Citrus Sinensis ID: 039007


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MLNSDCQSIPKRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECPALWERCKPLTGEDWSKIARIPRIMLDDEMTKSSDN
ccccccccccccccEEEEEccccccccccccccccccccEEccccccccccHHHHHHHccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEEccEEcccccccccccccccEEEcEEEccccccHHcccccccccEEEccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccEEccccccccccccEEEccccccHHHHccccccccccccccccEEEEcccccccccc
ccccccccccHHHcccEEcccccccccccHHHcccccccEEEEEccccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccHHHHHcccHccccccccccccc
mlnsdcqsipkrvrhlsfvsasasrNDFSSLLSDLRRVRTILFSindentsesfftscisksqflrvldlddstievlPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGqlsglrslilvdcpslislpsavkclsssetlilidckslnlnlniemegegshhdrdntRTHLQKLFVSGLKQLldlpqwllqgstktlqflgiedcpnfmALQGSLKDLEALETLLISACRKlsslpedihhlttlktlsikecpalwerckpltgedwskiariprimlddemtkssdn
mlnsdcqsipkrvrhlsfvsasasrndfssllsdlRRVRTILFsindentsesfFTSCISKSQFLRVLDLDDSTIEVLPreignlkhmryLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLttlktlsikecPALWErckpltgedwskiariprimlddemtkssdn
MLNSDCQSIPKRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQKLFVSGlkqlldlpqwllqGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECPALWERCKPLTGEDWSKIARIPRIMLDDEMTKSSDN
****************************SSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEM*************THLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECPALWERCKPLTGEDWSKIARIPRIML**********
M**SDCQSIPKRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIE****GS**DRDNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECPALWERCKPLTGEDWSKIARIPRIMLDDEMTK****
********IPKRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECPALWERCKPLTGEDWSKIARIPRIMLDD********
*****CQSIPKRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECPALWERCKPLTGEDWSKIARIPRIMLDDEMT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNSDCQSIPKRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECPALWERCKPLTGEDWSKIARIPRIMLDDEMTKSSDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query360 2.2.26 [Sep-21-2011]
Q7XA42 979 Putative disease resistan N/A no 0.725 0.266 0.299 2e-14
Q7XA40992 Putative disease resistan N/A no 0.713 0.259 0.291 2e-13
Q7XA39 988 Putative disease resistan N/A no 0.330 0.120 0.409 1e-11
B5DX45629 Leucine-rich repeat prote yes no 0.5 0.286 0.282 4e-11
Q7XBQ9970 Disease resistance protei N/A no 0.491 0.182 0.316 1e-10
Q9LRR4 1054 Putative disease resistan no no 0.808 0.276 0.265 2e-10
Q1L8Y7561 Leucine-rich repeat prote yes no 0.502 0.322 0.300 2e-10
B4JTV9622 Leucine-rich repeat prote N/A no 0.5 0.289 0.273 3e-10
Q9LRR5 1424 Putative disease resistan no no 0.425 0.107 0.333 3e-10
B4LXW1614 Leucine-rich repeat prote N/A no 0.5 0.293 0.273 4e-10
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function desciption
 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 132/277 (47%), Gaps = 16/277 (5%)

Query: 42  LFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKK 101
           + SI       S+  S + K   LRVL+L +S +  LP  IG+L H+RYLDLS   +I+ 
Sbjct: 504 MMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRN 563

Query: 102 LPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRS 161
           LP  +C+LQ+LQTL L  C  L  LPK    L SLR  ++     +     I  L+ L+S
Sbjct: 564 LPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKS 623

Query: 162 LIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLN 221
           L    C+ +     H  QL  L++L L    S+  L    K   + E  +       +L 
Sbjct: 624 L---SCFVIGKRKGH--QLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLC 678

Query: 222 LNIEMEGEGSHHDRD-----NTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDC 276
           L+ +++G+   +D +        ++L+ L ++G    + LP W+ Q   K +  + I  C
Sbjct: 679 LSWDLDGK-HRYDSEVLEALKPHSNLKYLEINGFGG-IRLPDWMNQSVLKNVVSIRIRGC 736

Query: 277 PNFMALQ--GSLKDLEALETLLISACRKLSSLPEDIH 311
            N   L   G L  LE+LE  L +    +  + +++H
Sbjct: 737 ENCSCLPPFGELPCLESLE--LHTGSADVEYVEDNVH 771




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 Back     alignment and function description
>sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
225441815 874 PREDICTED: putative disease resistance p 0.905 0.372 0.435 5e-69
147777286 815 hypothetical protein VITISV_009157 [Viti 0.858 0.379 0.461 7e-68
255577491 860 leucine-rich repeat containing protein, 0.919 0.384 0.443 3e-65
356570433 856 PREDICTED: disease resistance protein RG 0.941 0.396 0.435 2e-64
356571981 754 PREDICTED: disease resistance protein RG 0.941 0.449 0.427 3e-62
224120592 836 nbs-lrr resistance protein [Populus tric 0.877 0.377 0.405 1e-61
351720930 863 disease resistance protein [Glycine max] 0.947 0.395 0.427 1e-60
359491491 845 PREDICTED: disease resistance protein RG 0.916 0.390 0.412 1e-60
356570458 857 PREDICTED: disease resistance protein RG 0.941 0.395 0.421 2e-60
351725809 909 NBS-LRR disease resistance protein [Glyc 0.916 0.363 0.427 3e-60
>gi|225441815|ref|XP_002277987.1| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  267 bits (683), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 146/335 (43%), Positives = 213/335 (63%), Gaps = 9/335 (2%)

Query: 30  SLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIEVLPREIGNLKHMR 89
           +LL +   +RTI F  ++ N +  +  +C S+ +++RVLDL  +  E LP  IGN+KH+R
Sbjct: 544 ALLQEKNNIRTIWFPYSEINATAEYVGTCSSRFKYMRVLDLRGTDFEELPSSIGNMKHLR 603

Query: 90  YLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSL- 148
           YLD+    ++KKLP SIC+L  L TL  + C +LEELP+D+   +SLR   +TTKQ++  
Sbjct: 604 YLDICGNKRVKKLPASICKLYLLLTLSFKECTELEELPRDMGNFISLRFLAITTKQRAWP 663

Query: 149 -QESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSS 207
            + +G+ACL SLR L+I+ C ++E++FE +  L+ LRSL +  CPSL+SLP +VK L + 
Sbjct: 664 RKGNGLACLISLRWLLIAECNHVEFMFEGLQNLTALRSLEIRRCPSLVSLPPSVKHLPAL 723

Query: 208 ETLILIDCKSLNLNLNIEMEGEG-SHHDRDNTRTHLQKLFVSGLKQLLDLPQWLLQG-ST 265
           ETL++ +C+  N      M+ +G   +D       L+ L V  L +L  LP WL+QG + 
Sbjct: 724 ETLMIFNCEMFNF-----MDEDGDEENDIQGISCRLRSLMVVDLPKLEALPGWLIQGLAA 778

Query: 266 KTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECP 325
            TL +L I  C  F AL  SL++L +L+ L I  C +LS+L   +H LTTLK LSI++CP
Sbjct: 779 STLHYLLIRRCHKFKALPESLENLTSLQELRIDDCPQLSTLSGGMHRLTTLKVLSIRDCP 838

Query: 326 ALWERCKPLTGEDWSKIARIPRIMLDDEMTKSSDN 360
            L +RCKP  GEDW KIA +P I +D E  KS+ N
Sbjct: 839 ELSKRCKPEIGEDWHKIAHVPEIYIDGEAIKSTTN 873




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147777286|emb|CAN69089.1| hypothetical protein VITISV_009157 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577491|ref|XP_002529624.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223530909|gb|EEF32769.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356570433|ref|XP_003553392.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Back     alignment and taxonomy information
>gi|356571981|ref|XP_003554149.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Back     alignment and taxonomy information
>gi|224120592|ref|XP_002318368.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222859041|gb|EEE96588.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351720930|ref|NP_001235657.1| disease resistance protein [Glycine max] gi|223452597|gb|ACM89625.1| disease resistance protein [Glycine max] Back     alignment and taxonomy information
>gi|359491491|ref|XP_003634282.1| PREDICTED: disease resistance protein RGA2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570458|ref|XP_003553404.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] Back     alignment and taxonomy information
>gi|351725809|ref|NP_001238129.1| NBS-LRR disease resistance protein [Glycine max] gi|212717155|gb|ACJ37419.1| NBS-LRR disease resistance protein [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.425 0.107 0.339 1.3e-20
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.863 0.156 0.287 1.1e-17
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.713 0.216 0.281 6.7e-16
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.697 0.211 0.283 5.8e-13
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.775 0.179 0.263 8.1e-13
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.636 0.187 0.268 1e-12
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.816 0.278 0.270 1.3e-12
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.827 0.215 0.266 2.1e-11
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.433 0.120 0.355 7.1e-11
FB|FBgn0038504641 Sur-8 "Sur-8" [Drosophila mela 0.438 0.246 0.304 1.7e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 184 (69.8 bits), Expect = 1.3e-20, Sum P(2) = 1.3e-20
 Identities = 54/159 (33%), Positives = 76/159 (47%)

Query:     9 IPKRVRHLSFVSASASRNDFSSLLSDLRRVRTIL-F----SINDENTSESFFTSCISKSQ 63
             IP   RH SF  +    +     +     +RTIL F    S+     +E      ++   
Sbjct:   514 IPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALS 573

Query:    64 FLRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKL 123
              LR+L L    I  LP+ +  LK +RYLDLS   +IK+LP  +C L +LQTL+L  C  L
Sbjct:   574 GLRILSLSHYQITNLPKSLKGLKLLRYLDLSS-TKIKELPEFVCTLCNLQTLLLSNCRDL 632

Query:   124 EELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSL 162
               LPK I  L++LR+  +          GI  L SL+ L
Sbjct:   633 TSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKL 671


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0038504 Sur-8 "Sur-8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00025584001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (568 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-08
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 56.8 bits (137), Expect = 1e-08
 Identities = 80/279 (28%), Positives = 120/279 (43%), Gaps = 48/279 (17%)

Query: 68  LDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELP 127
           L +  S +E L   + +L  +R +DL     +K++P+ +    +L+TL L  C  L ELP
Sbjct: 616 LQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELP 674

Query: 128 KDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLI 187
             I+YL                       + L  L +S C NLE L   I  L  L  L 
Sbjct: 675 SSIQYL-----------------------NKLEDLDMSRCENLEILPTGI-NLKSLYRLN 710

Query: 188 LVDCPSLISLP---SAVKCLSSSETLILIDCKSLNL----NLNIEMEGEGSHHDRDNTRT 240
           L  C  L S P   + +  L   ET I     +L L     L +         +R    T
Sbjct: 711 LSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLT 770

Query: 241 --------HLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEAL 292
                    L +LF+S +  L++LP   +Q   K L+ L IE+C N   L   + +LE+L
Sbjct: 771 PLMTMLSPSLTRLFLSDIPSLVELPS-SIQNLHK-LEHLEIENCINLETLPTGI-NLESL 827

Query: 293 ETLLISACRKLSSLPE---DIHHLTTLKTLSIKECPALW 328
           E+L +S C +L + P+   +I  L   +T  I+E P  W
Sbjct: 828 ESLDLSGCSRLRTFPDISTNISDLNLSRT-GIEEVP-WW 864


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.64
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.6
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
KOG4237498 consensus Extracellular matrix protein slit, conta 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.51
KOG4341483 consensus F-box protein containing LRR [General fu 99.47
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.38
KOG4341483 consensus F-box protein containing LRR [General fu 99.34
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.3
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.1
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.97
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.95
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.86
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.85
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.69
PLN03150623 hypothetical protein; Provisional 98.65
PLN03150623 hypothetical protein; Provisional 98.61
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.47
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.28
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.23
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.23
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.23
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.1
PRK15386 426 type III secretion protein GogB; Provisional 98.09
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.04
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.02
PRK15386426 type III secretion protein GogB; Provisional 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.59
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.23
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.84
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.21
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.54
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 91.65
KOG4308478 consensus LRR-containing protein [Function unknown 90.86
KOG4308478 consensus LRR-containing protein [Function unknown 89.98
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.11
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.76
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.37
smart0037026 LRR Leucine-rich repeats, outliers. 85.37
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.97  E-value=1.2e-29  Score=257.52  Aligned_cols=309  Identities=19%  Similarity=0.163  Sum_probs=165.4

Q ss_pred             CcceEEEeeeccccccchhhhhccCccccEEEEeccCCCCcccchHHHhhcCCCccEEEEeCCCCc-ccCcCCCCCCCcC
Q 039007           11 KRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISKSQFLRVLDLDDSTIE-VLPREIGNLKHMR   89 (360)
Q Consensus        11 ~~l~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~-~~~~~~~~l~~L~   89 (360)
                      ++++.|++.+|.+.. .++..+..+++|++|++++|.+   ...++..+.++++|++|++++|.+. .+|..+.++++|+
T Consensus       140 ~~L~~L~Ls~n~~~~-~~p~~~~~l~~L~~L~L~~n~l---~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  215 (968)
T PLN00113        140 PNLETLDLSNNMLSG-EIPNDIGSFSSLKVLDLGGNVL---VGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLK  215 (968)
T ss_pred             CCCCEEECcCCcccc-cCChHHhcCCCCCEEECccCcc---cccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCcc
Confidence            345555555555443 3444555666666666666554   3334445556666666666666655 4555566666666


Q ss_pred             eEeccccccccccchhhhcCCccceEeeccccCcCcCCccccccccccEEEEecccccc-ccccCCCCCCCcEeeccCCC
Q 039007           90 YLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSL-QESGIACLSSLRSLIISHCW  168 (360)
Q Consensus        90 ~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~-~~~~~~~l~~L~~L~l~~~~  168 (360)
                      +|++++|...+.+|..++++++|+.|++++|...+.+|..++.+++|+.|++++|.+.. .+..+..+++|+.|++++|.
T Consensus       216 ~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~  295 (968)
T PLN00113        216 WIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNS  295 (968)
T ss_pred             EEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCe
Confidence            66666654444555556666666666666655555556566666666666666665542 34455556666666666655


Q ss_pred             chhhhHhhhcCCCCccEEEeccCCCCcccCcccCCCCCCCEEeecCCcCccccccc-------------cccCCCCCCCC
Q 039007          169 NLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNI-------------EMEGEGSHHDR  235 (360)
Q Consensus       169 ~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~-------------~~~~~~~~~~~  235 (360)
                      ....+|..+..+++|+.|++++|.....+|..+..+++|+.|++++|......+..             .....+..+..
T Consensus       296 l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~  375 (968)
T PLN00113        296 LSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEG  375 (968)
T ss_pred             eccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChh
Confidence            44455555566666666666666555555555666666666666655432211100             00000001111


Q ss_pred             CCCCCccceEEecCccCCCCchhhhhcCCCCCCcEEecccCCCcccccccccCccccccccccccccccCCCccccCCCc
Q 039007          236 DNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTT  315 (360)
Q Consensus       236 ~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~  315 (360)
                      .....+|+.|++++|.....+|..+  ..+++|+.|++++|.....+|..+..+++|+.|++++|.+.+.++..+..+++
T Consensus       376 ~~~~~~L~~L~l~~n~l~~~~p~~~--~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~  453 (968)
T PLN00113        376 LCSSGNLFKLILFSNSLEGEIPKSL--GACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPS  453 (968)
T ss_pred             HhCcCCCCEEECcCCEecccCCHHH--hCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCC
Confidence            1222334444444444444444444  44555555555555444455555555566666666665555555555555566


Q ss_pred             cceecccCCh
Q 039007          316 LKTLSIKECP  325 (360)
Q Consensus       316 L~~L~l~~c~  325 (360)
                      |++|++++|.
T Consensus       454 L~~L~L~~n~  463 (968)
T PLN00113        454 LQMLSLARNK  463 (968)
T ss_pred             CcEEECcCce
Confidence            6666666664



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 46/169 (27%), Positives = 71/169 (42%), Gaps = 10/169 (5%) Query: 60 SKSQF--LRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQS---LQT 114 + QF L L L + + LP I +L +R L + ++ +LP + + Q Sbjct: 122 TXQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG 181 Query: 115 LILRGCLKLE-----ELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWN 169 L+ L+LE LP I L +L+ + S I L L L + C Sbjct: 182 LVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTA 241 Query: 170 LEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSL 218 L G + L+ LIL DC +L++LP + L+ E L L C +L Sbjct: 242 LRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNL 290

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  114 bits (288), Expect = 2e-29
 Identities = 56/260 (21%), Positives = 93/260 (35%), Gaps = 54/260 (20%)

Query: 65  LRVLDLDDSTIEVLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLE 124
           L+ + +D + +  LP  +     +  L L+    ++ LP SI  L  L+ L +R C +L 
Sbjct: 106 LQHMTIDAAGLMELPDTMQQFAGLETLTLA-RNPLRALPASIASLNRLRELSIRACPELT 164

Query: 125 ELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLR 184
           ELP+ +    +                    L +L+SL +     +  L   I  L  L+
Sbjct: 165 ELPEPLASTDAS--------------GEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLK 209

Query: 185 SLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQK 244
           SL + +   L +L  A+  L                                     L++
Sbjct: 210 SLKIRNS-PLSALGPAIHHLPK-----------------------------------LEE 233

Query: 245 LFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLS 304
           L + G   L + P     G    L+ L ++DC N + L   +  L  LE L +  C  LS
Sbjct: 234 LDLRGCTALRNYPPIF--GGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLS 291

Query: 305 SLPEDIHHLTTLKTLSIKEC 324
            LP  I  L     + +   
Sbjct: 292 RLPSLIAQLPANCIILVPPH 311


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.98
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.3
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.26
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.03
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.01
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.99
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.95
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.73
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.61
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.53
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.46
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.23
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.72
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=6.7e-33  Score=273.28  Aligned_cols=310  Identities=18%  Similarity=0.169  Sum_probs=230.3

Q ss_pred             CcceEEEeeeccccccchhhhhccCccccEEEEeccCCCCcccchHHHhhc---------------------------CC
Q 039007           11 KRVRHLSFVSASASRNDFSSLLSDLRRVRTILFSINDENTSESFFTSCISK---------------------------SQ   63 (360)
Q Consensus        11 ~~l~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~---------------------------l~   63 (360)
                      ++++.|++.+|.+.+......+.++++|++|++++|.+.   +.++..+.+                           ++
T Consensus       318 ~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~---~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~  394 (768)
T 3rgz_A          318 SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS---GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN  394 (768)
T ss_dssp             TTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEE---ECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTC
T ss_pred             CCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccC---ccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccC
Confidence            557777777777765233344777777777777777652   122222222                           44


Q ss_pred             CccEEEEeCCCCc-ccCcCCCCCCCcCeEeccccccccccchhhhcCCccceEeeccccCcCcCCccccccccccEEEEe
Q 039007           64 FLRVLDLDDSTIE-VLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKLEELPKDIRYLVSLRMFVVT  142 (360)
Q Consensus        64 ~L~~L~l~~~~~~-~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~  142 (360)
                      .|++|++++|.++ .+|..+..+++|++|++++|...+.+|..+..+++|+.|++++|...+.+|..+..+++|+.|+++
T Consensus       395 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~  474 (768)
T 3rgz_A          395 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD  474 (768)
T ss_dssp             CCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECC
T ss_pred             CccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEec
Confidence            5666666666655 566667777778888887775555677777778888888888777777777778888888888888


Q ss_pred             ccccc-cccccCCCCCCCcEeeccCCCchhhhHhhhcCCCCccEEEeccCCCCcccCcccCCCCCCCEEeecCCcCcccc
Q 039007          143 TKQKS-LQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGLRSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLN  221 (360)
Q Consensus       143 ~~~~~-~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~  221 (360)
                      +|.+. ..+..+..+++|+.|++++|...+.+|..++.+++|++|++++|.....+|..++.+++|+.|++++|......
T Consensus       475 ~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~i  554 (768)
T 3rgz_A          475 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTI  554 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBC
T ss_pred             CCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcC
Confidence            88776 34667788888888888888776677888888888888888888877788888888889999998887644222


Q ss_pred             ccccccC-----------------------------------------------------------CCCCCCCCCCCCcc
Q 039007          222 LNIEMEG-----------------------------------------------------------EGSHHDRDNTRTHL  242 (360)
Q Consensus       222 ~~~~~~~-----------------------------------------------------------~~~~~~~~~~~~~L  242 (360)
                      +...+..                                                           .+..+.....+++|
T Consensus       555 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L  634 (768)
T 3rgz_A          555 PAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM  634 (768)
T ss_dssp             CGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCC
T ss_pred             ChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccc
Confidence            2111000                                                           01112234455688


Q ss_pred             ceEEecCccCCCCchhhhhcCCCCCCcEEecccCCCcccccccccCccccccccccccccccCCCccccCCCccceeccc
Q 039007          243 QKLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIK  322 (360)
Q Consensus       243 ~~L~L~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~  322 (360)
                      +.|++++|...+.+|..+  +.++.|+.|+|++|...+.+|..++++++|+.|++++|++.+.+|..+..++.|++|+++
T Consensus       635 ~~LdLs~N~l~g~ip~~l--~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls  712 (768)
T 3rgz_A          635 MFLDMSYNMLSGYIPKEI--GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS  712 (768)
T ss_dssp             CEEECCSSCCBSCCCGGG--GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECC
T ss_pred             cEEECcCCcccccCCHHH--hccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECc
Confidence            999999999888899888  889999999999997777999999999999999999999888999999999999999998


Q ss_pred             CCh
Q 039007          323 ECP  325 (360)
Q Consensus       323 ~c~  325 (360)
                      +|+
T Consensus       713 ~N~  715 (768)
T 3rgz_A          713 NNN  715 (768)
T ss_dssp             SSE
T ss_pred             CCc
Confidence            873



>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 44.3 bits (103), Expect = 1e-05
 Identities = 39/272 (14%), Positives = 83/272 (30%), Gaps = 12/272 (4%)

Query: 65  LRVLDLDDSTIEVLPR-EIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQTLILRGCLKL 123
             +LDL ++ I  +   +  NLK++  L L      K  P +   L  L+ L L    +L
Sbjct: 33  TALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKN-QL 91

Query: 124 EELPKDIRYLVSLRMFVVTTKQKSLQESGIACLSSLRSLIISHCWNLEYLFEHIGQLSGL 183
           +ELP+ +   +           K  +   +    +   ++      L+      G   G+
Sbjct: 92  KELPEKMPKTLQELRVHENEITKVRK--SVFNGLNQMIVVELGTNPLKSSGIENGAFQGM 149

Query: 184 RSLILVDCPSLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQ 243
           + L  +              +++    +      L+L+ N   + + +     N    L 
Sbjct: 150 KKLSYIRIAD--------TNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLG 201

Query: 244 KLFVSGLKQLLDLPQWLLQGSTKTLQFLGIEDCPNFMALQGSLKDLEALETLLISACRKL 303
             F S                   L    +   P  +A    ++ +      + +     
Sbjct: 202 LSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSND 261

Query: 304 SSLPEDIHHLTTLKTLSIKECPALWERCKPLT 335
              P       +   +S+   P  +   +P T
Sbjct: 262 FCPPGYNTKKASYSGVSLFSNPVQYWEIQPST 293


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.59
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.35
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.03
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.90  E-value=2.1e-23  Score=182.04  Aligned_cols=248  Identities=17%  Similarity=0.144  Sum_probs=153.6

Q ss_pred             cccEEEEeccCCCCcccchHHHhhcCCCccEEEEeC-CCCc-ccCcCCCCCCCcCeEeccccccccccchhhhcCCccce
Q 039007           37 RVRTILFSINDENTSESFFTSCISKSQFLRVLDLDD-STIE-VLPREIGNLKHMRYLDLSRYCQIKKLPNSICELQSLQT  114 (360)
Q Consensus        37 ~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~L~l~~-~~~~-~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~  114 (360)
                      +++.|+++++.+.. ...+|..+.++++|++|++++ |.+. .+|+.+.++++|++|++++|...+..+..+..+.+|+.
T Consensus        51 ~v~~L~L~~~~l~g-~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          51 RVNNLDLSGLNLPK-PYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CEEEEEEECCCCSS-CEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEECCCCCCCC-CCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            57777777776531 123456677777777777775 5565 67777777777888888777555555566677777788


Q ss_pred             EeeccccCcCcCCccccccccccEEEEecccccc-ccccCCCCCCC-cEeeccCCCchhhhHhhhcCCCCccEEEeccCC
Q 039007          115 LILRGCLKLEELPKDIRYLVSLRMFVVTTKQKSL-QESGIACLSSL-RSLIISHCWNLEYLFEHIGQLSGLRSLILVDCP  192 (360)
Q Consensus       115 L~l~~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~-~~~~~~~l~~L-~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~  192 (360)
                      +++..|.....+|..+..+++++.+++++|.+.. +|..+..+..+ +.+.+..|......+..+..+..+ .+++..+.
T Consensus       130 l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~  208 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNM  208 (313)
T ss_dssp             EECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSE
T ss_pred             cccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-cccccccc
Confidence            7777776667777777777778878777776653 35556666554 667777765544555555555443 57777766


Q ss_pred             CCcccCcccCCCCCCCEEeecCCcCccccccccccCCCCCCCCCCCCCccceEEecCccCCCCchhhhhcCCCCCCcEEe
Q 039007          193 SLISLPSAVKCLSSSETLILIDCKSLNLNLNIEMEGEGSHHDRDNTRTHLQKLFVSGLKQLLDLPQWLLQGSTKTLQFLG  272 (360)
Q Consensus       193 ~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~~~L~~L~  272 (360)
                      ....+|..+..+++++.+++.++....                                   .++ .+  ..+++|++|+
T Consensus       209 ~~~~~~~~~~~~~~l~~l~~~~~~l~~-----------------------------------~~~-~~--~~~~~L~~L~  250 (313)
T d1ogqa_         209 LEGDASVLFGSDKNTQKIHLAKNSLAF-----------------------------------DLG-KV--GLSKNLNGLD  250 (313)
T ss_dssp             EEECCGGGCCTTSCCSEEECCSSEECC-----------------------------------BGG-GC--CCCTTCCEEE
T ss_pred             ccccccccccccccccccccccccccc-----------------------------------ccc-cc--cccccccccc
Confidence            666667777777777777777654221                                   111 11  3344555555


Q ss_pred             cccCCCcccccccccCccccccccccccccccCCCccccCCCccceecccCCh
Q 039007          273 IEDCPNFMALQGSLKDLEALETLLISACRKLSSLPEDIHHLTTLKTLSIKECP  325 (360)
Q Consensus       273 L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~  325 (360)
                      +++|...+.+|..+.++++|++|+|++|++.+.+|. +.++++|+.+++.+|+
T Consensus       251 Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         251 LRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             CccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            555543335555555555555555555554444443 2445555555555554



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure