatula] gi|355522216|gb|AET02670.1| hypothetical protein MTR_8g045420 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388496560|gb|AFK36346.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
TAIR|locus:2173224301 AT5G13620 "AT5G13620" [Arabido 0.482 0.511 0.368 1.1e-40
TAIR|locus:2010277338 AT1G49290 "AT1G49290" [Arabido 0.931 0.878 0.330 1.8e-39
TAIR|locus:2010881304 AT1G64870 "AT1G64870" [Arabido 0.404 0.424 0.343 1.7e-33
TAIR|locus:2147942265 AT5G11220 "AT5G11220" [Arabido 0.244 0.294 0.382 1.5e-22
TAIR|locus:2096890300 AT3G45200 "AT3G45200" [Arabido 0.388 0.413 0.355 2.3e-13
TAIR|locus:504954994113 AT5G24355 "AT5G24355" [Arabido 0.197 0.557 0.439 2.5e-08
TAIR|locus:2173224 AT5G13620 "AT5G13620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 1.1e-40, Sum P(2) = 1.1e-40
 Identities = 59/160 (36%), Positives = 96/160 (60%)

Query:     1 MASSSSLAPLTVTKEQFKTFHNIDRILFTKLVHYLGRNSIESMQVIALWIWLEHSGLCRD 60
             MASSSS   + VT+++F  FH  DR LF + V  L R+  +S+QV++  ++LE SGL  +
Sbjct:     1 MASSSSA--VAVTRDEFNAFHKCDRALFRRFVVRLRRDINQSLQVMSFLLYLEKSGLVSN 58

Query:    61 LVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPFSLQNI--EVIPLTQSITKSRVSLSF 118
             L+    + PD  I ++ADE V+CLSC+ S E+F   + N   ++IPL   +T   ++L+ 
Sbjct:    59 LIVNFNSLPDFFINTVADEVVMCLSCL-SYENFSMFVANFGKKIIPLITRMTGEYLTLAV 117

Query:   119 FRDNRLKILHAVTKNVIEVCARAFEDLVLHEVQNKAIIRD 158
                NR  IL  + K++  +C  AFED+ + + + + +I D
Sbjct:   118 IHQNRESILLDMKKHLTSICYPAFEDICV-QAEKEKVIED 156
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2010277 AT1G49290 "AT1G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010881 AT1G64870 "AT1G64870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147942 AT5G11220 "AT5G11220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096890 AT3G45200 "AT3G45200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954994 AT5G24355 "AT5G24355" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VIII000359
hypothetical protein (373 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 319
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.06
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 98.02
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.89
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 97.77
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 97.77
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 97.74
smart0036071 RRM RNA recognition motif. 97.73
PLN03120 260 nucleic acid binding protein; Provisional 97.71
smart0036272 RRM_2 RNA recognition motif. 97.65
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 97.54
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.53
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 97.52
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 97.4
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 97.24
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 97.24
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.23
COG0724 306 RNA-binding proteins (RRM domain) [General functio 97.12
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.06
PLN03121 243 nucleic acid binding protein; Provisional 97.03
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.91
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 96.81
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.79
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 96.7
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 96.58
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 96.5
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 96.49
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 95.89
smart0036170 RRM_1 RNA recognition motif. 95.67
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 95.58
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 95.05
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 94.95
KOG0153377 consensus Predicted RNA-binding protein (RRM super 93.92
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 93.63
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 93.24
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 92.75
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 91.58
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 91.36
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 90.08
PLN03213 759 repressor of silencing 3; Provisional 89.88
KOG4207 256 consensus Predicted splicing factor, SR protein su 89.18
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 88.87
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 88.13
KOG0129520 consensus Predicted RNA-binding protein (RRM super 84.94
KOG0131 203 consensus Splicing factor 3b, subunit 4 [RNA proce 84.47
KOG0114124 consensus Predicted RNA-binding protein (RRM super 83.07
KOG0122270 consensus Translation initiation factor 3, subunit 80.83
PF1551362 DUF4651: Domain of unknown function (DUF4651) 80.83
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information 
Probab=98.06  E-value=5.6e-06  Score=80.58  Aligned_cols=78  Identities=24%  Similarity=0.376  Sum_probs=68.6

Q ss_pred             ceEEEEccCCCc--CCHHHHHHHHHhhcCCceeEEEeeecCCCCCCCceEEEEecchhhHHHHhCC-CCeeeEEEcCcee
Q 038714          235 RTIFLTFSKGYP--ISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGG-KSKAKFSINGKHK  311 (319)
Q Consensus       235 Rt~FvTFS~G~P--vse~ei~~fF~~~yGdcie~v~mq~~~~~~~qplfariVf~s~~~v~~vL~g-~~~~kf~Ingkhi  311 (319)
                      ||+ ..|.+|.|  ++++|+++||+. ||-.-+.+.|-+. ...+...||+|.|++++.||.++.- .+    .+|||.+
T Consensus        96 ~tk-kiFvGG~~~~~~e~~~r~yfe~-~g~v~~~~~~~d~-~~~~~rgFgfv~~~~e~sVdkv~~~~f~----~~~gk~v  168 (311)
T KOG4205|consen   96 RTK-KIFVGGLPPDTTEEDFKDYFEQ-FGKVADVVIMYDK-TTSRPRGFGFVTFDSEDSVDKVTLQKFH----DFNGKKV  168 (311)
T ss_pred             cee-EEEecCcCCCCchHHHhhhhhc-cceeEeeEEeecc-cccccccceeeEeccccccceeccccee----eecCcee
Confidence            455 66668999  999999999997 9976777788887 8999999999999999999999983 44    8999999


Q ss_pred             EEEeccCC
Q 038714          312 IIQILKNN  319 (319)
Q Consensus       312 Warky~pk  319 (319)
                      -+++++||
T Consensus       169 evkrA~pk  176 (311)
T KOG4205|consen  169 EVKRAIPK  176 (311)
T ss_pred             eEeeccch
Confidence            99999997

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF15513 DUF4651: Domain of unknown function (DUF4651) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 46.0 bits (108), Expect = 1e-05
 Identities = 50/374 (13%), Positives = 101/374 (27%), Gaps = 131/374 (35%)

Query: 14  KEQFKTFHNID-RILFT------------------KLVHYL-GRNSIESMQVIALWIWLE 53
            + +  F N+  +IL T                   L H+       E   ++  ++   
Sbjct: 256 AKAWNAF-NLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCR 314

Query: 54  HSGL------------------CRDLVNTLLTWPDTLITSLADEAVLCLSCIQSDESFPF 95
              L                   RD + T   W       L       L+ ++  E    
Sbjct: 315 PQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAE---- 370

Query: 96  SLQNIEVIPLTQSITKSR-VSLSFFRDNRLKILHAVTKNVIEV--CARAFED--LVLHEV 150
                          +     LS F  +   I       ++ +        D  +V++++
Sbjct: 371 --------------YRKMFDRLSVFPPS-AHI----PTILLSLIWFDVIKSDVMVVVNKL 411

Query: 151 QNKAIIRDQNAENSLRGNENMVKQQLSDYGPIVPVMSYYDAVVQRQHDVLRNEVDEMWR- 209
              +++  Q  E+++                     S         +  L+ +++  +  
Sbjct: 412 HKYSLVEKQPKESTI---------------------SIPS-----IYLELKVKLENEYAL 445

Query: 210 -RMQISSSNSDEKGNHDYQVTVPPDERTIFLTFSKGYPISE-------NEIR----DF-F 256
            R  +   N  +    D    +PP     F +   G+ +            R    DF F
Sbjct: 446 HRSIVDHYNIPKT--FDSDDLIPPYLDQYFYSHI-GHHLKNIEHPERMTLFRMVFLDFRF 502

Query: 257 I-RKFGECFEAINMQEVASSTEQ-------------PLFARLVMDSASFMDVVLGGKSKA 302
           + +K      A N      +T Q             P + RLV     F+          
Sbjct: 503 LEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFL------PKIE 556

Query: 303 KFSINGKHK-IIQI 315
           +  I  K+  +++I
Sbjct: 557 ENLICSKYTDLLRI 570

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.68
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.52
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.51
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.5
2dis_A109 Unnamed protein product; structural genomics, RRM 98.48
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.48
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.46
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.45
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.44
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.44
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.44
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.42
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.41
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.41
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.39
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.39
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.39
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.39
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.37
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.36
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.36
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.35
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.35
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.35
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.35
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.34
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.33
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.31
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.31
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.31
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.3
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.3
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.3
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.29
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.29
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.28
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.28
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.28
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.28
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.27
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.27
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.27
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.26
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.26
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.25
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.25
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.25
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.24
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.23
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.23
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.23
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.23
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.22
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.21
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.21
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.2
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.2
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.2
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.2
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.19
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.19
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.19
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.18
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.17
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.17
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.17
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.17
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.16
2div_A99 TRNA selenocysteine associated protein; structural 98.15
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.15
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.15
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.15
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.14
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.14
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.14
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.13
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.12
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.12
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.12
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.12
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.11
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.11
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.09
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.09
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.08
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.08
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.07
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.07
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.07
1x5p_A97 Negative elongation factor E; structure genomics, 98.07
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.05
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.03
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.03
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.03
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.03
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.01
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.01
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.0
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.0
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.99
2la6_A99 RNA-binding protein FUS; structural genomics, nort 97.99
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 97.99
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 97.98
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.98
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 97.96
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.96
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 97.95
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 97.95
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 97.95
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 97.94
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 97.94
2krb_A81 Eukaryotic translation initiation factor 3 subunit 97.94
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.93
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.93
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 97.92
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 97.89
2cpj_A99 Non-POU domain-containing octamer-binding protein; 97.89
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 97.89
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.88
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.88
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 97.88
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 97.88
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 97.88
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 97.86
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.86
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 97.85
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 97.84
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 97.84
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 97.83
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 97.83
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.83
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.83
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 97.83
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 97.83
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 97.82
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.82
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 97.82
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 97.8
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 97.77
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 97.77
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 97.76
1x5o_A114 RNA binding motif, single-stranded interacting pro 97.75
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 96.92
2f3j_A177 RNA and export factor binding protein 2; RRM domai 97.71
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.7
3q2s_C229 Cleavage and polyadenylation specificity factor S; 97.7
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 97.69
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.69
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 97.68
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 97.66
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.66
2i2y_A150 Fusion protein consists of immunoglobin G- binding 97.65
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.64
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.61
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 97.6
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.58
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 97.55
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 97.55
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 97.55
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 97.54
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.53
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 97.53
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.52
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 97.51
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.47
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.46
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 97.46
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.44
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.42
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 97.42
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 97.35
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 97.35
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 97.35
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 97.34
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.29
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.26
2dit_A112 HIV TAT specific factor 1 variant; structural geno 97.25
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 97.22
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.21
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 97.05
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 97.03
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 96.98
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 96.94
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 96.91
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 96.78
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 96.76
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 96.76
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 96.74
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 96.71
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 96.54
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 96.49
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 96.45
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 96.04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 95.96
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 95.72
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 95.69
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 95.67
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 95.61
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 95.31
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 94.28
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 94.01
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 91.66
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 91.25
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 87.54
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 87.37
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
Probab=98.68  E-value=9e-08  Score=76.29  Aligned_cols=82  Identities=15%  Similarity=0.235  Sum_probs=64.6

Q ss_pred             CCCCCceEEEEccCCCc--CCHHHHHHHHHhhcCCceeEEEeeecCCCCCCCceEEEEecchhhHHHHhCCCCeeeEEEc
Q 038714          230 VPPDERTIFLTFSKGYP--ISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSIN  307 (319)
Q Consensus       230 ~~~d~Rt~FvTFS~G~P--vse~ei~~fF~~~yGdcie~v~mq~~~~~~~qplfariVf~s~~~v~~vL~g~~~~kf~In  307 (319)
                      .+++.||+||   +|.|  ++++||+++|.+ ||. |+.|.|-..+.+++..+||+|.|.+.+....++....   ..++
T Consensus        21 ~~~~~~~lfV---~nLp~~~te~~L~~~F~~-~G~-i~~v~i~~~~~tg~~kg~afV~f~~~~~A~~Ai~~~~---~~l~   92 (109)
T 2rs2_A           21 MGSSGCKMFI---GGLSWQTTQEGLREYFGQ-FGE-VKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSR---HELD   92 (109)
T ss_dssp             -----CCEEE---ESCCTTCCHHHHHHHHTT-TSC-EEEEEECCCTTTCCCTTCEEEEESSHHHHHHHHHSSC---EEET
T ss_pred             cCCCCCEEEE---eCCCCCCCHHHHHHHHHc-cCC-eEEEEEEECCCCCCcCcEEEEEECCHHHHHHHHHHCC---CcCC
Confidence            4677899999   6877  999999999986 999 6666665543678999999999999999999987643   6899


Q ss_pred             CceeEEEeccCC
Q 038714          308 GKHKIIQILKNN  319 (319)
Q Consensus       308 gkhiWarky~pk  319 (319)
                      |+.+-++...|+
T Consensus        93 g~~l~V~~a~~~  104 (109)
T 2rs2_A           93 SKTIDPKVAFPR  104 (109)
T ss_dssp             TEEEEEEECCCC
T ss_pred             CEEEEEEEccCC
Confidence            999988876654
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.9
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.77
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.74
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.61
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.6
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.58
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.51
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.48
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.44
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.42
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.42
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.42
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.38
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.37
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.37
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.37
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.36
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.35
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.33
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.3
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.29
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.29
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.28
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.27
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.26
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.26
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.25
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.23
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.23
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.22
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.22
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.22
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.22
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.22
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.21
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.19
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.19
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.19
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.18
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.15
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.14
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.14
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.14
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.11
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.06
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.06
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.03
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.03
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.02
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.02
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.98
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 97.95
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.95
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.94
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.92
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.86
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.82
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.8
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.8
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 97.78
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.74
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.73
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.73
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.68
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 97.62
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 97.58
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 97.52
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 97.52
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 97.51
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 97.47
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 97.47
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.46
d2cpja186 Non-POU domain-containing octamer-binding protein, 97.4
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 97.24
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.19
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 97.17
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 97.15
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.02
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.01
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 96.97
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.92
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 96.9
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 96.63
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 96.38
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 94.02
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 93.11
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.90  E-value=2.6e-09  Score=80.60  Aligned_cols=79  Identities=13%  Similarity=0.300  Sum_probs=65.0

Q ss_pred             CCCCceEEEEccCCCc--CCHHHHHHHHHhhcCCceeEEEeeecCCCCCCCceEEEEecchhhHHHHhCCCCeeeEEEcC
Q 038714          231 PPDERTIFLTFSKGYP--ISENEIRDFFIRKFGECFEAINMQEVASSTEQPLFARLVMDSASFMDVVLGGKSKAKFSING  308 (319)
Q Consensus       231 ~~d~Rt~FvTFS~G~P--vse~ei~~fF~~~yGdcie~v~mq~~~~~~~qplfariVf~s~~~v~~vL~g~~~~kf~Ing  308 (319)
                      |++.|++||   +|.|  +++++|++||.+ ||+ |+.|.|-....+++..+||.|.|.+++..+.+|.....   .|+|
T Consensus         3 pe~~~~lfV---~nlp~~~te~~l~~~F~~-~G~-i~~v~i~~d~~tg~~kG~afV~f~~~~~a~~ai~~~~~---~i~G   74 (84)
T d1l3ka1           3 PEQLRKLFI---GGLSFETTDESLRSHFEQ-WGT-LTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPH---KVDG   74 (84)
T ss_dssp             CGGGGEEEE---ESCCTTCCHHHHHHHHGG-GSC-EEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSC---EETT
T ss_pred             CCCCcEEEE---ECCCCCCCHHHHHHHHHh-hcc-ccceeecccccCCCcccEEEEEEcCHHHHHHHHHhCCC---EECC
Confidence            677899999   8988  999999999975 999 55665544337789999999999999999999975432   5799


Q ss_pred             ceeEEEecc
Q 038714          309 KHKIIQILK  317 (319)
Q Consensus       309 khiWarky~  317 (319)
                      |.+=+++.+
T Consensus        75 r~i~V~~A~   83 (84)
T d1l3ka1          75 RVVEPKRAV   83 (84)
T ss_dssp             EECEEEECC
T ss_pred             EEEEEEeee
Confidence            999888754
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure