Citrus Sinensis ID: 038788

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MNTIRNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP
ccccccccEEEccccccccccccEEEccccccccccccccccHHcccccccccEEEcccccccccccHHHHHHHHccccEEccccEEEEcccHHcccccccccccccccccccHHHHccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccHHHHcccccccccccccccHHHHccccccEEEccccccccccc
cccccccccccccHHHcccccccEEEcccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEcccccccccccHHHcccccccEEEcccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHccccHHHEEEcccccccccccHHHcccccccEEEcccccccccccHHccccccEEEEcccccccccccHHHcccccccEEEccccccccccc
MNTIRNIFSGkvsinfgglqnlswlnlgknnlgtwttnDLHFITFLTNCTKLGVLVLDanrfggalpfsLANLSTTMtgiaignnqiscfipdgiaNLVNLNALGVEFNQLAVTILKSLQMLFLHENilqgtipcslgnlTMLTQRLLEVNDllgnippsigncknlillttrknkpsgtmprqlprIITLSVLLNLSdnllsghfpaevgklknlisldissnmfsseisttlgctsLEYLCMqdnsfigsipstlssLKSITELDlscnnlsghip
MNTIRNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTtrknkpsgtmprqLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITEldlscnnlsghip
MNTIRNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITlsvllnlsdnllsGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP
****RNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTR**********QLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITELD***********
MNTIRNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP
MNTIRNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP
*NT*RNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTIRNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query278 2.2.26 [Sep-21-2011]
C0LGT6 1031 LRR receptor-like serine/ yes no 0.974 0.262 0.435 4e-48
Q9SD62 1025 Putative receptor-like pr no no 0.974 0.264 0.442 8e-42
C0LGP4 1010 Probable LRR receptor-lik no no 0.938 0.258 0.411 1e-39
C0LGV1 1135 LRR receptor-like serine/ no no 0.949 0.232 0.370 6e-29
O49318 1124 Probable leucine-rich rep no no 0.877 0.217 0.361 8e-29
Q9LP24 1120 Probable leucine-rich rep no no 0.953 0.236 0.328 4e-27
Q9SHI2 1101 Leucine-rich repeat recep no no 0.978 0.247 0.317 6e-26
Q9FL28 1173 LRR receptor-like serine/ no no 0.974 0.231 0.305 2e-25
Q9LVP0 1102 Probable leucine-rich rep no no 0.884 0.223 0.315 3e-25
C0LGR3 1091 Probable LRR receptor-lik no no 0.935 0.238 0.305 2e-24
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function desciption
 Score =  191 bits (486), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 176/280 (62%), Gaps = 9/280 (3%)

Query: 6   NIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGA 65
           N  SG + ++FG L+NL WL +  N+LG  +++ L FI  + NCT+L  L +  NR GG 
Sbjct: 300 NYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGE 359

Query: 66  LPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFN----QLAVTILK--SL 119
           LP S+ANLSTT+T + +G N IS  IP  I NLV+L  L +E N    +L V+  K  +L
Sbjct: 360 LPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNL 419

Query: 120 QMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSG 179
           Q++ L+ N + G IP   GN+T L +  L  N   G IP S+G C+ L+ L    N+ +G
Sbjct: 420 QVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNG 479

Query: 180 TMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTL-GCTS 238
           T+P+++ +I +L+  ++LS+N L+GHFP EVGKL+ L+ L  S N  S ++   + GC S
Sbjct: 480 TIPQEILQIPSLAY-IDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLS 538

Query: 239 LEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP 278
           +E+L MQ NSF G+IP  +S L S+  +D S NNLSG IP
Sbjct: 539 MEFLFMQGNSFDGAIPD-ISRLVSLKNVDFSNNNLSGRIP 577
Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Reduces transformation by Rhizobium radiobacter probably by inducing plant defense during the interaction. Binding to the effector AvrPto1 from P.syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
224115346 1017 predicted protein [Populus trichocarpa] 0.982 0.268 0.503 1e-57
357497599 1002 CCP [Medicago truncatula] gi|355494103|g 0.942 0.261 0.501 2e-57
357484501 1006 Kinase-like protein [Medicago truncatula 0.996 0.275 0.473 1e-54
255577438 1028 receptor-kinase, putative [Ricinus commu 0.996 0.269 0.456 3e-54
356529793 922 PREDICTED: probable LRR receptor-like se 0.971 0.292 0.496 1e-53
449499190 1023 PREDICTED: LOW QUALITY PROTEIN: probable 0.978 0.265 0.478 9e-53
449441592 1023 PREDICTED: probable LRR receptor-like se 0.978 0.265 0.478 9e-53
224116466 1008 predicted protein [Populus trichocarpa] 0.978 0.269 0.460 2e-52
357505893 1003 Receptor kinase-like protein [Medicago t 0.967 0.268 0.460 3e-52
255553269 2793 receptor-kinase, putative [Ricinus commu 0.982 0.097 0.471 3e-52
>gi|224115346|ref|XP_002317009.1| predicted protein [Populus trichocarpa] gi|222860074|gb|EEE97621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 184/280 (65%), Gaps = 7/280 (2%)

Query: 6   NIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGA 65
           N FSGK+S+NFGGL++L+ ++L  N +G+    +L F+  L NCT L  + +  N F G 
Sbjct: 307 NSFSGKLSVNFGGLKHLAVVSLSFNKMGSGEPGELSFLDSLINCTSLYAIDIVGNHFEGM 366

Query: 66  LPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTI------LKSL 119
           LP SL NLST +T + +G NQ+   I  GI NL+NLN LG+EFNQL+  I      L+ L
Sbjct: 367 LPNSLGNLSTGLTFLGLGQNQLFGGIHSGIGNLINLNTLGLEFNQLSGPIPLDIGKLRML 426

Query: 120 QMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSG 179
           Q   L  N L G IP S+GNLT+L +  L+ N L G IP SIGNC+ L+LL   +N  SG
Sbjct: 427 QRFSLSYNRLSGHIPSSIGNLTLLLEFDLQGNQLQGTIPSSIGNCQKLLLLHLSRNNLSG 486

Query: 180 TMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLG-CTS 238
             P++L  I +LSV L+LS N  +G  P+E+G LK+L  L++S N FS EI +TL  CTS
Sbjct: 487 NAPKELFAISSLSVSLDLSQNYFNGSLPSEIGSLKSLAKLNVSYNEFSGEIPSTLASCTS 546

Query: 239 LEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP 278
           LEYL MQ N F GSIPS+ S+L+ I +LDLS NNLSG IP
Sbjct: 547 LEYLYMQHNFFQGSIPSSFSTLRGIQKLDLSHNNLSGQIP 586

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357497599|ref|XP_003619088.1| CCP [Medicago truncatula] gi|355494103|gb|AES75306.1| CCP [Medicago truncatula] Back     alignment and taxonomy information
>gi|357484501|ref|XP_003612538.1| Kinase-like protein [Medicago truncatula] gi|355513873|gb|AES95496.1| Kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255577438|ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis] gi|223530931|gb|EEF32790.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356529793|ref|XP_003533472.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Back     alignment and taxonomy information
>gi|449499190|ref|XP_004160745.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441592|ref|XP_004138566.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224116466|ref|XP_002331904.1| predicted protein [Populus trichocarpa] gi|222874576|gb|EEF11707.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357505893|ref|XP_003623235.1| Receptor kinase-like protein [Medicago truncatula] gi|355498250|gb|AES79453.1| Receptor kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255553269|ref|XP_002517677.1| receptor-kinase, putative [Ricinus communis] gi|223543309|gb|EEF44841.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.974 0.262 0.414 1.1e-47
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.974 0.264 0.414 7.4e-46
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.982 0.266 0.417 3e-44
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.978 0.269 0.377 9.4e-43
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.974 0.268 0.378 3.2e-42
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.982 0.335 0.378 1.5e-40
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.971 0.267 0.385 2.2e-40
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.949 0.232 0.352 1.9e-30
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.953 0.236 0.335 1.4e-29
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.956 0.234 0.327 2.7e-28
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 508 (183.9 bits), Expect = 1.1e-47, P = 1.1e-47
 Identities = 116/280 (41%), Positives = 164/280 (58%)

Query:     6 NIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGA 65
             N  SG + ++FG L+NL WL +  N+LG  +++ L FI  + NCT+L  L +  NR GG 
Sbjct:   300 NYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGE 359

Query:    66 LPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTI------LKSL 119
             LP S+ANLSTT+T + +G N IS  IP  I NLV+L  L +E N L+  +      L +L
Sbjct:   360 LPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNL 419

Query:   120 QMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSG 179
             Q++ L+ N + G IP   GN+T L +  L  N   G IP S+G C+ L+ L    N+ +G
Sbjct:   420 QVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNG 479

Query:   180 TMPRQLPRIITXXXXXXXXXXXXXGHFPAEVGKLKNLISLDISSNMFSSEISTTLG-CTS 238
             T+P+++ +I               GHFP EVGKL+ L+ L  S N  S ++   +G C S
Sbjct:   480 TIPQEILQI-PSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLS 538

Query:   239 LEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP 278
             +E+L MQ NSF G+IP  +S L S+  +D S NNLSG IP
Sbjct:   539 MEFLFMQGNSFDGAIPD-ISRLVSLKNVDFSNNNLSGRIP 577
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0010204 "defense response signaling pathway, resistance gene-independent" evidence=IMP
GO:0016045 "detection of bacterium" evidence=RCA;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0002764 "immune response-regulating signaling pathway" evidence=IMP
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0019199 "transmembrane receptor protein kinase activity" evidence=TAS
GO:0010359 "regulation of anion channel activity" evidence=IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009581 "detection of external stimulus" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0050776 "regulation of immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XI.617.1
hypothetical protein (973 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-19
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  116 bits (293), Expect = 2e-29
 Identities = 94/298 (31%), Positives = 131/298 (43%), Gaps = 51/298 (17%)

Query: 6   NIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGA 65
           N+ SG++  + G   +L  L+LG N L             LTN T L  L L +N+  G 
Sbjct: 150 NMLSGEIPNDIGSFSSLKVLDLGGNVLVG------KIPNSLTNLTSLEFLTLASNQLVGQ 203

Query: 66  LPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTILKSLQMLFLH 125
           +P  L  + + +  I +G N +S  IP  I  L +LN L + +N L              
Sbjct: 204 IPRELGQMKS-LKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLT------------- 249

Query: 126 ENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQL 185
                G IP SLGNL  L    L  N L G IPPSI + + LI L    N  SG +P  +
Sbjct: 250 -----GPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELV 304

Query: 186 PRIITLSVL-----------------------LNLSDNLLSGHFPAEVGKLKNLISLDIS 222
            ++  L +L                       L L  N  SG  P  +GK  NL  LD+S
Sbjct: 305 IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLS 364

Query: 223 SNMFSSEISTTLGCTS--LEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP 278
           +N  + EI   L C+S  L  L +  NS  G IP +L + +S+  + L  N+ SG +P
Sbjct: 365 TNNLTGEIPEGL-CSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELP 421

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 278
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.4
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
PLN03150623 hypothetical protein; Provisional 99.15
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
PLN03150623 hypothetical protein; Provisional 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.73
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.63
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.23
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.19
PRK15386 426 type III secretion protein GogB; Provisional 98.16
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.91
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.79
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.71
KOG4341483 consensus F-box protein containing LRR [General fu 97.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.33
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.12
KOG4341483 consensus F-box protein containing LRR [General fu 97.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.98
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.72
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.66
KOG4308478 consensus LRR-containing protein [Function unknown 95.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.34
KOG4308478 consensus LRR-containing protein [Function unknown 95.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.89
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.85
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.6
smart0037026 LRR Leucine-rich repeats, outliers. 92.38
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.38
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.41
KOG0473 326 consensus Leucine-rich repeat protein [Function un 86.67
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.24
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.98
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.48
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.8e-34  Score=267.75  Aligned_cols=270  Identities=38%  Similarity=0.532  Sum_probs=139.1

Q ss_pred             CCCcccccceeccccccCcccccEEecCCCCCCCccCCCccccccccCCCCccEEEeecccccccCCchhhcccccccEE
Q 038788            1 MNTIRNIFSGKVSINFGGLQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGI   80 (278)
Q Consensus         1 L~l~~n~~~~~~~~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L   80 (278)
                      ||+++|.+.+.+|..++.+++|++|++++|.+.+..      +..+.++++|++|++++|.+.+.+|..+.++.. |++|
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~------p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~-L~~L  217 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKI------PNSLTNLTSLEFLTLASNQLVGQIPRELGQMKS-LKWI  217 (968)
T ss_pred             EECcCCcccccCChHHhcCCCCCEEECccCcccccC------ChhhhhCcCCCeeeccCCCCcCcCChHHcCcCC-ccEE
Confidence            355555555556666666666666666666555432      233445555555555555555445555554444 5555


Q ss_pred             EeecCeeeecCCccccccCCcceecccccccchhh------hccccEEEeecccccccCCCCCCCcccccEEEcccCccc
Q 038788           81 AIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTI------LKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLL  154 (278)
Q Consensus        81 ~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~------~~~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~  154 (278)
                      ++++|.+++..|..+..+++|+.|++++|.+....      +++|++|++++|.+.+..|..+..+++|++|++++|.+.
T Consensus       218 ~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~  297 (968)
T PLN00113        218 YLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS  297 (968)
T ss_pred             ECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeec
Confidence            55555555444555555555555555555443211      344455555555444444444444444555555544444


Q ss_pred             ccCCcCccCCCCCcEEEeecCcCcccCCCCcccccccceeEEccCCcCcccCchhhhcCCCCCEEEc-------------
Q 038788          155 GNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDI-------------  221 (278)
Q Consensus       155 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~~L~l~~n~~~~~~~~~~~~~~~L~~L~L-------------  221 (278)
                      +..|..+..+++|+.|++++|.+++..|..+..+++| +.|++++|.+.+..|..+..+++|+.|++             
T Consensus       298 ~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L-~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~  376 (968)
T PLN00113        298 GEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRL-QVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGL  376 (968)
T ss_pred             cCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCC-CEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhH
Confidence            4444444444444444444444444444444444444 44444444444444444444444444444             


Q ss_pred             -----------cCCeecccCCCccC-CCCccEEEccCCeecccCCccccCCCCCcEEECCCCcccccCC
Q 038788          222 -----------SSNMFSSEISTTLG-CTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP  278 (278)
Q Consensus       222 -----------~~n~~~~~~~~~~~-~~~L~~l~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p  278 (278)
                                 ++|.+.+..+..+. +++|+.+++++|.+.+.+|..+..++.|+.+++++|+++|.+|
T Consensus       377 ~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~  445 (968)
T PLN00113        377 CSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRIN  445 (968)
T ss_pred             hCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccC
Confidence                       44444443333333 5666666666666666666666666666666666666666543

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-15
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-10
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-05
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-04
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 3e-04
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-04
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-04
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-04
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 108/243 (44%), Gaps = 13/243 (5%)
Query: 46  LTNCTKLGVLVLDANRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALG 105
           ++ C  L  L + +N F   +PF L + S  +  + I  N++S      I+    L  L 
Sbjct: 193 VSRCVNLEFLDVSSNNFSTGIPF-LGDCSA-LQHLDISGNKLSGDFSRAISTCTELKLLN 250
Query: 106 VEFNQLAVTI----LKSLQMLFLHENILQGTIPCSL-GNLTMLTQRLLEVNDLLGNIPPS 160
           +  NQ    I    LKSLQ L L EN   G IP  L G    LT   L  N   G +PP 
Sbjct: 251 ISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF 310
Query: 161 IGNCKNLILLTTRKNKPSGTMPRQLPRIITXXXXXXXXXXXXXGHFPAEVGKLK-NLISL 219
            G+C  L  L    N  SG +P      +              G  P  +  L  +L++L
Sbjct: 311 FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 370
Query: 220 DISSNMFSSEISTTLGCT----SLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSG 275
           D+SSN FS  I   L C     +L+ L +Q+N F G IP TLS+   +  L LS N LSG
Sbjct: 371 DLSSNNFSGPILPNL-CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG 429
Query: 276 HIP 278
            IP
Sbjct: 430 TIP 432
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-50
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-35
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 5e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 9e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  175 bits (447), Expect = 2e-50
 Identities = 81/283 (28%), Positives = 116/283 (40%), Gaps = 23/283 (8%)

Query: 6   NIFSGKVSINFGGLQNLSWLNLGKNNL-GTWTTNDLHFITFLTNCTKLGVLVLDANRFGG 64
           N  SG +  + G L  L  L L  N L G            L     L  L+LD N   G
Sbjct: 428 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGE-------IPQELMYVKTLETLILDFNDLTG 480

Query: 65  ALPFSLANLSTTMTGIAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVTI------LKS 118
            +P  L+N  T +  I++ NN+++  IP  I  L NL  L +  N  +  I       +S
Sbjct: 481 EIPSGLSNC-TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRS 539

Query: 119 LQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKP- 177
           L  L L+ N+  GTIP ++   +      +  N + G     I N           N   
Sbjct: 540 LIWLDLNTNLFNGTIPAAMFKQS----GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLE 595

Query: 178 -SGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLG- 235
             G    QL R+ T +   N++  +  GH         +++ LD+S NM S  I   +G 
Sbjct: 596 FQGIRSEQLNRLSTRNPC-NITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGS 654

Query: 236 CTSLEYLCMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP 278
              L  L +  N   GSIP  +  L+ +  LDLS N L G IP
Sbjct: 655 MPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIP 697
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.98
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.21
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.06
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.87
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.82
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.81
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.43
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.82
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-38  Score=291.04  Aligned_cols=269  Identities=33%  Similarity=0.501  Sum_probs=222.6

Q ss_pred             CCcccccceeccccccC--cccccEEecCCCCCCCccCCCccccccccCCCCccEEEeecccccccCCchhhcccccccE
Q 038788            2 NTIRNIFSGKVSINFGG--LQNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDANRFGGALPFSLANLSTTMTG   79 (278)
Q Consensus         2 ~l~~n~~~~~~~~~~~~--l~~L~~l~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~   79 (278)
                      |+++|+++|.+|..+..  +++|++|++++|++++      .++..+.++++|++|++++|.+++.+|..+..+.. |++
T Consensus       374 ~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~------~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~-L~~  446 (768)
T 3rgz_A          374 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG------KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK-LRD  446 (768)
T ss_dssp             ECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEE------ECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTT-CCE
T ss_pred             EccCCCcCCCcChhhhhcccCCccEEECCCCcccc------ccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCC-CCE
Confidence            44444444444444443  4445555555555544      23456788888999999999888888888888877 999


Q ss_pred             EEeecCeeeecCCccccccCCcceecccccccchh------hhccccEEEeecccccccCCCCCCCcccccEEEcccCcc
Q 038788           80 IAIGNNQISCFIPDGIANLVNLNALGVEFNQLAVT------ILKSLQMLFLHENILQGTIPCSLGNLTMLTQRLLEVNDL  153 (278)
Q Consensus        80 L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~------~~~~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~  153 (278)
                      |++++|++++..|..+..+++|+.|++++|++...      .+++|++|++++|.+.+..|.+++.+++|++|++++|.+
T Consensus       447 L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l  526 (768)
T 3rgz_A          447 LKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSF  526 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCC
T ss_pred             EECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcc
Confidence            99999988888888888899999999999887632      278899999999999888888899999999999999999


Q ss_pred             cccCCcCccCCCCCcEEEeecCcCcccCCCCc------------------------------------------------
Q 038788          154 LGNIPPSIGNCKNLILLTTRKNKPSGTMPRQL------------------------------------------------  185 (278)
Q Consensus       154 ~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~------------------------------------------------  185 (278)
                      .+.+|..+..+++|+.|++++|.+++.+|..+                                                
T Consensus       527 ~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  606 (768)
T 3rgz_A          527 SGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNR  606 (768)
T ss_dssp             EEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGG
T ss_pred             cCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhc
Confidence            88889889999999999999988776655432                                                


Q ss_pred             ----------------------ccccccceeEEccCCcCcccCchhhhcCCCCCEEEccCCeecccCCCccC-CCCccEE
Q 038788          186 ----------------------PRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLG-CTSLEYL  242 (278)
Q Consensus       186 ----------------------~~~~~L~~~L~l~~n~~~~~~~~~~~~~~~L~~L~L~~n~~~~~~~~~~~-~~~L~~l  242 (278)
                                            ..++.+ +.+++++|.+++.+|..++.++.|+.|++++|.+++.+|..+. +++|+.|
T Consensus       607 l~~~~~~~l~~~~~~g~~~~~~~~l~~L-~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~L  685 (768)
T 3rgz_A          607 LSTRNPCNITSRVYGGHTSPTFDNNGSM-MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNIL  685 (768)
T ss_dssp             GGGTCCSCTTSCEEEEECCCSCSSSBCC-CEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEE
T ss_pred             cccccccccccceecccCchhhhccccc-cEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEE
Confidence                                  334567 8899999999999999999999999999999999988887776 9999999


Q ss_pred             EccCCeecccCCccccCCCCCcEEECCCCcccccCC
Q 038788          243 CMQDNSFIGSIPSTLSSLKSITELDLSCNNLSGHIP  278 (278)
Q Consensus       243 ~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~p  278 (278)
                      ++++|++++.+|..+.+++.|++|++++|+++|.||
T Consensus       686 dLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP  721 (768)
T 3rgz_A          686 DLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP  721 (768)
T ss_dssp             ECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECC
T ss_pred             ECCCCcccCcCChHHhCCCCCCEEECcCCcccccCC
Confidence            999999999999999999999999999999999998
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 278
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 56.9 bits (136), Expect = 6e-10
 Identities = 53/192 (27%), Positives = 75/192 (39%), Gaps = 18/192 (9%)

Query: 84  NNQISCFIPDGIANLVNLNALGVEFNQL----AVTILKSLQMLFLHENILQGTIPCSLGN 139
           NNQIS   P GI    NL+ L +  NQL     +  L +L  L L  N +    P  L  
Sbjct: 206 NNQISDITPLGILT--NLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP--LSG 261

Query: 140 LTMLTQRLLEVNDLLGNIPPSIGNCKNLILLTTRKNKPSGTMPRQLPRIITLSVLLNLSD 199
           LT LT+  L  N +    P        L  LT  +   +          +     L L  
Sbjct: 262 LTKLTELKLGANQISNISP-----LAGLTALTNLELNENQLEDISPISNLKNLTYLTLYF 316

Query: 200 NLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLGCTSLEYLCMQDNSFIGSIPSTLSS 259
           N +S   P  V  L  L  L  ++N  S  +S+    T++ +L    N      P  L++
Sbjct: 317 NNISDISP--VSSLTKLQRLFFANNKVSD-VSSLANLTNINWLSAGHNQISDLTP--LAN 371

Query: 260 LKSITELDLSCN 271
           L  IT+L L+  
Sbjct: 372 LTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.4
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.06
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.38
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.97  E-value=2.3e-30  Score=211.40  Aligned_cols=248  Identities=26%  Similarity=0.329  Sum_probs=202.5

Q ss_pred             ccccEEecCCCCCCCccCCCccccccccCCCCccEEEeec-ccccccCCchhhcccccccEEEeecCeeeecCCcccccc
Q 038788           20 QNLSWLNLGKNNLGTWTTNDLHFITFLTNCTKLGVLVLDA-NRFGGALPFSLANLSTTMTGIAIGNNQISCFIPDGIANL   98 (278)
Q Consensus        20 ~~L~~l~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~-~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l   98 (278)
                      .+++.|+++++.+++..    .++..+.++++|++|++++ |.+++.+|..++++.. |++|++++|++.+..+..+..+
T Consensus        50 ~~v~~L~L~~~~l~g~~----~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~-L~~L~Ls~N~l~~~~~~~~~~~  124 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPY----PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQ-LHYLYITHTNVSGAIPDFLSQI  124 (313)
T ss_dssp             CCEEEEEEECCCCSSCE----ECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTT-CSEEEEEEECCEEECCGGGGGC
T ss_pred             EEEEEEECCCCCCCCCC----CCChHHhcCccccccccccccccccccccccccccc-cchhhhccccccccccccccch
Confidence            36899999999888742    3567799999999999986 7888889999999887 9999999999998888889999


Q ss_pred             CCcceecccccccchh------hhccccEEEeecccccccCCCCCCCcccc-cEEEcccCcccccCCcCccCCCCCcEEE
Q 038788           99 VNLNALGVEFNQLAVT------ILKSLQMLFLHENILQGTIPCSLGNLTML-TQRLLEVNDLLGNIPPSIGNCKNLILLT  171 (278)
Q Consensus        99 ~~L~~L~l~~~~l~~~------~~~~L~~l~l~~~~~~~~~~~~~~~~~~L-~~L~l~~n~~~~~~~~~~~~~~~L~~L~  171 (278)
                      ++|+.++++.|.+...      .++.++.+++++|.+.+.+|..+..+..+ +.++++.|.+.+..+..+..+.. ..++
T Consensus       125 ~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~  203 (313)
T d1ogqa_         125 KTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVD  203 (313)
T ss_dssp             TTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEE
T ss_pred             hhhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccccc-cccc
Confidence            9999999998876432      27788888998888887788888777665 77888888888777777766554 4688


Q ss_pred             eecCcCcccCCCCcccccccceeEEccCCcCcccCchhhhcCCCCCEEEccCCeecccCCCccC-CCCccEEEccCCeec
Q 038788          172 TRKNKPSGTMPRQLPRIITLSVLLNLSDNLLSGHFPAEVGKLKNLISLDISSNMFSSEISTTLG-CTSLEYLCMQDNSFI  250 (278)
Q Consensus       172 l~~~~~~~~~~~~~~~~~~L~~~L~l~~n~~~~~~~~~~~~~~~L~~L~L~~n~~~~~~~~~~~-~~~L~~l~l~~n~~~  250 (278)
                      +..+...+..|..+...+++ +.++++++.+.+.. ..+..+++|+.|++++|++++..|..+. +++|++|++++|+++
T Consensus       204 l~~~~~~~~~~~~~~~~~~l-~~l~~~~~~l~~~~-~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~  281 (313)
T d1ogqa_         204 LSRNMLEGDASVLFGSDKNT-QKIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC  281 (313)
T ss_dssp             CCSSEEEECCGGGCCTTSCC-SEEECCSSEECCBG-GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE
T ss_pred             cccccccccccccccccccc-cccccccccccccc-cccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccc
Confidence            88888877788888888888 88889988887544 4567788899999999999877766555 889999999999998


Q ss_pred             ccCCccccCCCCCcEEECCCCc-cccc
Q 038788          251 GSIPSTLSSLKSITELDLSCNN-LSGH  276 (278)
Q Consensus       251 ~~~~~~~~~~~~L~~L~l~~n~-l~~~  276 (278)
                      +.+|. ++++.+|+.+++++|+ ++|.
T Consensus       282 g~iP~-~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         282 GEIPQ-GGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             EECCC-STTGGGSCGGGTCSSSEEEST
T ss_pred             ccCCC-cccCCCCCHHHhCCCccccCC
Confidence            88874 5778888889999887 6664
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure