Citrus Sinensis ID: 038900

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISSSREARNEYKISVTFGSNNVSTLTFRSAISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRLPHWLR
cccccEEcccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEcEEEEEEEccccccEEEEEEEccccEEEEEEEEEccccEEEEEEEEEcccccccccEEEEEEEcccccEEEEEEEEccccHHHccccccccccEEccccccccccEEEEEEEEEEccccccc
ccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccEEcccccHHHHHHccccccccccccccccccHHHHHHHHHHHccccEEEEcccEEEEEccccccccEEEEEEccccEEEEEEEEccccccEEEEEEEEEcccccccccEEEEEEEEcccccEEEcccccccHHHHHcccccHcEEEccHHHHccccccEEEEEEEEcccccccc
cenghmvcttcrskikndscpfdrspiaytRNRVIEKLLESVKSVSCKNAEYGCNEMLgylekndhekackhspcscplsgcdflgssSQLYQHFRAQhqnssvpfrydqdfsirldaknDKFLVLlegrddniLFVLHNARsnqqqnglsiSCISSSREARNEYKISVTFGSNNVSTLTFRSAISSSKkqldnlpklgfplvpwlldatdgrlnlkicifkdrlphwlr
cenghmvcttcrskikndscpfdrspiaytrNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNarsnqqqnglsISCISSSREARNEYKISvtfgsnnvstLTFRSAISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIfkdrlphwlr
CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISSSREARNEYKISVTFGSNNVSTLTFRSAISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRLPHWLR
*****MVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNA************C**********YKISVTFGSNNVSTLTFRSA*******LDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRLPHW**
CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISSSREARNEYKISVTFGSN**********************KLGFPLVPWLLDATDGRLNLKICIFKDRLP****
CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISSSREARNEYKISVTFGSNNVSTLTFRSAISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRLPHWLR
CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISSSREARNEYKISVTFGSNNVSTLTFRSAISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISSSREARNEYKISVTFGSNNVSTLTFRSAISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRLPHWLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
Q84K34349 E3 ubiquitin-protein liga yes no 0.926 0.610 0.329 2e-26
Q9FKD9281 Putative E3 ubiquitin-pro no no 0.926 0.758 0.308 1e-23
Q9C6H2303 E3 ubiquitin-protein liga no no 0.926 0.702 0.278 3e-20
Q9C6H3313 E3 ubiquitin-protein liga no no 0.921 0.677 0.288 6e-20
Q9FKD7286 E3 ubiquitin-protein liga no no 0.921 0.741 0.292 2e-19
Q9C9M0329 E3 ubiquitin-protein liga no no 0.582 0.407 0.370 1e-17
Q9FKD5276 Putative E3 ubiquitin-pro no no 0.430 0.358 0.396 1e-16
Q8I147331 E3 ubiquitin-protein liga N/A no 0.691 0.480 0.323 3e-15
P21461314 E3 ubiquitin-protein liga yes no 0.691 0.506 0.323 3e-15
P61093314 E3 ubiquitin-protein liga N/A no 0.691 0.506 0.323 3e-15
>sp|Q84K34|SIL10_ARATH E3 ubiquitin-protein ligase SINA-like 10 OS=Arabidopsis thaliana GN=At5g37930 PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/231 (32%), Positives = 120/231 (51%), Gaps = 18/231 (7%)

Query: 1   CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGY 60
           C+NGH+ CT C +K++N  CP    PI Y R R +EK++E+ + VSC NA+YGC E   Y
Sbjct: 127 CDNGHLACTLCCTKVRN-RCPSCTLPIGYVRCRAMEKVIEASR-VSCLNAKYGCKESTSY 184

Query: 61  LEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKN 120
             +  HE+ C  +PCSCP+  C + G    L  H RA+H++  + F ++   +I LD  N
Sbjct: 185 GNRFSHEQVCVFTPCSCPILDCHYTGYYKDLNNHVRAEHKDDLISFVWNTRLTISLDL-N 243

Query: 121 DKFLVLLEGRDDNILFV-----LHNARSNQQQNGLSISCISSSREARNEYKISVTFGSNN 175
            K  +L E  D +++ V     LH          +S+SCI+         ++S       
Sbjct: 244 KKTTILQEENDGHVIVVQVFRALHAVY-------VSVSCIAPLTPGVG--RLSCRLAKIT 294

Query: 176 VSTLTFRS-AISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRL 225
           V +L  +   + + +K  +  P+ GF L+P  L + +  LNL+I I   R+
Sbjct: 295 VDSLLKQGFMVKNIQKVTNEHPEDGFMLIPSYLFSGNDNLNLQIWIGHGRI 345
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9FKD9|SINL6_ARATH Putative E3 ubiquitin-protein ligase SINA-like 6 OS=Arabidopsis thaliana GN=At5g37870 PE=3 SV=1 Back     alignment and function description
>sp|Q9C6H2|SINL3_ARATH E3 ubiquitin-protein ligase SINA-like 3 OS=Arabidopsis thaliana GN=At1g66630 PE=2 SV=1 Back     alignment and function description
>sp|Q9C6H3|SINL2_ARATH E3 ubiquitin-protein ligase SINA-like 2 OS=Arabidopsis thaliana GN=At1g66620 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKD7|SINL7_ARATH E3 ubiquitin-protein ligase SINA-like 7 OS=Arabidopsis thaliana GN=At5g37890 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9M0|SINL4_ARATH E3 ubiquitin-protein ligase SINA-like 4 OS=Arabidopsis thaliana GN=At1g66650 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKD5|SINL9_ARATH Putative E3 ubiquitin-protein ligase SINA-like 9 OS=Arabidopsis thaliana GN=At5g37910 PE=3 SV=1 Back     alignment and function description
>sp|Q8I147|SINA_DROWI E3 ubiquitin-protein ligase sina OS=Drosophila willistoni GN=sina PE=3 SV=1 Back     alignment and function description
>sp|P21461|SINA_DROME E3 ubiquitin-protein ligase sina OS=Drosophila melanogaster GN=sina PE=1 SV=2 Back     alignment and function description
>sp|P61093|SINA_DROER E3 ubiquitin-protein ligase sina OS=Drosophila erecta GN=sina PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
255583779 374 ubiquitin-protein ligase, putative [Rici 0.934 0.574 0.381 2e-34
224135291 372 predicted protein [Populus trichocarpa] 0.930 0.575 0.385 2e-34
225453102 355 PREDICTED: E3 ubiquitin-protein ligase S 0.913 0.591 0.388 9e-34
147816090 355 hypothetical protein VITISV_037121 [Viti 0.913 0.591 0.388 1e-33
356512131320 PREDICTED: E3 ubiquitin-protein ligase S 0.913 0.656 0.388 6e-33
356524904320 PREDICTED: E3 ubiquitin-protein ligase S 0.913 0.656 0.388 7e-33
255647862320 unknown [Glycine max] 0.913 0.656 0.388 1e-32
224077239213 predicted protein [Populus trichocarpa] 0.917 0.990 0.378 4e-32
358348167327 E3 ubiquitin-protein ligase SINA-like pr 0.852 0.599 0.377 4e-30
224079768 408 predicted protein [Populus trichocarpa] 0.882 0.497 0.370 3e-27
>gi|255583779|ref|XP_002532642.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527633|gb|EEF29745.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 131/223 (58%), Gaps = 8/223 (3%)

Query: 1   CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGY 60
           CENGH  C++C  K+ +  CP    PI Y R R IEK+LESVK + C N +YGC EM+ Y
Sbjct: 136 CENGHTACSSCCRKLAHK-CPSCSLPIGYNRCRAIEKVLESVK-LPCHNLKYGCKEMVSY 193

Query: 61  LEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKN 120
            +K DH+K C ++PCSCPLSGC F+GSS QLYQHF  +H+ S+ PFRY+  F +     N
Sbjct: 194 SKKLDHDKICNNAPCSCPLSGCSFVGSSRQLYQHFSIKHKGSAAPFRYNITFPVFFTL-N 252

Query: 121 DKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISS-SREARNEYKISVTFGSNNVSTL 179
           DK L+L E ++  + F+ + A      N ++++C+   S +    Y+++     +N+   
Sbjct: 253 DKSLILQEEKEGVVFFLKNTAEI--LGNVITVNCLGGPSSKGGYFYELAARMEGSNLKFQ 310

Query: 180 TFRSAISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFK 222
           +F   I   K   D+     F ++P     + G+++L +CI++
Sbjct: 311 SFTKNI--QKVNHDDPHSDTFLIIPGSFFGSYGQISLDLCIWR 351

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224135291|ref|XP_002327611.1| predicted protein [Populus trichocarpa] gi|222836165|gb|EEE74586.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225453102|ref|XP_002271757.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147816090|emb|CAN77431.1| hypothetical protein VITISV_037121 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512131|ref|XP_003524774.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] Back     alignment and taxonomy information
>gi|356524904|ref|XP_003531068.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine max] Back     alignment and taxonomy information
>gi|255647862|gb|ACU24390.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224077239|ref|XP_002305191.1| predicted protein [Populus trichocarpa] gi|222848155|gb|EEE85702.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358348167|ref|XP_003638120.1| E3 ubiquitin-protein ligase SINA-like protein [Medicago truncatula] gi|355504055|gb|AES85258.1| E3 ubiquitin-protein ligase SINA-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224079768|ref|XP_002305940.1| predicted protein [Populus trichocarpa] gi|222848904|gb|EEE86451.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
TAIR|locus:2153784349 AT5G37930 [Arabidopsis thalian 0.947 0.624 0.331 4.4e-29
TAIR|locus:2153804281 AT5G37870 [Arabidopsis thalian 0.926 0.758 0.308 1.9e-26
TAIR|locus:2153754286 AT5G37890 [Arabidopsis thalian 0.917 0.737 0.300 2.3e-23
TAIR|locus:2195180303 AT1G66630 [Arabidopsis thalian 0.765 0.580 0.306 3.8e-23
TAIR|locus:2195175313 AT1G66620 [Arabidopsis thalian 0.939 0.690 0.288 1.6e-22
TAIR|locus:2033369329 AT1G66650 [Arabidopsis thalian 0.582 0.407 0.381 3e-21
TAIR|locus:2153774276 AT5G37910 [Arabidopsis thalian 0.939 0.782 0.280 6.3e-21
FB|FBgn0003410314 sina "seven in absentia" [Dros 0.939 0.687 0.288 1.4e-18
UNIPROTKB|P61093314 sina "E3 ubiquitin-protein lig 0.939 0.687 0.288 1.4e-18
UNIPROTKB|Q8I147331 sina "E3 ubiquitin-protein lig 0.939 0.652 0.288 1.4e-18
TAIR|locus:2153784 AT5G37930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 4.4e-29, P = 4.4e-29
 Identities = 75/226 (33%), Positives = 121/226 (53%)

Query:     1 CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGY 60
             C+NGH+ CT C +K++N  CP    PI Y R R +EK++E+ + VSC NA+YGC E   Y
Sbjct:   127 CDNGHLACTLCCTKVRN-RCPSCTLPIGYVRCRAMEKVIEASR-VSCLNAKYGCKESTSY 184

Query:    61 LEKNDHEKACKHSPCSCPLSGCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKN 120
               +  HE+ C  +PCSCP+  C + G    L  H RA+H++  + F ++   +I LD  N
Sbjct:   185 GNRFSHEQVCVFTPCSCPILDCHYTGYYKDLNNHVRAEHKDDLISFVWNTRLTISLDL-N 243

Query:   121 DKFLVLLEGRDDNILFVLHNARSNQQQNGLSISCISSSREARNEYKISVTFGSNNVSTLT 180
              K  +L E  D +++ V+   R+      +S+SCI+         ++S       V +L 
Sbjct:   244 KKTTILQEENDGHVI-VVQVFRALHAVY-VSVSCIAPLTPGVG--RLSCRLAKITVDSLL 299

Query:   181 FRS-AISSSKKQLDNLPKLGFPLVPWLLDATDGRLNLKICIFKDRL 225
              +   + + +K  +  P+ GF L+P  L + +  LNL+I I   R+
Sbjct:   300 KQGFMVKNIQKVTNEHPEDGFMLIPSYLFSGNDNLNLQIWIGHGRI 345
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA;ISS
GO:0007275 "multicellular organismal development" evidence=IEA;ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA
TAIR|locus:2153804 AT5G37870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153754 AT5G37890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195180 AT1G66630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195175 AT1G66620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033369 AT1G66650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153774 AT5G37910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0003410 sina "seven in absentia" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P61093 sina "E3 ubiquitin-protein ligase sina" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I147 sina "E3 ubiquitin-protein ligase sina" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
pfam03145198 pfam03145, Sina, Seven in absentia protein family 7e-17
>gnl|CDD|190542 pfam03145, Sina, Seven in absentia protein family Back     alignment and domain information 
 Score = 75.5 bits (186), Expect = 7e-17
 Identities = 35/154 (22%), Positives = 59/154 (38%), Gaps = 13/154 (8%)

Query: 31  RNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSG--CDFLGSS 88
           RN  +EK+   V    CK+A  GC   L    K+ HE+ C++ P  CP+ G  C + G  
Sbjct: 2   RNLAVEKVASKVL-FPCKHAALGCPVRLPLQLKDWHEERCEYKPYFCPMPGAKCKWQGDE 60

Query: 89  SQLYQHFRAQHQNSSVPFRYDQDFSIRLDAKNDKF-----LVLLEGRDDNILFVLHNARS 143
             L  H  A H+  +       +F I   A           V+++       F L+  + 
Sbjct: 61  DDLMPHLTADHKVITTEGG---EFDIVYLAAAVNLVGAPTWVMVQFSCFGRHFNLYLEKY 117

Query: 144 NQ--QQNGLSISCISSSREARNEYKISVTFGSNN 175
           +    Q   ++  +   R+    +   +  G N 
Sbjct: 118 DLGGTQMYFAVIQLIGERKEAENFAYELELGGNR 151

The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non- neuronal cell type. The Sina protein contains an N-terminal RING finger domain pfam00097. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that thus Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is described in pfam00097, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana. Length = 198

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
KOG3002299 consensus Zn finger protein [General function pred 100.0
PF03145198 Sina: Seven in absentia protein family; InterPro: 100.0
cd03829127 Sina Seven in absentia (Sina) protein family, C-te 99.5
KOG0297 391 consensus TNF receptor-associated factor [Signal t 99.07
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 98.3
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.26
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 97.19
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.02
PF1463444 zf-RING_5: zinc-RING finger domain 96.94
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.88
PLN03086567 PRLI-interacting factor K; Provisional 96.8
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.51
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.34
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.24
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.22
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.21
PLN03086567 PRLI-interacting factor K; Provisional 95.95
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 95.91
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.75
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.65
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 95.63
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 94.87
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 94.48
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.42
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.31
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 94.13
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 93.99
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 93.88
KOG4739233 consensus Uncharacterized protein involved in syna 89.88
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 89.01
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 88.91
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 88.06
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 87.97
PF10083158 DUF2321: Uncharacterized protein conserved in bact 86.58
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 85.56
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 83.9
COG4306160 Uncharacterized protein conserved in bacteria [Fun 83.65
PHA0061644 hypothetical protein 82.77
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 82.18
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 81.0
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-39  Score=281.48  Aligned_cols=204  Identities=31%  Similarity=0.546  Sum_probs=169.6

Q ss_pred             CCCCCccccccccccCCCCCCCCCCCCCccchHHHHHHHhhcceecCcCCCCCcceeeecCchhhHhhcCCCCCCCCCCC
Q 038900            1 CENGHMVCTTCRSKIKNDSCPFDRSPIAYTRNRVIEKLLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLS   80 (230)
Q Consensus         1 C~~GH~~C~~C~~~l~~~~CP~C~~~~~~~r~~~~e~~~~~l~~v~C~n~~~GC~~~~~~~~~~~He~~C~~~~~~Cp~~   80 (230)
                      |++||++|++|+.++.+ +||.|+.+++++|+++||++++++. |||||+.+||++.++|.+..+||+.|.|+|+.||.+
T Consensus        65 C~nGHlaCssC~~~~~~-~CP~Cr~~~g~~R~~amEkV~e~~~-vpC~~~~~GC~~~~~Y~~~~~HE~~C~f~~~~CP~p  142 (299)
T KOG3002|consen   65 CDNGHLACSSCRTKVSN-KCPTCRLPIGNIRCRAMEKVAEAVL-VPCKNAKLGCTKSFPYGEKSKHEKVCEFRPCSCPVP  142 (299)
T ss_pred             cCCCcEehhhhhhhhcc-cCCccccccccHHHHHHHHHHHhce-ecccccccCCceeeccccccccccccccCCcCCCCC
Confidence            89999999999999887 9999999999999999999999999 999999999999999999999999999999999999


Q ss_pred             --CCCcccChhhHHHHHhhhcCCCce-----eEEecceEEEEEecCC--CCeEEEEEecCCeEEEEEEecCCCCceeEEE
Q 038900           81 --GCDFLGSSSQLYQHFRAQHQNSSV-----PFRYDQDFSIRLDAKN--DKFLVLLEGRDDNILFVLHNARSNQQQNGLS  151 (230)
Q Consensus        81 --~C~~~g~~~~L~~H~~~~H~~~~~-----~~~y~~~~~l~l~~~~--~~~~vl~~~~d~~~lFll~~~~~~~~g~~vs  151 (230)
                        .|+|+|.+++|..|+...|+..++     .|.+....+..+....  .+..+..+...+. +|+++.+. ++.|.+++
T Consensus       143 ~~~C~~~G~~~~l~~H~~~~hk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~q~~~-~~~~~y~t  220 (299)
T KOG3002|consen  143 GAECKYTGSYKDLYAHLNDTHKSDIITLTGFDFVFVATDENLLGAATWTLKTSVCFGREFGL-LFEVQCFR-EPHGVYVT  220 (299)
T ss_pred             cccCCccCcHHHHHHHHHhhChhhhhhccccceecccCCccccccchhheeeeecCcEEEee-eeeehhhc-CCCceEEE
Confidence              899999999999999999999765     4444433322222221  1222233444555 88888866 77899999


Q ss_pred             EEeecCCC--CCCCeEEEEEEeCCceEEEEEeecceecccccccCCCCCCcccccCcccCC
Q 038900          152 ISCISSSR--EARNEYKISVTFGSNNVSTLTFRSAISSSKKQLDNLPKLGFPLVPWLLDAT  210 (230)
Q Consensus       152 v~cigp~~--~~~f~Y~l~~~~~~~~l~~~s~~~~i~~s~~~~~~~~~~~fl~vp~~~~~~  210 (230)
                      |++|.|.+  +.+|+|+|++.+++++|+|++.++++..+.  ....|..+||++|.+++..
T Consensus       221 v~~i~~~~~e~~~fsy~L~~~~~~~klt~~s~~~s~~~kv--s~~~p~~dfm~ip~~~~~~  279 (299)
T KOG3002|consen  221 VNRIAPSAPEAGEFSYSLALGGSGRKLTWQSPPRSIIQKV--SKVRPEDDFMLIPRSLLCL  279 (299)
T ss_pred             eehhccCCCcccccceeeecCCCCceEeecCCcceeeccc--ceeccCCCceeccHHHhhc
Confidence            99999865  358999999999999999999988766532  2367889999999987654

>PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila Back     alignment and domain information
>cd03829 Sina Seven in absentia (Sina) protein family, C-terminal substrate binding domain; composed of the Drosophila Sina protein, the mammalian Sina homolog (Siah), the plant protein SINAT5, and similar proteins Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2a25_A193 Crystal Structure Of Siah1 Sbd Bound To The Peptide 4e-05
1k2f_A190 Siah, Seven In Absentia Homolog Length = 190 1e-04
2an6_A191 Protein-Peptide Complex Length = 191 1e-04
>pdb|2A25|A Chain A, Crystal Structure Of Siah1 Sbd Bound To The Peptide Ekpaavvapittg From Sip Length = 193 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
Query: 47  CKNAEYGCNEMLGYLEKNDHEKACKHSP--CSCPLSGCDFLGSSSQLYQHFRAQHQN 101
           CK A  GC   L + EK DHE+ C+  P  C CP + C + GS   +  H   QH++
Sbjct: 9   CKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKS 65
>pdb|1K2F|A Chain A, Siah, Seven In Absentia Homolog Length = 190 Back     alignment and structure
>pdb|2AN6|A Chain A, Protein-Peptide Complex Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 1e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-07
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 1e-05
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Length = 193 Back     alignment and structure
 Score = 90.2 bits (223), Expect = 1e-22
 Identities = 43/191 (22%), Positives = 71/191 (37%), Gaps = 9/191 (4%)

Query: 38  LLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSP--CSCPLSGCDFLGSSSQLYQHF 95
           +  SV    CK A  GC   L + EK DHE+ C+  P  C CP + C + GS   +  H 
Sbjct: 1   VANSVL-FPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHL 59

Query: 96  RAQHQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLS---- 151
             QH++ +     D  F             ++        F+L   +  +          
Sbjct: 60  MHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAI 119

Query: 152 ISCISSSREARN-EYKISVTFGSNNVS-TLTFRSAISSSKKQLDNLPKLGFPLVPWLLDA 209
           +  I + ++A N  Y++ +      ++   T RS        + N   L F      L A
Sbjct: 120 VQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFA 179

Query: 210 TDGRLNLKICI 220
            +G L + + I
Sbjct: 180 ENGNLGINVTI 190
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 100.0
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.75
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.29
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.25
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.15
2yre_A100 F-box only protein 30; zinc binding, E3 ubiquitin 97.95
2yre_A100 F-box only protein 30; zinc binding, E3 ubiquitin 97.8
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 97.79
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.67
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.6
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.58
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.45
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.44
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.44
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 97.39
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.34
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.33
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.32
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.29
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.23
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.22
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.22
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.2
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.01
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.97
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 96.92
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.91
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 96.89
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.87
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.86
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.85
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 96.83
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 96.82
2ecw_A85 Tripartite motif-containing protein 30; metal bind 96.81
2ysl_A73 Tripartite motif-containing protein 31; ring-type 96.8
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 96.8
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.79
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.78
2ect_A78 Ring finger protein 126; metal binding protein, st 96.75
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.73
2ecm_A55 Ring finger and CHY zinc finger domain- containing 96.7
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.66
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 96.62
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.59
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.58
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.57
2ea5_A68 Cell growth regulator with ring finger domain prot 96.51
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 96.49
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.47
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 96.45
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 96.42
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.42
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.33
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.32
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 96.3
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.29
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.28
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 96.17
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.15
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 96.15
2ysj_A63 Tripartite motif-containing protein 31; ring-type 95.64
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.58
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 95.57
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 95.33
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 93.87
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 92.61
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 92.43
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 90.94
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 90.31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 90.21
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 89.35
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 88.8
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 88.27
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 86.43
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 86.43
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 86.11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 84.89
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 84.83
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 84.28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 80.48
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Back     alignment and structure
Probab=100.00  E-value=1.9e-36  Score=249.74  Aligned_cols=179  Identities=20%  Similarity=0.314  Sum_probs=104.0

Q ss_pred             HHhhcceecCcCCCCCcceeeecCchhhHhhcCCCCCCCCCCCC--CCcccChhhHHHHHhhhcCCCceeEEecceEEEE
Q 038900           38 LLESVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLSG--CDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIR  115 (230)
Q Consensus        38 ~~~~l~~v~C~n~~~GC~~~~~~~~~~~He~~C~~~~~~Cp~~~--C~~~g~~~~L~~H~~~~H~~~~~~~~y~~~~~l~  115 (230)
                      ++++++ +||+|+.+||++.++|.++.+||+.|+|+|+.||.+|  |+|+|+.++|.+|++.+|.|..+.  .+..+ ++
T Consensus         1 v~~s~~-~pC~~~~~GC~~~~~y~~~~~He~~C~f~p~~Cp~~g~~C~~~G~~~~l~~H~~~~H~~~~~~--~g~~i-~f   76 (193)
T 2a25_A            1 VANSVL-FPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTL--QGEDI-VF   76 (193)
T ss_dssp             ------------------------------------CEECCCC--CCCCEECSTTHHHHHHHHCTTSCEE--ESSEE-EE
T ss_pred             CccceE-ecCCCCCCCCCcccccccccchhhcCCCCCccCCCCCCCCcCCCCHHHHHHHHHHHCCCccee--cCceE-EE
Confidence            468899 9999999999999999999999999999999999987  999999999999999999985322  22222 22


Q ss_pred             EecCC-----CCeEEEEEecCCeEEEEEEecCCCCce---eEEEEEeecCCC-CCCCeEEEEEEeCCceEEEEEeeccee
Q 038900          116 LDAKN-----DKFLVLLEGRDDNILFVLHNARSNQQQ---NGLSISCISSSR-EARNEYKISVTFGSNNVSTLTFRSAIS  186 (230)
Q Consensus       116 l~~~~-----~~~~vl~~~~d~~~lFll~~~~~~~~g---~~vsv~cigp~~-~~~f~Y~l~~~~~~~~l~~~s~~~~i~  186 (230)
                      +..+.     .+|++++.+++..|+|+++.+. .+.|   .+++|+||||.+ +.+|+|+|++.+++++|+|++++++++
T Consensus        77 ~~~~~~l~~~~~~~~v~~~~g~~Fll~~~~~~-~~~g~~~~~~~V~~ig~~~ea~~f~Y~l~~~~~~r~L~~~~~~~s~~  155 (193)
T 2a25_A           77 LATDINLPGAVDWVMMQSCFGFHFMLVLEKQE-KYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIH  155 (193)
T ss_dssp             EEECCC----CEEEEEEEETTEEEEEEEEEC-------CEEEEEEEESSCHHHHTTEEEEEEEEETTEEEEEEECCEETT
T ss_pred             EecccccccceeEEEEEEecCceEEEEEEEec-cCCCCcEEEEEEEEeCCcchhcceEEEEEEEcCCCEEEEEEEEEehh
Confidence            22221     2687777766555556666654 3444   468999999864 468999999999999999999998776


Q ss_pred             cccccccCCCCCCcccccCcc---cCCCCceEEEEEEEcc
Q 038900          187 SSKKQLDNLPKLGFPLVPWLL---DATDGRLNLKICIFKD  223 (230)
Q Consensus       187 ~s~~~~~~~~~~~fl~vp~~~---~~~~g~l~l~v~I~~~  223 (230)
                      .+..  ...++.+||+||..+   |+++|+|.|+|+|+++
T Consensus       156 e~~~--~~~~~~d~L~ip~~~~~~f~~~~~L~l~v~I~~~  193 (193)
T 2a25_A          156 EGIA--TAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC  193 (193)
T ss_dssp             TCSH--HHHHTTCSEEEEHHHHHHHCSSSEEEEEEEEEEC
T ss_pred             hccc--ccccCCCEEEEcHHHHHhhcCCCeEEEEEEEEeC
Confidence            5321  224678899999754   6777899999999874
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1k2fa_190 b.8.1.2 (A:) SIAH, seven in absentia homolog {Mous 3e-25
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure

class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: SIAH, seven in absentia homolog
domain: SIAH, seven in absentia homolog
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 95.9 bits (238), Expect = 3e-25
 Identities = 44/188 (23%), Positives = 71/188 (37%), Gaps = 9/188 (4%)

Query: 41  SVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSP--CSCPLSGCDFLGSSSQLYQHFRAQ 98
           SV    CK A  GC   L + EK +HE+ C+  P  C CP + C + GS   +  H   Q
Sbjct: 1   SVL-FPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQ 59

Query: 99  HQNSSVPFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNAR----SNQQQNGLSISC 154
           H++ +     D  F             ++        F+L   +       QQ    +  
Sbjct: 60  HKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQL 119

Query: 155 ISSSREARN-EYKISVTFGSNNVSTL-TFRSAISSSKKQLDNLPKLGFPLVPWLLDATDG 212
           I + ++A N  Y++ +      ++   T RS        + N   L F      L A +G
Sbjct: 120 IGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENG 179

Query: 213 RLNLKICI 220
            L + + I
Sbjct: 180 NLGINVTI 187

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1k2fa_190 SIAH, seven in absentia homolog {Mouse (Mus muscul 100.0
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.98
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.65
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.64
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.52
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.23
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.22
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.19
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.15
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.71
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 96.7
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.57
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.31
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 95.83
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.32
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 94.31
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 93.85
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 93.16
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.96
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 92.74
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 92.65
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.15
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 85.45
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 83.0
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 80.25
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: SIAH, seven in absentia homolog
domain: SIAH, seven in absentia homolog
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.4e-33  Score=230.22  Aligned_cols=178  Identities=21%  Similarity=0.266  Sum_probs=138.9

Q ss_pred             hcceecCcCCCCCcceeeecCchhhHhhcCCCCCCCCCCC--CCCcccChhhHHHHHhhhcCCCceeEEecceEEEEEec
Q 038900           41 SVKSVSCKNAEYGCNEMLGYLEKNDHEKACKHSPCSCPLS--GCDFLGSSSQLYQHFRAQHQNSSVPFRYDQDFSIRLDA  118 (230)
Q Consensus        41 ~l~~v~C~n~~~GC~~~~~~~~~~~He~~C~~~~~~Cp~~--~C~~~g~~~~L~~H~~~~H~~~~~~~~y~~~~~l~l~~  118 (230)
                      ++. +||+|+.+||+++++|.++..||+.|+|+|+.||.+  +|+|+|+.++|..|+...|++..+.+.++..+......
T Consensus         1 Sv~-~pC~~~~~GC~~~~~~~~~~~HE~~C~~~p~~C~~~~~~C~~~G~~~~l~~Hl~~~H~~~~~~~~~~~~~~~~~~~   79 (190)
T d1k2fa_           1 SVL-FPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDIN   79 (190)
T ss_dssp             CCC-CCCTTGGGTCCCCCCGGGHHHHHHTCTTSCEECCSSSTTCCCEECHHHHHHHHHHSSCCCEEEESSEEEEEECCTT
T ss_pred             Cee-EecCCCCCCCCEeccccchhhHHhcCCCcccCCCCCCCCCccCCCHhHHHHHHHhcCCcccccCccceEEeeeccc
Confidence            467 999999999999999999999999999999666554  69999999999999999999877666666544333221


Q ss_pred             C-CCCeEEEEEecCCeEEEEEEecC----CCCceeEEEEEeecCCC-CCCCeEEEEEEeCCceEEEEEeecceecccccc
Q 038900          119 K-NDKFLVLLEGRDDNILFVLHNAR----SNQQQNGLSISCISSSR-EARNEYKISVTFGSNNVSTLTFRSAISSSKKQL  192 (230)
Q Consensus       119 ~-~~~~~vl~~~~d~~~lFll~~~~----~~~~g~~vsv~cigp~~-~~~f~Y~l~~~~~~~~l~~~s~~~~i~~s~~~~  192 (230)
                      . .....+++...+|. +|+|....    .......+.|++||+++ +++|.|+|++.+++++|+|++.+++++.+..  
T Consensus        80 ~~~~~~~v~~~~~~g~-~F~l~~~~~~~~~~~~~~~~~v~~~G~~~~a~~f~Yel~l~~~~r~l~~~~~~~si~e~~~--  156 (190)
T d1k2fa_          80 LPGAVDWVMMQSCFGF-HFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIA--  156 (190)
T ss_dssp             CTTCCEEEEEEEETTE-EEEEEEEEEEETTTEEEEEEEEEESSCHHHHTTEEEEEEEEETTEEEEEEECCEETTTCSH--
T ss_pred             cccceeEEEEEecCCC-EEEEEEEEEeccCCCCeEEEEEEEECCHHHhhCccEEEEecCCCceEEEeccccccccccc--
Confidence            1 12344555566777 78777632    12233457788999865 4689999999999999999999998877432  


Q ss_pred             cCCCCCCcccccCc---ccCCCCceEEEEEEEc
Q 038900          193 DNLPKLGFPLVPWL---LDATDGRLNLKICIFK  222 (230)
Q Consensus       193 ~~~~~~~fl~vp~~---~~~~~g~l~l~v~I~~  222 (230)
                      ...+..+||+||..   +|+++|+|.|+|+|+.
T Consensus       157 ~~~~~~d~lvi~~~~~~~F~~~g~L~l~v~I~~  189 (190)
T d1k2fa_         157 TAIMNSDCLVFDTSIAQLFAENGNLGINVTISM  189 (190)
T ss_dssp             HHHHTTCSEEEEHHHHHHHCBTTBEEEEEEEEE
T ss_pred             cccCCCCEEEECHHHHhhcccCCcEEEEEEEEe
Confidence            22456789999995   7899999999999975
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure