Citrus Sinensis ID: 038850
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| 255547732 | 141 | DNA binding protein, putative [Ricinus c | 0.948 | 0.524 | 0.786 | 4e-24 | |
| 225425432 | 140 | PREDICTED: nuclear transcription factor | 0.948 | 0.528 | 0.675 | 5e-21 | |
| 224053481 | 123 | predicted protein [Populus trichocarpa] | 0.884 | 0.560 | 0.724 | 8e-21 | |
| 357463021 | 173 | Nuclear transcription factor Y subunit C | 0.935 | 0.421 | 0.698 | 1e-19 | |
| 449452907 | 139 | PREDICTED: nuclear transcription factor | 0.935 | 0.525 | 0.698 | 1e-19 | |
| 356538087 | 168 | PREDICTED: nuclear transcription factor | 0.935 | 0.434 | 0.671 | 5e-19 | |
| 449489251 | 139 | PREDICTED: LOW QUALITY PROTEIN: nuclear | 0.935 | 0.525 | 0.684 | 6e-19 | |
| 15239815 | 130 | nuclear factor Y, subunit C13 [Arabidops | 0.923 | 0.553 | 0.625 | 3e-18 | |
| 297791585 | 131 | hypothetical protein ARALYDRAFT_917343 [ | 0.923 | 0.549 | 0.635 | 1e-17 | |
| 356569178 | 166 | PREDICTED: dr1-associated corepressor ho | 0.807 | 0.379 | 0.714 | 2e-17 |
| >gi|255547732|ref|XP_002514923.1| DNA binding protein, putative [Ricinus communis] gi|223545974|gb|EEF47477.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 115 bits (287), Expect = 4e-24, Method: Compositional matrix adjust.
Identities = 59/75 (78%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
Query: 5 AEEQNT-ETTRPEFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAI 63
AEE+NT ET RPEFP GRVKKI+KLD+DINKVTS+ALF+VSRSTELFLR LAEKSAE A
Sbjct: 2 AEEENTVETIRPEFPTGRVKKIMKLDKDINKVTSDALFLVSRSTELFLRLLAEKSAEVAT 61
Query: 64 EKKRKTIKLGDMRVA 78
E+KRKTIKL +R+A
Sbjct: 62 EQKRKTIKLDHIRIA 76
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225425432|ref|XP_002271716.1| PREDICTED: nuclear transcription factor Y subunit gamma [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224053481|ref|XP_002297836.1| predicted protein [Populus trichocarpa] gi|222845094|gb|EEE82641.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357463021|ref|XP_003601792.1| Nuclear transcription factor Y subunit C-4 [Medicago truncatula] gi|355490840|gb|AES72043.1| Nuclear transcription factor Y subunit C-4 [Medicago truncatula] gi|388508356|gb|AFK42244.1| unknown [Medicago truncatula] gi|388523251|gb|AFK49678.1| nuclear transcription factor Y subunit C9 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449452907|ref|XP_004144200.1| PREDICTED: nuclear transcription factor Y subunit C-1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356538087|ref|XP_003537536.1| PREDICTED: nuclear transcription factor Y subunit C-4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449489251|ref|XP_004158259.1| PREDICTED: LOW QUALITY PROTEIN: nuclear transcription factor Y subunit C-1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15239815|ref|NP_199139.1| nuclear factor Y, subunit C13 [Arabidopsis thaliana] gi|10177387|dbj|BAB10588.1| unnamed protein product [Arabidopsis thaliana] gi|225879084|dbj|BAH30612.1| hypothetical protein [Arabidopsis thaliana] gi|332007548|gb|AED94931.1| nuclear factor Y, subunit C13 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297791585|ref|XP_002863677.1| hypothetical protein ARALYDRAFT_917343 [Arabidopsis lyrata subsp. lyrata] gi|297309512|gb|EFH39936.1| hypothetical protein ARALYDRAFT_917343 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356569178|ref|XP_003552782.1| PREDICTED: dr1-associated corepressor homolog [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| TAIR|locus:2169238 | 130 | NF-YC13 ""nuclear factor Y, su | 0.923 | 0.553 | 0.486 | 4.9e-14 | |
| WB|WBGene00013150 | 179 | Y53F4B.3 [Caenorhabditis elega | 0.935 | 0.407 | 0.287 | 4.8e-07 | |
| FB|FBgn0034726 | 155 | Mes4 "Mesoderm-expressed 4" [D | 0.897 | 0.451 | 0.3 | 5.5e-06 | |
| DICTYBASE|DDB_G0272740 | 158 | DDB_G0272740 "putative histone | 0.5 | 0.246 | 0.410 | 1.1e-05 | |
| UNIPROTKB|E9PI99 | 141 | NFYC "Nuclear transcription fa | 0.807 | 0.446 | 0.285 | 5e-05 | |
| UNIPROTKB|Q5T6K7 | 129 | NFYC "Nuclear transcription fa | 0.807 | 0.488 | 0.285 | 5e-05 | |
| UNIPROTKB|E9PNC7 | 156 | DRAP1 "Dr1-associated corepres | 0.628 | 0.314 | 0.407 | 6.3e-05 | |
| FB|FBgn0034650 | 341 | NC2alpha "Negative Cofactor 2a | 0.910 | 0.208 | 0.328 | 6.9e-05 | |
| TAIR|locus:2114555 | 234 | NF-YC1 ""nuclear factor Y, sub | 0.961 | 0.320 | 0.289 | 7.1e-05 | |
| TAIR|locus:2010980 | 217 | NF-YC3 ""nuclear factor Y, sub | 0.923 | 0.331 | 0.277 | 7.7e-05 |
| TAIR|locus:2169238 NF-YC13 ""nuclear factor Y, subunit C13"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 181 (68.8 bits), Expect = 4.9e-14, P = 4.9e-14
Identities = 35/72 (48%), Positives = 47/72 (65%)
Query: 7 EQNTETTRPEFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLXXXXXXXXXXXX 66
E+ + RPEFP+GRVKKI+KLD+DINK+ SEAL +++ STELFL FL
Sbjct: 2 EEEEGSIRPEFPIGRVKKIMKLDKDINKINSEALHVITYSTELFLHFLAEKSAVVTAEKK 61
Query: 67 XXTIKLGDMRVA 78
T+ L +R+A
Sbjct: 62 RKTVNLDHLRIA 73
|
|
| WB|WBGene00013150 Y53F4B.3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034726 Mes4 "Mesoderm-expressed 4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272740 DDB_G0272740 "putative histone-like transcription factor" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PI99 NFYC "Nuclear transcription factor Y subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T6K7 NFYC "Nuclear transcription factor Y subunit gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PNC7 DRAP1 "Dr1-associated corepressor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034650 NC2alpha "Negative Cofactor 2alpha" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2114555 NF-YC1 ""nuclear factor Y, subunit C1"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010980 NF-YC3 ""nuclear factor Y, subunit C3"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| pfam00808 | 65 | pfam00808, CBFD_NFYB_HMF, Histone-like transcripti | 7e-15 | |
| COG5247 | 113 | COG5247, BUR6, Class 2 transcription repressor NC2 | 7e-07 | |
| COG5208 | 286 | COG5208, HAP5, CCAAT-binding factor, subunit C [Tr | 1e-06 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 9e-05 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 0.001 |
| >gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone | Back alignment and domain information |
|---|
Score = 61.9 bits (151), Expect = 7e-15
Identities = 22/63 (34%), Positives = 41/63 (65%)
Query: 16 EFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAIEKKRKTIKLGDM 75
E P+ RVK+I+K D D +++ +A +++ E F+ F+A ++AE ++KRKTI +
Sbjct: 2 ELPIARVKRIMKSDPDAGRISQDAKELIAECVEEFIEFIASEAAEICKKEKRKTINAEHI 61
Query: 76 RVA 78
++A
Sbjct: 62 KLA 64
|
This family includes archaebacterial histones and histone like transcription factors from eukaryotes. Length = 65 |
| >gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|227533 COG5208, HAP5, CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 99.91 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 99.78 | |
| KOG1657 | 236 | consensus CCAAT-binding factor, subunit C (HAP5) [ | 99.78 | |
| KOG1659 | 224 | consensus Class 2 transcription repressor NC2, alp | 99.72 | |
| COG5247 | 113 | BUR6 Class 2 transcription repressor NC2, alpha su | 99.69 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 99.34 | |
| KOG1658 | 162 | consensus DNA polymerase epsilon, subunit C [Repli | 99.31 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 99.29 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 99.27 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 99.23 | |
| KOG0870 | 172 | consensus DNA polymerase epsilon, subunit D [Trans | 99.19 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 99.15 | |
| smart00414 | 106 | H2A Histone 2A. | 99.15 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.07 | |
| PTZ00017 | 134 | histone H2A; Provisional | 99.05 | |
| PLN00154 | 136 | histone H2A; Provisional | 99.04 | |
| smart00417 | 74 | H4 Histone H4. | 98.99 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 98.96 | |
| PLN00153 | 129 | histone H2A; Provisional | 98.95 | |
| PLN00156 | 139 | histone H2AX; Provisional | 98.94 | |
| PLN00157 | 132 | histone H2A; Provisional | 98.94 | |
| PLN00035 | 103 | histone H4; Provisional | 98.92 | |
| KOG1756 | 131 | consensus Histone 2A [Chromatin structure and dyna | 98.89 | |
| PTZ00015 | 102 | histone H4; Provisional | 98.86 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 98.84 | |
| PTZ00252 | 134 | histone H2A; Provisional | 98.81 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 98.57 | |
| smart00428 | 105 | H3 Histone H3. | 98.49 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 98.44 | |
| COG5150 | 148 | Class 2 transcription repressor NC2, beta subunit | 98.17 | |
| KOG1757 | 131 | consensus Histone 2A [Chromatin structure and dyna | 98.14 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 98.12 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 97.99 | |
| PLN00121 | 136 | histone H3; Provisional | 97.98 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 97.97 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 97.96 | |
| PLN00160 | 97 | histone H3; Provisional | 97.95 | |
| PTZ00018 | 136 | histone H3; Provisional | 97.95 | |
| PLN00161 | 135 | histone H3; Provisional | 97.9 | |
| PF15510 | 102 | CENP-W: Centromere kinetochore component W | 97.89 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 97.75 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 97.72 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 97.57 | |
| smart00427 | 89 | H2B Histone H2B. | 97.53 | |
| KOG1658 | 162 | consensus DNA polymerase epsilon, subunit C [Repli | 97.34 | |
| PLN00158 | 116 | histone H2B; Provisional | 97.24 | |
| PTZ00463 | 117 | histone H2B; Provisional | 97.22 | |
| KOG1745 | 137 | consensus Histones H3 and H4 [Chromatin structure | 97.15 | |
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 97.12 | |
| KOG3219 | 195 | consensus Transcription initiation factor TFIID, s | 97.11 | |
| PLN00155 | 58 | histone H2A; Provisional | 96.97 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 96.96 | |
| KOG1744 | 127 | consensus Histone H2B [Chromatin structure and dyn | 96.53 | |
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 96.52 | |
| cd07978 | 92 | TAF13 The TATA Binding Protein (TBP) Associated Fa | 96.44 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 96.31 | |
| KOG3467 | 103 | consensus Histone H4 [Chromatin structure and dyna | 95.83 | |
| KOG2549 | 576 | consensus Transcription initiation factor TFIID, s | 95.04 | |
| KOG1142 | 258 | consensus Transcription initiation factor TFIID, s | 94.39 | |
| PF03540 | 51 | TFIID_30kDa: Transcription initiation factor TFIID | 93.91 | |
| PF05236 | 264 | TAF4: Transcription initiation factor TFIID compon | 93.47 | |
| COG5095 | 450 | TAF6 Transcription initiation factor TFIID, subuni | 93.35 | |
| KOG3423 | 176 | consensus Transcription initiation factor TFIID, s | 93.25 | |
| cd08045 | 212 | TAF4 TATA Binding Protein (TBP) Associated Factor | 91.27 | |
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 90.58 | |
| PF10979 | 43 | DUF2786: Protein of unknown function (DUF2786); In | 85.03 | |
| PF12767 | 252 | SAGA-Tad1: Transcriptional regulator of RNA polII, | 80.21 |
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
Probab=99.91 E-value=1.9e-24 Score=125.58 Aligned_cols=63 Identities=38% Similarity=0.621 Sum_probs=58.4
Q ss_pred CCChHHHHHHhhcCcCccccchHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCccCchhhhcC
Q 038850 16 EFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAIEKKRKTIKLGDMRVA 78 (78)
Q Consensus 16 ~lP~arVkrImK~d~dv~~vs~eA~~~i~~A~ElFi~~L~~~A~~~a~~~~rkti~~~Di~~A 78 (78)
.||+++|+||||.+|++.+||+||.+++++|+|+|+++|+.+|++.|.+++||||+|+||..|
T Consensus 2 ~lP~a~vkri~k~~~~~~~vs~ea~~~i~~a~e~Fi~~l~~~A~~~a~~~~rkti~~~Dv~~A 64 (65)
T PF00808_consen 2 SLPLARVKRIMKSDPDVMRVSKEAVEAIAKAAEEFIQYLAKEANEIAQRDKRKTITYEDVAKA 64 (65)
T ss_dssp SS-HHHHHHHHHHTSTTSEE-HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSEE-HHHHHHH
T ss_pred CCChHHHHHHhccCCCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCccCHHHHHHH
Confidence 699999999999999999999999999999999999999999999999999999999999865
|
The factor is a heteromeric complex of A and B subunits, both of which are required for DNA-binding [, ]. The subunits can interact in the absence of DNA-binding, conserved regions in each being important in mediating this interaction. The A subunit can be split into 3 domains on the basis of sequence similarity, a non-conserved N-terminal 'A domain'; a highly-conserved central 'B domain' involved in DNA-binding; and a C-terminal 'C domain', which contains a number of glutamine and acidic residues involved in protein-protein interactions []. The A subunit shows striking similarity to the HAP3 subunit of the yeast CCAAT-binding heterotrimeric transcription factor [, ]. The Kluyveromyces lactis HAP3 protein has been predicted to contain a 4-cysteine zinc finger, which is thought to be present in similar HAP3 and CBF subunit A proteins, in which the third cysteine is replaced by a serine []. This domain is found in the CCAAT transcription factor and archaeal histones.; GO: 0043565 sequence-specific DNA binding, 0005622 intracellular; PDB: 1F1E_A 2BYM_D 2BYK_D 1HTA_A 1B67_A 1JFI_B 1KU5_B 1N1J_A 1BFM_A 1B6W_A .... |
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] | Back alignment and domain information |
|---|
| >KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] | Back alignment and domain information |
|---|
| >COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >KOG1756 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >KOG1757 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF15510 CENP-W: Centromere kinetochore component W | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] | Back alignment and domain information |
|---|
| >PLN00155 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >KOG1744 consensus Histone H2B [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG3467 consensus Histone H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PF03540 TFIID_30kDa: Transcription initiation factor TFIID 23-30kDa subunit; InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors | Back alignment and domain information |
|---|
| >PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site | Back alignment and domain information |
|---|
| >COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG3423 consensus Transcription initiation factor TFIID, subunit TAF10 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF10979 DUF2786: Protein of unknown function (DUF2786); InterPro: IPR024498 This domain is found in proteins that have no known function | Back alignment and domain information |
|---|
| >PF12767 SAGA-Tad1: Transcriptional regulator of RNA polII, SAGA, subunit; InterPro: IPR024738 The yeast Spt-Ada-Gcn5-Acetyl (SAGA) transferase complex is a multifunctional coactivator involved in multiple cellular processes [], including regulation of transcription by RNA polymerase II [, ] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 78 | ||||
| 1jfi_A | 98 | Crystal Structure Of The Nc2-Tbp-Dna Ternary Comple | 7e-05 | ||
| 1n1j_B | 97 | Crystal Structure Of The Nf-YbNF-Yc Histone Pair Le | 5e-04 | ||
| 4awl_C | 94 | The Nf-y Transcription Factor Is Structurally And F | 5e-04 |
| >pdb|1JFI|A Chain A, Crystal Structure Of The Nc2-Tbp-Dna Ternary Complex Length = 98 | Back alignment and structure |
|
| >pdb|1N1J|B Chain B, Crystal Structure Of The Nf-YbNF-Yc Histone Pair Length = 97 | Back alignment and structure |
| >pdb|4AWL|C Chain C, The Nf-y Transcription Factor Is Structurally And Functionally A Sequence Specific Histone Length = 94 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 4e-16 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 3e-15 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 5e-13 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 1e-05 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 8e-05 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 1e-04 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 3e-04 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 6e-04 |
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 | Back alignment and structure |
|---|
Score = 65.7 bits (160), Expect = 4e-16
Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 5/78 (6%)
Query: 1 MPQEAEEQNTETTRPEFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAE 60
MP + ++ N FP R+KKI++ DE+I KV + I+SR+ ELFL L +K+ +
Sbjct: 1 MPSKKKKYNAR-----FPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQ 55
Query: 61 AAIEKKRKTIKLGDMRVA 78
+ KT+ ++
Sbjct: 56 VTQSRNAKTMTTSHLKQC 73
|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 93 | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Length = 128 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Length = 70 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Length = 68 | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 179 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 99.93 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 99.92 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 99.91 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 99.91 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 99.85 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.84 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 99.79 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.76 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 99.66 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 99.51 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.49 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 99.47 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 99.47 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 99.46 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 99.45 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.43 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 99.42 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 99.42 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 99.31 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 99.31 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 99.27 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 99.26 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 99.25 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 99.24 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 99.11 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 98.77 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 98.52 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 98.52 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 98.34 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 98.31 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 98.24 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 98.23 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 98.19 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 98.13 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 98.09 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 98.09 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 98.07 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 97.97 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 97.94 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 97.9 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 97.89 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 97.86 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 97.85 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 97.84 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 97.82 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 97.59 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 96.91 | |
| 3v9r_B | 88 | MHF2, uncharacterized protein YDL160C-A; histone f | 95.71 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 95.16 | |
| 1wwi_A | 148 | Hypothetical protein TTHA1479; structural genomics | 89.42 | |
| 1h3o_A | 75 | Transcription initiation factor TFIID 135 kDa subu | 86.59 | |
| 1r4v_A | 171 | Hypothetical protein AQ_328; structural genomics, | 83.18 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 81.15 |
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
Probab=99.93 E-value=4.4e-26 Score=146.01 Aligned_cols=74 Identities=24% Similarity=0.468 Sum_probs=68.8
Q ss_pred HhhhcCCCCCCCCChHHHHHHhhcCcCccccchHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCccCchhhhcC
Q 038850 5 AEEQNTETTRPEFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAIEKKRKTIKLGDMRVA 78 (78)
Q Consensus 5 ~e~e~~~~~~~~lP~arVkrImK~d~dv~~vs~eA~~~i~~A~ElFi~~L~~~A~~~a~~~~rkti~~~Di~~A 78 (78)
.|.++.+.+..+||++|||||||.||++++||++|++++++|+|+||++|+..|++.|..++||||+|+||..|
T Consensus 30 ~e~~~~d~k~~~lPvaRIkrImK~d~~~~~is~eA~v~la~a~E~Fi~~L~~~A~~~a~~~krktI~~~di~~A 103 (119)
T 4g92_C 30 LESDNHDYKIHQLPLARIKKVMKADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAAA 103 (119)
T ss_dssp HTCSCCCSSCCSSCHHHHHHHHHTSTTCCEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHH
T ss_pred HHhcccccccCCCCHHHHHHHHhhCCccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCccCHHHHHHH
Confidence 34456677888999999999999999999999999999999999999999999999999999999999999864
|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A | Back alignment and structure |
|---|
| >1h3o_A Transcription initiation factor TFIID 135 kDa subunit; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 78 | ||||
| d1jfia_ | 66 | a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai | 7e-15 | |
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 3e-12 | |
| d1ku5a_ | 66 | a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc | 3e-10 | |
| d2byka1 | 72 | a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophil | 1e-09 | |
| d1n1ja_ | 87 | a.22.1.3 (A:) Nuclear transcription factor Y subun | 2e-09 | |
| d2bykb1 | 89 | a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila | 2e-09 | |
| d1jfib_ | 135 | a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain | 7e-09 | |
| d1htaa_ | 68 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth | 5e-08 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 2e-07 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 0.001 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 1e-04 | |
| d1tzyc_ | 95 | a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), | 0.004 |
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: TBP-associated factors, TAFs domain: Negative cofactor 2, NC2, alpha chain species: Human (Homo sapiens) [TaxId: 9606]
Score = 60.5 bits (147), Expect = 7e-15
Identities = 22/62 (35%), Positives = 36/62 (58%)
Query: 17 FPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAIEKKRKTIKLGDMR 76
FP R+KKI++ DE+I KV + I+SR+ ELFL L +K+ + + KT+ ++
Sbjct: 3 FPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLK 62
Query: 77 VA 78
Sbjct: 63 QC 64
|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 89 | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 99.94 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 99.92 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 99.88 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 99.85 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 99.85 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 99.84 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 99.8 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 99.8 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.68 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.23 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 99.18 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 99.05 | |
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 99.02 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 98.99 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 98.99 | |
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 98.24 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 98.08 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 97.98 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 97.68 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 96.25 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 91.91 | |
| d1h3oa_ | 50 | TAF(II)-135, (TAF(II)-130, hTAF4), histone fold do | 91.31 | |
| d1wwia1 | 148 | Hypothetical protein TTHA1479 {Thermus thermophilu | 90.67 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 89.7 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 88.57 |
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: TBP-associated factors, TAFs domain: Negative cofactor 2, NC2, alpha chain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94 E-value=2.3e-27 Score=136.76 Aligned_cols=63 Identities=35% Similarity=0.587 Sum_probs=58.7
Q ss_pred CCChHHHHHHhhcCcCccccchHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCccCchhhhcC
Q 038850 16 EFPVGRVKKIIKLDEDINKVTSEALFIVSRSTELFLRFLAEKSAEAAIEKKRKTIKLGDMRVA 78 (78)
Q Consensus 16 ~lP~arVkrImK~d~dv~~vs~eA~~~i~~A~ElFi~~L~~~A~~~a~~~~rkti~~~Di~~A 78 (78)
+||++|||||||.||++++||+||++++++|+|+|+++|++.|++.|+.++||||+|+||..|
T Consensus 2 ~fP~srVkkimk~~~~~~~is~~A~~~~~~a~E~Fi~~l~~~A~~~a~~~krktI~~~dl~~a 64 (66)
T d1jfia_ 2 RFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQC 64 (66)
T ss_dssp CCCHHHHHHHHTTSTTCCCBCTTHHHHHHHHHHHHHHHHHHHHHHHHHTC---CBCHHHHHTT
T ss_pred CCChHHHHHHHhcCCccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcCCHHHHHHH
Confidence 799999999999999999999999999999999999999999999999999999999999876
|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h3oa_ a.22.1.3 (A:) TAF(II)-135, (TAF(II)-130, hTAF4), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|