Citrus Sinensis ID: 038739


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------
RIPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCESGEAPTNEDHTEGSEESLFSGASDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILEKLGMQQKATRRRRRRRN
cccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccEEEcccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEccccccEEccccccccccccccEEccccccEEEccccccccccccEEEccccccEEcccHHHHHcccccEEEccccccEEEccccccccccccccEEEccccEEEEEcccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccccccccccccccHHHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccc
cccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccccHcHcccccccEEEEccccccccccHHHHHccccccEEEccccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEEcccccccccccHHHccccccccccccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccc
ripsslgnlsKLLHLDLSLNElqgelpvsvgnlhsleeldlsanflssewpisignlsslkeldlsqnrffgelpismgnlgslkvldlsqngyfgelpTSIRNLFSLEKldlsfnnfsgefpwstgnfsslklldlrscgfwgkvphsignfTQLQylhlgsnnfsgdllgpignlrslEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYiglrscnltkfpnflqnqhhlrfmdlsdnriqgkvpkwlldpnmqnlngfnfshnlltgfdqhpvvlpgnkgplpvpppgtitylasnnsltgeipswiCNLNILESLVLSHnnlsgllpqclgnfsDELLVLDLqgnnlplskgcesgeaptnedhtegseeslfsgasDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILEKLGMQQKATRRRRRRRN
ripsslgnlSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLtkatsdttsqklKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCESGEAPTNEDHTEGSEESLFSGASDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILeklgmqqkatrrrrrrrn
RIPsslgnlskllhldlslnelQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHpvvlpgnkgplpvpppgTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCESGEAPTNEDHTEGSEESLFSGASDWKIILTgyvgglvaglvlgFNFSTGIIRWILEKLGMQQKATrrrrrrrN
**********KLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNN***************************SGASDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILEKLG**************
RIPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCESGEAPTN*************GASDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILEKLGMQQ****R******
RIPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKG********************FSGASDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILEKLG**************
*IPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCESGEAPTNEDHTEGSEESLFSGASDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILEKLGMQQKATRRRR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RIPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCESGEAPTNEDHTEGSEESLFSGASDWKIILTGYVGGLVAGLVLGFNFSTGIIRWILEKLGMQQKATRRRRRRRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query477 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.830 0.467 0.348 4e-43
C0LGS2 1136 Probable LRR receptor-lik no no 0.947 0.397 0.296 2e-40
O82318 960 Probably inactive leucine no no 0.895 0.444 0.306 2e-38
Q9FZ59 1088 Leucine-rich repeat recep no no 0.788 0.345 0.330 3e-37
Q9M0G7 1013 Leucine-rich repeat recep no no 0.811 0.382 0.333 6e-37
C0LGV1 1135 LRR receptor-like serine/ no no 0.792 0.333 0.351 6e-37
Q8VZG8 1045 Probable LRR receptor-lik no no 0.809 0.369 0.318 9e-37
C0LGQ5 1249 LRR receptor-like serine/ no no 0.790 0.301 0.349 1e-36
P93194 1109 Receptor-like protein kin N/A no 0.752 0.323 0.335 1e-36
O49318 1124 Probable leucine-rich rep no no 0.823 0.349 0.319 2e-36
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  176 bits (446), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 149/427 (34%), Positives = 211/427 (49%), Gaps = 31/427 (7%)

Query: 1   RIPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSL 60
            IPSSLGNLS L  ++L  N+  GE+P S+GNL+ L  L L+ N L+ E P S+GNLS L
Sbjct: 125 EIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRL 184

Query: 61  KELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSG 120
             L+L  NR  G++P S+G+L  L+ L L+ N   GE+P+S+ NL +L  L L+ N   G
Sbjct: 185 VNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVG 244

Query: 121 EFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSL 180
           E P S GN   L+++   +    G +P S  N T+L    L SNNF+      +    +L
Sbjct: 245 EVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNL 304

Query: 181 EAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRL 240
           E  +V+  +FSG    SL  +  L ++ L +N + G IE     +S K L+ L L  NRL
Sbjct: 305 EYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTK-LQDLILGRNRL 363

Query: 241 SVLTKATSDTTSQ--KLKYIGLRSCNLT-KFPNFLQNQHHLRFMDLSDNRIQGKVPKWLL 297
                   ++ S+   L+ + +   N T   P  +    +L  +DLS N ++G+VP  L 
Sbjct: 364 H---GPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACL- 419

Query: 298 DPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASN-NSLTGEIPSWI 356
                 LN    SHN  + F+                    I  L  N NS  G IP  I
Sbjct: 420 ----WRLNTMVLSHNSFSSFEN------------TSQEEALIEELDLNSNSFQGPIPYMI 463

Query: 357 CNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNN----LP--LSKGCESGEAPT 410
           C L+ L  L LS+N  SG +P C+ NFS  +  L+L  NN    LP   SK  E      
Sbjct: 464 CKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDV 523

Query: 411 NEDHTEG 417
           + +  EG
Sbjct: 524 SHNQLEG 530




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query477
359485824 973 PREDICTED: receptor-like protein 12-like 0.798 0.391 0.441 1e-71
147818103 785 hypothetical protein VITISV_003452 [Viti 0.851 0.517 0.417 5e-69
359490156 886 PREDICTED: receptor-like protein 12-like 0.809 0.435 0.408 2e-68
147766212 925 hypothetical protein VITISV_018438 [Viti 0.838 0.432 0.414 3e-66
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.842 0.400 0.368 4e-65
224140505 993 predicted protein [Populus trichocarpa] 0.807 0.387 0.402 3e-63
147794486 1924 hypothetical protein VITISV_000631 [Viti 0.796 0.197 0.430 2e-62
225447578 1946 PREDICTED: uncharacterized protein LOC10 0.828 0.202 0.418 3e-62
224140513 947 predicted protein [Populus trichocarpa] 0.901 0.454 0.352 7e-59
224128143 923 predicted protein [Populus trichocarpa] 0.823 0.425 0.375 1e-58
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  276 bits (707), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 175/396 (44%), Positives = 227/396 (57%), Gaps = 15/396 (3%)

Query: 22  LQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNL 81
           L GE P+ +  L SL+ L +  N     +       S LK LDL+   F GELP S+G L
Sbjct: 235 LHGEFPMKIFQLPSLQYLTVRDNLDLISYLPEFQETSPLKMLDLAGTSFSGELPTSIGRL 294

Query: 82  GSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCG 141
           GSL  LD+S   + G +P+S+ +L  L  LDLS N+FSG+ P S  N + L  L L    
Sbjct: 295 GSLTELDISSCNFTGSVPSSLGHLTQLYYLDLSNNHFSGQIPSSMANLTQLIYLSLSWND 354

Query: 142 FWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNL 201
           F       +G  T+L YL+L   N  G++   + N+  L  ++++    SGQI SSL  L
Sbjct: 355 FNVGTLSWLGQQTKLTYLYLNQINLIGEIPFSLVNMSQLNILSLSDNQLSGQIPSSLFEL 414

Query: 202 SQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLR 261
             L  L L  N   G +EL  LL+  KNL +L LS NRLS L+   ++ T  K K++GL 
Sbjct: 415 VNLQGLYLLSNYLNGTVELQ-LLSKLKNLIYLQLSDNRLSFLSYTRTNATLPKFKHLGLG 473

Query: 262 SCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHP 321
           SCNLT+FP+FLQNQH L  + LS+N+I G +PKW+ + + + L     S N LTGFDQ P
Sbjct: 474 SCNLTEFPDFLQNQHELEIITLSENKIHGPIPKWVWNISKETLVTLELSENFLTGFDQRP 533

Query: 322 VVLPGNK------------GPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSH 369
            VLP +K            GPLPVPPP T+ YL S N LTGEI   ICN+  LE L LS 
Sbjct: 534 FVLPWSKLHTLRLDSNMLQGPLPVPPPSTVEYLVSGNKLTGEISPLICNMTSLELLDLSS 593

Query: 370 NNLSGLLPQCLGNFSDELLVLDLQGNNL--PLSKGC 403
           NNLSG +PQCL NFS  L VLDL  N+L  P+ + C
Sbjct: 594 NNLSGRIPQCLANFSRSLFVLDLGSNSLDGPIPEIC 629




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147818103|emb|CAN73568.1| hypothetical protein VITISV_003452 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766212|emb|CAN63381.1| hypothetical protein VITISV_018438 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140505|ref|XP_002323623.1| predicted protein [Populus trichocarpa] gi|222868253|gb|EEF05384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147794486|emb|CAN71611.1| hypothetical protein VITISV_000631 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447578|ref|XP_002270154.1| PREDICTED: uncharacterized protein LOC100264911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140513|ref|XP_002323627.1| predicted protein [Populus trichocarpa] gi|222868257|gb|EEF05388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224128143|ref|XP_002329092.1| predicted protein [Populus trichocarpa] gi|222869761|gb|EEF06892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query477
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.756 0.377 0.349 4.4e-49
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.750 0.400 0.370 5.4e-49
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.767 0.388 0.357 6.5e-48
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.765 0.417 0.347 3.5e-47
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.769 0.360 0.346 6.1e-47
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.771 0.374 0.330 3.1e-46
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.765 0.420 0.336 1.1e-45
TAIR|locus:2119445 719 AT4G13820 [Arabidopsis thalian 0.781 0.518 0.340 4.7e-44
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.687 0.461 0.339 1.5e-43
TAIR|locus:2046585 808 RLP27 "receptor like protein 2 0.712 0.420 0.366 2.1e-43
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 520 (188.1 bits), Expect = 4.4e-49, P = 4.4e-49
 Identities = 140/401 (34%), Positives = 201/401 (50%)

Query:    24 GELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGS 83
             G++P S+GNL +L  LDLS N  S + P  IGNLS L  L L  N F GE+P S GNL  
Sbjct:   231 GQIPSSIGNLSNLTTLDLSNNNFSGQIPSFIGNLSQLTFLGLFSNNFVGEIPSSFGNLNQ 290

Query:    84 LKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFW 143
             L  L +  N   G  P  + NL  L  L LS N F+G  P +  + S+L   D     F 
Sbjct:   291 LTRLYVDDNKLSGNFPNVLLNLTGLSLLSLSNNKFTGTLPPNITSLSNLMDFDASDNAFT 350

Query:   144 GKVPHSIGNFTQLQYLHLGSNNFSGDL-LGPIGNLRSLEAINVAKCNFSGQITSSLRNLS 202
             G  P  +     L Y+ L  N   G L  G I +  +L  +++   NF G I SS+  L 
Sbjct:   351 GTFPSFLFTIPSLTYIRLNGNQLKGTLEFGNISSPSNLYELDIGNNNFIGPIPSSISKLV 410

Query:   203 QLTALDLAQNSYRG-------------------------MIELDVLLTSWKNLEFLGLSL 237
             +L  LD++  + +G                          I+L+  L+ +K L  L LS 
Sbjct:   411 KLFRLDISHLNTQGPVDFSIFSHLKSLLDLNISHLNTTTRIDLNYFLSYFKRLLLLDLSG 470

Query:   238 NRLSVLTKAT-SDTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWL 296
             N +S   K++ SD  SQ ++ + L  C +T+FP F++ QH L F+D+S+N+I+G+VP WL
Sbjct:   471 NHVSATNKSSVSDPPSQLIQSLYLSGCGITEFPEFVRTQHELGFLDISNNKIKGQVPDWL 530

Query:   297 LDPNMQNLNGFNFSHNLLTGFDQHXXXXXXXXXXXXXXXXXTITYLASNNSLTGEIPSWI 356
                 +  L   N S+N L GF +                   +  L SNN+  G+IPS+I
Sbjct:   531 W--RLPILYYVNLSNNTLIGFQRPSKPEPSL-----------LYLLGSNNNFIGKIPSFI 577

Query:   357 CNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNL 397
             C L  L +L LS NN +G +P+C+G+    L VL+L+ N+L
Sbjct:   578 CGLRSLNTLDLSDNNFNGSIPRCMGHLKSTLSVLNLRQNHL 618


GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00029112001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (1311 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-23
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  178 bits (453), Expect = 2e-48
 Identities = 144/424 (33%), Positives = 210/424 (49%), Gaps = 31/424 (7%)

Query: 1   RIPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSL 60
           +IP+SL NL+ L  L L+ N+L G++P  +G + SL+ + L  N LS E P  IG L+SL
Sbjct: 179 KIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSL 238

Query: 61  KELDLSQNRFFGELPISMGNLGSLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSG 120
             LDL  N   G +P S+GNL +L+ L L QN   G +P SI +L  L  LDLS N+ SG
Sbjct: 239 NHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG 298

Query: 121 EFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIGNLRSL 180
           E P       +L++L L S  F GK+P ++ +  +LQ L L SN FSG++   +G   +L
Sbjct: 299 EIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNL 358

Query: 181 EAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRL 240
             ++++  N +G+I   L +   L  L L  NS  G I     L + ++L  + L  N  
Sbjct: 359 TVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKS--LGACRSLRRVRLQDNSF 416

Query: 241 SVLTKATSDTTSQKLKY-IGLRSCNLT-KFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLD 298
           S   +  S+ T   L Y + + + NL  +  +   +   L+ + L+ N+  G +P     
Sbjct: 417 S--GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGS 474

Query: 299 PNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYLASNNSLTGEIPSWICN 358
             ++NL   + S N  +G       +P   G L       +    S N L+GEIP  + +
Sbjct: 475 KRLENL---DLSRNQFSG------AVPRKLGSL----SELMQLKLSENKLSGEIPDELSS 521

Query: 359 LNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCESGEAPTNEDHTEGS 418
              L SL LSHN LSG +P         L  LDL  N L       SGE P N     G+
Sbjct: 522 CKKLVSLDLSHNQLSGQIPASFSEMP-VLSQLDLSQNQL-------SGEIPKN----LGN 569

Query: 419 EESL 422
            ESL
Sbjct: 570 VESL 573


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 477
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PLN03150623 hypothetical protein; Provisional 99.37
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.35
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
PLN03150623 hypothetical protein; Provisional 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.05
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.6
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.57
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.36
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.16
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.98
PRK15386 426 type III secretion protein GogB; Provisional 97.98
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.97
PRK15386426 type III secretion protein GogB; Provisional 97.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.87
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.85
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.77
KOG4341483 consensus F-box protein containing LRR [General fu 97.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.59
KOG4341483 consensus F-box protein containing LRR [General fu 97.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.45
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.04
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.97
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.71
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.4
KOG4308478 consensus LRR-containing protein [Function unknown 94.31
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.31
KOG4308478 consensus LRR-containing protein [Function unknown 94.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.63
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.2
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.2
smart0037026 LRR Leucine-rich repeats, outliers. 91.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.29
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.34
smart0037026 LRR Leucine-rich repeats, outliers. 89.24
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.24
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.3
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.74
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 85.71
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.63
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.74
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.1e-49  Score=433.50  Aligned_cols=395  Identities=33%  Similarity=0.465  Sum_probs=200.9

Q ss_pred             CccCCCCCCCCEEEccCCCCCCCccccccCCCCCCEEEcccccCCccccccCCCCCCCCEEecccCcCcccCCcccCCCC
Q 038739            3 PSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLG   82 (477)
Q Consensus         3 p~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~   82 (477)
                      |..++++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+++++
T Consensus       157 p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~  236 (968)
T PLN00113        157 PNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLT  236 (968)
T ss_pred             ChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCC
Confidence            33444444444444444444444444444444444444444444444444444444444444444444444444444444


Q ss_pred             CCCEEeCcCCCCCCcccccccCCCCccEEEccCCcCcCCCCccccCCCCCCEEEccCCCCcccCCccccCCCCCcEEECC
Q 038739           83 SLKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLG  162 (477)
Q Consensus        83 ~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~  162 (477)
                      +|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..+.++++|++|+++
T Consensus       237 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~  316 (968)
T PLN00113        237 SLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLF  316 (968)
T ss_pred             CCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECC
Confidence            44444444444444444444444444444444444444444444444444444444444444444444444444444444


Q ss_pred             CCcCCCcCCcCCCCCCCCCEEEccCCccccccchhhhcCCCCCEEeCcCCcCccccchhhhhcCCCCCCEEeCCCCCCcc
Q 038739          163 SNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSV  242 (477)
Q Consensus       163 ~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~ls~n~i~~  242 (477)
                      +|.+++..|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|.+.+..+..  +..+++|+.|++++|.+..
T Consensus       317 ~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~--~~~~~~L~~L~l~~n~l~~  394 (968)
T PLN00113        317 SNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEG--LCSSGNLFKLILFSNSLEG  394 (968)
T ss_pred             CCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChh--HhCcCCCCEEECcCCEecc
Confidence            44444444444444444444554444444444444444444444554444444333322  2333333333333332211


Q ss_pred             ccccCCc-cCcCcccEEEccCCCCC-CcchhhhcCCCcCEEeccCCcccccCCccCCcccCCCCCeEEec----------
Q 038739          243 LTKATSD-TTSQKLKYIGLRSCNLT-KFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFS----------  310 (477)
Q Consensus       243 ~~~~~~~-~~~~~L~~L~L~~n~l~-~~p~~l~~~~~L~~L~Ls~n~i~~~~p~~~~~~~l~~L~~L~Ls----------  310 (477)
                        ..+.. ..+++|+.|++++|.++ .+|..+..+++|+.|++++|++++.+|..+.  .+++|+.|+++          
T Consensus       395 --~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~--~l~~L~~L~L~~n~~~~~~p~  470 (968)
T PLN00113        395 --EIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW--DMPSLQMLSLARNKFFGGLPD  470 (968)
T ss_pred             --cCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc--cCCCCcEEECcCceeeeecCc
Confidence              11111 13445555555555552 3455555555555555555555555544433  34444444444          


Q ss_pred             -------------CCcccccCCCCc---------ccCCC--CCCCCCC---CCccceeecCCCcCccCCChhhhccCCCC
Q 038739          311 -------------HNLLTGFDQHPV---------VLPGN--KGPLPVP---PPGTITYLASNNSLTGEIPSWICNLNILE  363 (477)
Q Consensus       311 -------------~N~l~~~~~~~~---------~l~~n--~~~~~~~---~~~l~~L~ls~n~l~~~~p~~~~~l~~L~  363 (477)
                                   +|++++..+..+         ++++|  .+.+|..   +++|+.|++++|.+++.+|..+..+++|+
T Consensus       471 ~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  550 (968)
T PLN00113        471 SFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLS  550 (968)
T ss_pred             ccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCC
Confidence                         444444333221         34444  3344432   35677777777777777777777777777


Q ss_pred             eEeCCCCcCcccCCchhhhcccccceeecCCCcCCcccCCC
Q 038739          364 SLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNLPLSKGCE  404 (477)
Q Consensus       364 ~LdLs~N~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~p~~  404 (477)
                      .|||++|++++.+|..+..++ +|++|++++|++.|.+|..
T Consensus       551 ~L~Ls~N~l~~~~p~~l~~l~-~L~~l~ls~N~l~~~~p~~  590 (968)
T PLN00113        551 QLDLSQNQLSGEIPKNLGNVE-SLVQVNISHNHLHGSLPST  590 (968)
T ss_pred             EEECCCCcccccCChhHhcCc-ccCEEeccCCcceeeCCCc
Confidence            777777777777777777776 7777777777777777754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-24
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 8e-24
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-07
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 3e-06
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 8e-06
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 1e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-05
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 5e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 5e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 6e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 6e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 8e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 8e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 102 bits (255), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 118/386 (30%), Positives = 181/386 (46%), Gaps = 48/386 (12%) Query: 28 VSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVL 87 V V +LE LD+S+N S+ P +G+ S+L+ LD+S N+ G+ ++ LK+L Sbjct: 191 VDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLL 249 Query: 88 DLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFP-WSTGNFSSLKLLDLRSCGFWGKV 146 ++S N + G +P L SL+ L L+ N F+GE P + +G +L LDL F+G V Sbjct: 250 NISSNQFVGPIPP--LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAV 307 Query: 147 PHSIGNFTQLQYLHLGSNNFSGDL-LGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQ-L 204 P G+ + L+ L L SNNFSG+L + + +R L+ ++++ FSG++ SL NLS L Sbjct: 308 PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASL 367 Query: 205 TALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCN 264 LDL+ N++ G I ++ L+ L L N + Sbjct: 368 LTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFT----------------------- 404 Query: 265 LTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHXXXX 324 K P L N L + LS N + G +P L ++ L N+L G Sbjct: 405 -GKIPPTLSNCSELVSLHLSFNYLSGTIPSSL--GSLSKLRDLKLWLNMLEGEIPQELMY 461 Query: 325 XXXXXXXXXXXXXTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFS 384 T + N LTGEIPS + N L + LS+N L+G +P+ +G Sbjct: 462 VKTLE----------TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL- 510 Query: 385 DELLVLDLQGN----NLPLSKG-CES 405 + L +L L N N+P G C S Sbjct: 511 ENLAILKLSNNSFSGNIPAELGDCRS 536
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query477
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-79
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-77
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-73
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-72
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-53
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-42
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-47
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-43
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  268 bits (687), Expect = 6e-82
 Identities = 125/410 (30%), Positives = 180/410 (43%), Gaps = 38/410 (9%)

Query: 2   IPSSLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWP--ISIGNLSS 59
           + SSL +L+ L  L LS + + G +        SL  LDLS N LS       S+G+ S 
Sbjct: 69  VSSSLLSLTGLESLFLSNSHINGSVS-GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSG 127

Query: 60  LKELDLSQNRFFGELPISMG-NLGSLKVLDLSQNGYFGELPTSIR---NLFSLEKLDLSF 115
           LK L++S N       +S G  L SL+VLDLS N   G              L+ L +S 
Sbjct: 128 LKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISG 187

Query: 116 NNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSGDLLGPIG 175
           N  SG+         +L+ LD+ S  F   +P  +G+ + LQ+L +  N  SGD    I 
Sbjct: 188 NKISGDVDV--SRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAIS 244

Query: 176 NLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGL 235
               L+ +N++   F G I      L  L  L LA+N + G I    L  +   L  L L
Sbjct: 245 TCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDF-LSGACDTLTGLDL 301

Query: 236 SLNRLS-----VLTKATSDTTSQKLKYIGLRSCNLT-KFP-NFLQNQHHLRFMDLSDNRI 288
           S N             +       L+ + L S N + + P + L     L+ +DLS N  
Sbjct: 302 SGNHFYGAVPPFFGSCSL------LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF 355

Query: 289 QGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNKGPLPVPPPGTITYL-ASNNS 347
            G++P+ L + +  +L   + S N  +G       +  N       P  T+  L   NN 
Sbjct: 356 SGELPESLTNLSA-SLLTLDLSSNNFSG------PILPNLCQN---PKNTLQELYLQNNG 405

Query: 348 LTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGNNL 397
            TG+IP  + N + L SL LS N LSG +P  LG+ S +L  L L  N L
Sbjct: 406 FTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNML 454


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query477
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.71
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.63
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.62
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.59
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.3
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.43
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.58
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.8e-52  Score=444.66  Aligned_cols=392  Identities=33%  Similarity=0.448  Sum_probs=266.0

Q ss_pred             cCCCCCCCCEEEccCCCCCCCccccccCCCCCCEEEcccccCCccccccCCCCCCCCEEecccCcCcccCCcccCCC-CC
Q 038739            5 SLGNLSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNL-GS   83 (477)
Q Consensus         5 ~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l-~~   83 (477)
                      .++++++|++|++++|.+++.+|..+.++++|++|++++|.+++..|..  .+++|++|++++|.+++.+|..+... ++
T Consensus       218 ~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~  295 (768)
T 3rgz_A          218 FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDT  295 (768)
T ss_dssp             BCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTT
T ss_pred             ccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCc
Confidence            3889999999999999999888989999999999999998887766543  66777777777777766666666553 67


Q ss_pred             CCEEeCcCCCCCCcccccccCCCCccEEEccCCcCcCCCCcc-ccCCCCCCEEEccCCCCcccCCccccC----------
Q 038739           84 LKVLDLSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWS-TGNFSSLKLLDLRSCGFWGKVPHSIGN----------  152 (477)
Q Consensus        84 L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~~~l~~L~~L~L~~n~~~~~~~~~l~~----------  152 (477)
                      |++|++++|++++.+|..++++++|++|++++|.+++.+|.. +..+++|++|++++|.+.+.+|..+..          
T Consensus       296 L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~L  375 (768)
T 3rgz_A          296 LTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDL  375 (768)
T ss_dssp             CSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEEC
T ss_pred             CCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEc
Confidence            777777777766666666666666666666666666555544 566666666666666665555554443          


Q ss_pred             -----------------CCCCcEEECCCCcCCCcCCcCCCCCCCCCEEEccCCccccccchhhhcCCCCCEEeCcCCcCc
Q 038739          153 -----------------FTQLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYR  215 (477)
Q Consensus       153 -----------------l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~  215 (477)
                                       +++|++|++++|.+++.+|..+..+++|++|++++|.+++.+|..+..+++|+.|++++|.+.
T Consensus       376 s~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~  455 (768)
T 3rgz_A          376 SSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE  455 (768)
T ss_dssp             CSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCC
T ss_pred             cCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCccc
Confidence                             445566666666665566666666777777777777777677777777777777777777777


Q ss_pred             cccchhhhhcCCCCCCEEeCCCCCCccccccCCc-cCcCcccEEEccCCCCC-CcchhhhcCCCcCEEeccCCcccccCC
Q 038739          216 GMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSD-TTSQKLKYIGLRSCNLT-KFPNFLQNQHHLRFMDLSDNRIQGKVP  293 (477)
Q Consensus       216 ~~~~~~~~~~~~~~L~~L~ls~n~i~~~~~~~~~-~~~~~L~~L~L~~n~l~-~~p~~l~~~~~L~~L~Ls~n~i~~~~p  293 (477)
                      +..+..  +..+++|++|++++|++...  .+.. ..+++|++|++++|+++ .+|.++..+++|++|++++|++++.+|
T Consensus       456 ~~~p~~--~~~l~~L~~L~L~~N~l~~~--~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p  531 (768)
T 3rgz_A          456 GEIPQE--LMYVKTLETLILDFNDLTGE--IPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP  531 (768)
T ss_dssp             SCCCGG--GGGCTTCCEEECCSSCCCSC--CCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECC
T ss_pred             CcCCHH--HcCCCCceEEEecCCcccCc--CCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCC
Confidence            666655  66777777777777755432  2222 25677888888888885 677888888888888888888888888


Q ss_pred             ccCCcccCCCCCeEEecCCcccccCCCCcc--------------------------------------------------
Q 038739          294 KWLLDPNMQNLNGFNFSHNLLTGFDQHPVV--------------------------------------------------  323 (477)
Q Consensus       294 ~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~--------------------------------------------------  323 (477)
                      ..+.  .+++|+.|++++|+++|.+|..+.                                                  
T Consensus       532 ~~l~--~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  609 (768)
T 3rgz_A          532 AELG--DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST  609 (768)
T ss_dssp             GGGG--GCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGG
T ss_pred             HHHc--CCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcccc
Confidence            8777  788888888888888876554320                                                  


Q ss_pred             -----cCCC--CCCCCCC---CCccceeecCCCcCccCCChhhhccCCCCeEeCCCCcCcccCCchhhhcccccceeecC
Q 038739          324 -----LPGN--KGPLPVP---PPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQ  393 (477)
Q Consensus       324 -----l~~n--~~~~~~~---~~~l~~L~ls~n~l~~~~p~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~~L~~L~Ls  393 (477)
                           +..+  .|.+|..   ++.++.|++++|+++|.+|..++++++|+.|||++|+++|.+|..++.++ +|++|||+
T Consensus       610 ~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~-~L~~LdLs  688 (768)
T 3rgz_A          610 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLR-GLNILDLS  688 (768)
T ss_dssp             TCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT-TCCEEECC
T ss_pred             ccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCC-CCCEEECC
Confidence                 0001  1111111   23455666666666666666666666666666666666666666666665 56666666


Q ss_pred             CCcCCcccCCCC
Q 038739          394 GNNLPLSKGCES  405 (477)
Q Consensus       394 ~N~l~~~~p~~~  405 (477)
                      +|+++|.+|...
T Consensus       689 ~N~l~g~ip~~l  700 (768)
T 3rgz_A          689 SNKLDGRIPQAM  700 (768)
T ss_dssp             SSCCEECCCGGG
T ss_pred             CCcccCcCChHH
Confidence            666666666544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 477
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 80.5 bits (197), Expect = 2e-17
 Identities = 58/291 (19%), Positives = 91/291 (31%), Gaps = 14/291 (4%)

Query: 35  SLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLDLSQNGY 94
            L  +  S   L     +          LDL  N+          NL +L  L L  N  
Sbjct: 11  HLRVVQCSDLGLEK---VPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKI 67

Query: 95  FGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFT 154
               P +   L  LE+L LS N               L++ +         V + +    
Sbjct: 68  SKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMI 127

Query: 155 QLQYLHLGSNNFSGDLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSY 214
            +  L       SG   G    ++ L  I +A  N +   T        LT L L  N  
Sbjct: 128 VV-ELGTNPLKSSGIENGAFQGMKKLSYIRIADTNIT---TIPQGLPPSLTELHLDGNKI 183

Query: 215 RGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATSDTTSQKLKYIGLRSCNLTKFPNFLQN 274
             +      L    NL  LGLS           S   +  L+ + L +  L K P  L +
Sbjct: 184 TKVDAAS--LKGLNNLAKLGLS-FNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLAD 240

Query: 275 QHHLRFMDLSDNRIQGKVPKWLLDP----NMQNLNGFNFSHNLLTGFDQHP 321
             +++ + L +N I          P       + +G +   N +  ++  P
Sbjct: 241 HKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQP 291


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query477
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.47
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.97  E-value=4.6e-29  Score=243.28  Aligned_cols=341  Identities=23%  Similarity=0.297  Sum_probs=199.4

Q ss_pred             CCCCCEEEccCCCCCCCccccccCCCCCCEEEcccccCCccccccCCCCCCCCEEecccCcCcccCCcccCCCCCCCEEe
Q 038739            9 LSKLLHLDLSLNELQGELPVSVGNLHSLEELDLSANFLSSEWPISIGNLSSLKELDLSQNRFFGELPISMGNLGSLKVLD   88 (477)
Q Consensus         9 l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~   88 (477)
                      +.+|++|+++++.|+. + +.+..+++|++|++++|++++..+  ++++++|++|++++|++.+..  .++++++|+.|+
T Consensus        43 l~~l~~L~l~~~~I~~-l-~gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n~i~~i~--~l~~l~~L~~L~  116 (384)
T d2omza2          43 LDQVTTLQADRLGIKS-I-DGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIADIT--PLANLTNLTGLT  116 (384)
T ss_dssp             HTTCCEEECCSSCCCC-C-TTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCG--GGTTCTTCCEEE
T ss_pred             hCCCCEEECCCCCCCC-c-cccccCCCCCEEeCcCCcCCCCcc--ccCCccccccccccccccccc--cccccccccccc
Confidence            4566777777776663 2 245666677777777777665432  666777777777777665332  256667777777


Q ss_pred             CcCCCCCCcccccccCCCCccEEEccCCcCcCCCCccccCCCCCCEEEccCCCCcccCCccccCCCCCcEEECCCCcCCC
Q 038739           89 LSQNGYFGELPTSIRNLFSLEKLDLSFNNFSGEFPWSTGNFSSLKLLDLRSCGFWGKVPHSIGNFTQLQYLHLGSNNFSG  168 (477)
Q Consensus        89 Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~  168 (477)
                      ++++.+++..+  ......+.......|.+....+................     .....+...+.........|... 
T Consensus       117 ~~~~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~-  188 (384)
T d2omza2         117 LFNNQITDIDP--LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQV-----TDLKPLANLTTLERLDISSNKVS-  188 (384)
T ss_dssp             CCSSCCCCCGG--GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESC-----CCCGGGTTCTTCCEEECCSSCCC-
T ss_pred             ccccccccccc--cccccccccccccccccccccccccccccccccccccc-----chhhhhccccccccccccccccc-
Confidence            76666644322  23344555555555544322111111111111111110     11122333344444444444332 


Q ss_pred             cCCcCCCCCCCCCEEEccCCccccccchhhhcCCCCCEEeCcCCcCccccchhhhhcCCCCCCEEeCCCCCCccccccCC
Q 038739          169 DLLGPIGNLRSLEAINVAKCNFSGQITSSLRNLSQLTALDLAQNSYRGMIELDVLLTSWKNLEFLGLSLNRLSVLTKATS  248 (477)
Q Consensus       169 ~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~~L~ls~n~i~~~~~~~~  248 (477)
                       .......+++++.+++++|.+++..+  ...+++|++|++++|.++....    +..+++|+.+++++|.+...+.   
T Consensus       189 -~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~~~----l~~l~~L~~L~l~~n~l~~~~~---  258 (384)
T d2omza2         189 -DISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDIGT----LASLTNLTDLDLANNQISNLAP---  258 (384)
T ss_dssp             -CCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCCGG----GGGCTTCSEEECCSSCCCCCGG---
T ss_pred             -cccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCcch----hhcccccchhccccCccCCCCc---
Confidence             22334556666677777766664433  3455667777777776655432    4556667777777765554432   


Q ss_pred             ccCcCcccEEEccCCCCCCcchhhhcCCCcCEEeccCCcccccCCccCCcccCCCCCeEEecCCcccccCCCCcccCCCC
Q 038739          249 DTTSQKLKYIGLRSCNLTKFPNFLQNQHHLRFMDLSDNRIQGKVPKWLLDPNMQNLNGFNFSHNLLTGFDQHPVVLPGNK  328 (477)
Q Consensus       249 ~~~~~~L~~L~L~~n~l~~~p~~l~~~~~L~~L~Ls~n~i~~~~p~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~n~  328 (477)
                      ...+++|++|+++++.++.++. +..++.++.+++++|++.+. + .+.  .+++++.|++++|++++..+         
T Consensus       259 ~~~~~~L~~L~l~~~~l~~~~~-~~~~~~l~~l~~~~n~l~~~-~-~~~--~~~~l~~L~ls~n~l~~l~~---------  324 (384)
T d2omza2         259 LSGLTKLTELKLGANQISNISP-LAGLTALTNLELNENQLEDI-S-PIS--NLKNLTYLTLYFNNISDISP---------  324 (384)
T ss_dssp             GTTCTTCSEEECCSSCCCCCGG-GTTCTTCSEEECCSSCCSCC-G-GGG--GCTTCSEEECCSSCCSCCGG---------
T ss_pred             ccccccCCEeeccCcccCCCCc-cccccccccccccccccccc-c-ccc--hhcccCeEECCCCCCCCCcc---------
Confidence            2234567777777777766653 55666777777777776642 2 233  56677777777777765421         


Q ss_pred             CCCCCCCCccceeecCCCcCccCCChhhhccCCCCeEeCCCCcCcccCCchhhhcccccceeecCCC
Q 038739          329 GPLPVPPPGTITYLASNNSLTGEIPSWICNLNILESLVLSHNNLSGLLPQCLGNFSDELLVLDLQGN  395 (477)
Q Consensus       329 ~~~~~~~~~l~~L~ls~n~l~~~~p~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~~L~~L~Ls~N  395 (477)
                         ...+++|+.|++++|++++ ++ .+.++++|++||+++|++++..|  +.+++ +|++|+|++|
T Consensus       325 ---l~~l~~L~~L~L~~n~l~~-l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~-~L~~L~L~~N  383 (384)
T d2omza2         325 ---VSSLTKLQRLFFANNKVSD-VS-SLANLTNINWLSAGHNQISDLTP--LANLT-RITQLGLNDQ  383 (384)
T ss_dssp             ---GGGCTTCCEEECCSSCCCC-CG-GGGGCTTCCEEECCSSCCCBCGG--GTTCT-TCSEEECCCE
T ss_pred             ---cccCCCCCEEECCCCCCCC-Ch-hHcCCCCCCEEECCCCcCCCChh--hccCC-CCCEeeCCCC
Confidence               1235667777777777764 34 68899999999999999997655  78898 9999999988



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure