Citrus Sinensis ID: 039067

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MYCSSEITLDISTPLFNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCARNAESSTPNNY
cccccccEEcccccccccccccccccEEEEccccccEEcccccccccccccccccEEEEEccccccccccccHHcccccccEEEEEccccccccccccccccccEEEccccccccEEcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccEEEcccccEEcccccccccccccccccEEEccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEcccccccccccccc
cccccccEEcccccccccEEccccccEEEEcccccEEEEcccccccccccccccEEEEEEccccHHHcccHHHHHHHHHHcEEEEccHHHHHHHHcccccccccEEEEcccccccEEcccccccccccccEEEEEcccccEEEccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHEEcccccHHHHHcccccHHHHHHccEEEEEccccccccHHHHccccccHHHHccHHHHHHHEcHccHHHHHHHccccccccccHHHcEEEEEEccHHHccccccccc
mycsseitldistplfnekvalpnlealeiSEINVnkiwhynhlpvmfprfqNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQlttlglqylpklrclypgmhtsewpaLESLLVRHCDKLKIFAADLsqnnendqlgipeqqllwpleKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKqleivgddstcfpiwnvfseegslekhVGKLAMIkelklyrpyhlkqlgkqdsklgpifQYLEILEVYYCArnaesstpnny
mycsseitldistplfNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSeegslekhVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCARnaesstpnny
MYCSSEITLDISTPLFNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCARNAESSTPNNY
******ITLDISTPLFNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCAR**********
MYCSS**TLDISTPLFNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCARNAESSTPNNY
MYCSSEITLDISTPLFNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCARNA********
**C*SEITLDISTPLFNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCARNAESSTPNN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYCSSEITLDISTPLFNEKVALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQLGKQDSKLGPIFQYLEILEVYYCARNAESSTPNNY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query304 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.381 0.126 0.335 6e-07
O22727967 Probable disease resistan no no 0.315 0.099 0.333 3e-05
Q9LVT3948 Probable disease resistan no no 0.463 0.148 0.243 0.0004
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 64/131 (48%), Gaps = 15/131 (11%)

Query: 22  LPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMI-GSLKQL 80
            PNLE L +  +N+  I   N    M  R Q L  L V  C +LK +FS  ++ G+L  L
Sbjct: 767 FPNLEELSLDNVNLESIGELNGFLGM--RLQKLKLLQVSGCRQLKRLFSDQILAGTLPNL 824

Query: 81  QHLDIRHCEDLQEII----------SENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALE 130
           Q + +  C  L+E+           +E+   +LT + L+YLP+LR L       E  +LE
Sbjct: 825 QEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLE--SLE 882

Query: 131 SLLVRHCDKLK 141
            L V  C+ LK
Sbjct: 883 HLEVESCESLK 893
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|Q9LVT3|DRL38_ARATH Probable disease resistance protein At5g47260 OS=Arabidopsis thaliana GN=At5g47260 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.878 0.157 0.293 2e-20
302143659 922 unnamed protein product [Vitis vinifera] 0.898 0.296 0.316 2e-20
359488103 1530 PREDICTED: disease resistance protein At 0.782 0.155 0.286 7e-19
302143656 839 unnamed protein product [Vitis vinifera] 0.782 0.283 0.286 8e-19
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.486 0.062 0.393 2e-18
359488025 1781 PREDICTED: uncharacterized protein LOC10 0.878 0.149 0.301 4e-18
296087869 1711 unnamed protein product [Vitis vinifera] 0.878 0.156 0.301 5e-18
147833354 1494 hypothetical protein VITISV_041837 [Viti 0.888 0.180 0.300 8e-18
302143647 759 unnamed protein product [Vitis vinifera] 0.782 0.313 0.293 1e-17
359488101 1677 PREDICTED: disease resistance protein At 0.888 0.161 0.292 1e-16
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 141/320 (44%), Gaps = 53/320 (16%)

Query: 6    EITLDISTPLFNEKVALPNLEALEISEI-NVNKIWHYNHLPVMFPRFQNLTRLIVWRCHK 64
            E   D+     NE V + +L  L +  +  V KIW  N  P     FQNL  + + +C  
Sbjct: 1156 EEVFDVEGTNVNEGVTVTHLSRLILRLLPKVEKIW--NKDPHGILNFQNLKSIFIDKCQS 1213

Query: 65   LKYIFSASMIGSLKQLQHLDIRHCEDLQEIIS-ENRAD--------QLTTLGLQYLPKLR 115
            LK +F AS++  L QL+ L +R C  ++EI++ +N A+        ++T+L L +L +LR
Sbjct: 1214 LKNLFPASLVKDLVQLEKLKLRSC-GIEEIVAKDNEAETAAKFVFPKVTSLKLFHLHQLR 1272

Query: 116  CLYPGMHTSEWPALESLLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRVTV 175
              YPG HTS+WP L+ L+VR CDK+ +FA++          G  +  +L PL    +V  
Sbjct: 1273 SFYPGAHTSQWPLLKELIVRACDKVNVFASETPTFQRRHHEGSFDMPILQPLFLLQQVGF 1332

Query: 176  DHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQADFPQHLFGSLKQLEIVG------- 228
             +                  +EL L       I Q  FP   F  L+ L + G       
Sbjct: 1333 PY-----------------LEELILDDNGNTEIWQEQFPMDSFPRLRCLNVRGYGDILVV 1375

Query: 229  ---------------DDSTCFPIWNVFSEEG-SLEKHVGKLAMIKELKLYRPYHLKQLGK 272
                           D   C  +  +F  EG   E    +L  ++E+ L     L  L K
Sbjct: 1376 IPSFMLQRLHNLEKLDVRRCSSVKEIFQLEGLDEENQAQRLGRLREIILGSLPALTHLWK 1435

Query: 273  QDSKLGPIFQYLEILEVYYC 292
            ++SK G   Q LE LEV+ C
Sbjct: 1436 ENSKSGLDLQSLESLEVWSC 1455

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143659|emb|CBI22412.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143656|emb|CBI22409.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087869|emb|CBI35152.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833354|emb|CAN66237.1| hypothetical protein VITISV_041837 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143647|emb|CBI22400.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.378 0.125 0.338 7.5e-06
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.319 0.100 0.336 8e-05
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 136 (52.9 bits), Expect = 7.5e-06, P = 7.5e-06
 Identities = 44/130 (33%), Positives = 64/130 (49%)

Query:    23 PNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMI-GSLKQLQ 81
             PNLE L +  +N+  I   N    M  R Q L  L V  C +LK +FS  ++ G+L  LQ
Sbjct:   768 PNLEELSLDNVNLESIGELNGFLGM--RLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQ 825

Query:    82 HLDIRHCEDLQEIIS----------ENRADQLTTLGLQYLPKLRCLYPGMHTSEWPALES 131
              + +  C  L+E+ +          E+   +LT + L+YLP+LR L       E  +LE 
Sbjct:   826 EIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLE--SLEH 883

Query:   132 LLVRHCDKLK 141
             L V  C+ LK
Sbjct:   884 LEVESCESLK 893
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_329000001
cc-nbs-lrr resistance protein (2359 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 304
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.61
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.56
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.06
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.06
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.02
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.97
KOG4341483 consensus F-box protein containing LRR [General fu 98.96
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.63
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.6
KOG4341483 consensus F-box protein containing LRR [General fu 98.47
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.38
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.37
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.35
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.26
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.26
PRK15386 426 type III secretion protein GogB; Provisional 98.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.07
PRK15386 426 type III secretion protein GogB; Provisional 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.93
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.85
KOG0617264 consensus Ras suppressor protein (contains leucine 97.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.74
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.7
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.6
KOG0617264 consensus Ras suppressor protein (contains leucine 97.57
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.46
KOG0472 565 consensus Leucine-rich repeat protein [Function un 97.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.1
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.63
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.51
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.51
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.47
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.2
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.7
PLN03150623 hypothetical protein; Provisional 95.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 94.93
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.79
KOG4237498 consensus Extracellular matrix protein slit, conta 94.47
PLN03150623 hypothetical protein; Provisional 94.45
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 93.26
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 92.65
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 92.2
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.74
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 91.12
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 90.45
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 90.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 89.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 89.42
KOG2123388 consensus Uncharacterized conserved protein [Funct 88.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 88.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 87.85
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 86.33
KOG2123 388 consensus Uncharacterized conserved protein [Funct 83.08
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.61  E-value=6.1e-15  Score=152.35  Aligned_cols=113  Identities=24%  Similarity=0.382  Sum_probs=93.1

Q ss_pred             cCCccceeeecceeeeeecccCCCCCccCCCCCccEEeeccCcccccccchhhhhcCCcccEEeeccCccccchhcccC-
Q 039067           21 ALPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISENR-   99 (304)
Q Consensus        21 ~~~~L~~L~L~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~C~~l~~l~~~~~~~~l~~L~~L~i~~c~~l~~l~~~~~-   99 (304)
                      .+.+|++|++.+++++.+|.+...      +++|+.|++++|..++.++.   ...+++|++|++++|..+.+++.... 
T Consensus       609 ~~~~L~~L~L~~s~l~~L~~~~~~------l~~Lk~L~Ls~~~~l~~ip~---ls~l~~Le~L~L~~c~~L~~lp~si~~  679 (1153)
T PLN03210        609 RPENLVKLQMQGSKLEKLWDGVHS------LTGLRNIDLRGSKNLKEIPD---LSMATNLETLKLSDCSSLVELPSSIQY  679 (1153)
T ss_pred             CccCCcEEECcCcccccccccccc------CCCCCEEECCCCCCcCcCCc---cccCCcccEEEecCCCCccccchhhhc
Confidence            467899999999988888876532      89999999999988888843   35679999999999998888876533 


Q ss_pred             CCccceeecccCccceecCCCcccCCCCccceeeeccccccccccc
Q 039067          100 ADQLTTLGLQYLPKLRCLYPGMHTSEWPALESLLVRHCDKLKIFAA  145 (304)
Q Consensus       100 ~~~L~~L~L~~c~~L~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~~  145 (304)
                      .++|+.|++++|.+++.++...   .+++|+.|.+++|..++.+|.
T Consensus       680 L~~L~~L~L~~c~~L~~Lp~~i---~l~sL~~L~Lsgc~~L~~~p~  722 (1153)
T PLN03210        680 LNKLEDLDMSRCENLEILPTGI---NLKSLYRLNLSGCSRLKSFPD  722 (1153)
T ss_pred             cCCCCEEeCCCCCCcCccCCcC---CCCCCCEEeCCCCCCcccccc
Confidence            3899999999999999988653   689999999999988888774

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 52.2 bits (124), Expect = 1e-07
 Identities = 57/308 (18%), Positives = 101/308 (32%), Gaps = 77/308 (25%)

Query: 8   TLDISTPLF----NEKVA-LPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWR- 61
           T D    L     + +   LP  E L  +   ++ I     +      + N      W+ 
Sbjct: 299 TPDEVKSLLLKYLDCRPQDLPR-EVLTTNPRRLSIIAES--IRDGLATWDN------WKH 349

Query: 62  --CHKLKYIFSASMIGSLKQLQHLDIRHC-EDLQEIISENRADQLTTLGLQYLP-KLRCL 117
             C KL  I  +S    L  L+  + R   + L  +   +           ++P  L  L
Sbjct: 350 VNCDKLTTIIESS----LNVLEPAEYRKMFDRL-SVFPPS----------AHIPTILLSL 394

Query: 118 YPGMHTSEWPALES----LLVRHCDKLKIFAADLSQNNENDQLGIPEQQLLWPLEKSLRV 173
                   W  +      ++V    K  +    + +  +   + IP   L       L+V
Sbjct: 395 I-------WFDVIKSDVMVVVNKLHKYSL----VEKQPKESTISIPSIYL------ELKV 437

Query: 174 TVDHQLTSLVIMIDDDQIVSNFKELSLSGKDVKMILQAD--FPQHLFGSLKQLEIVGDDS 231
            ++++      ++D   I   F    L           D  F  H+   LK +E   +  
Sbjct: 438 KLENEYALHRSIVDHYNIPKTFDSDDLI------PPYLDQYFYSHIGHHLKNIEH-PERM 490

Query: 232 TCFPIWNVFSEEGSLE---KHVGK--------LAMIKELKLYRPYHLKQLGKQDSKLGPI 280
           T F    VF +   LE   +H           L  +++LK Y+PY      K +  +  I
Sbjct: 491 TLFR--MVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAI 548

Query: 281 FQYLEILE 288
             +L  +E
Sbjct: 549 LDFLPKIE 556
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.63
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.6
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.6
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.59
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.59
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.56
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.55
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.53
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.52
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.5
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.49
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.48
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.47
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.46
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.46
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.46
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.45
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.44
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.42
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.42
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.42
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.42
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.41
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.41
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.41
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.41
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.39
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.38
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.37
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.37
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.35
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.35
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.35
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.34
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.31
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.3
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.3
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.3
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.29
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.27
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.26
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.26
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.24
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.19
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.11
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.1
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.1
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.04
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.02
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.99
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.98
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.97
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.96
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.94
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.91
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.9
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.89
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.89
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.78
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.53
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.53
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.5
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.41
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.23
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.21
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.15
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.98
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.95
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.91
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.89
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.86
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.83
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.8
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.57
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.54
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.94
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.8
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.62
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.1
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 87.0
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 86.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 86.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 82.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 81.06
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.63  E-value=2.6e-15  Score=133.84  Aligned_cols=113  Identities=16%  Similarity=0.207  Sum_probs=75.8

Q ss_pred             CCccceeeecceeeeeecccCCCCCccCCCCCccEEeeccCcccccccchhhhhcCCcccEEeeccCccccchhccc-CC
Q 039067           22 LPNLEALEISEINVNKIWHYNHLPVMFPRFQNLTRLIVWRCHKLKYIFSASMIGSLKQLQHLDIRHCEDLQEIISEN-RA  100 (304)
Q Consensus        22 ~~~L~~L~L~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~C~~l~~l~~~~~~~~l~~L~~L~i~~c~~l~~l~~~~-~~  100 (304)
                      .++++.|+|+++++..++.....      +++|++|+++++ .+..++.  .+..+++|++|++++|. +..++... ..
T Consensus        80 ~~~l~~L~L~~n~l~~lp~~l~~------l~~L~~L~L~~n-~l~~lp~--~~~~l~~L~~L~Ls~n~-l~~lp~~l~~l  149 (328)
T 4fcg_A           80 QPGRVALELRSVPLPQFPDQAFR------LSHLQHMTIDAA-GLMELPD--TMQQFAGLETLTLARNP-LRALPASIASL  149 (328)
T ss_dssp             STTCCEEEEESSCCSSCCSCGGG------GTTCSEEEEESS-CCCCCCS--CGGGGTTCSEEEEESCC-CCCCCGGGGGC
T ss_pred             ccceeEEEccCCCchhcChhhhh------CCCCCEEECCCC-CccchhH--HHhccCCCCEEECCCCc-cccCcHHHhcC
Confidence            57788888888877766544222      688888888876 5666632  24677888888888885 55555432 23


Q ss_pred             CccceeecccCccceecCCCcc-------cCCCCccceeeeccccccccccc
Q 039067          101 DQLTTLGLQYLPKLRCLYPGMH-------TSEWPALESLLVRHCDKLKIFAA  145 (304)
Q Consensus       101 ~~L~~L~L~~c~~L~~~~~~~~-------~~~l~~L~~L~l~~C~~L~~l~~  145 (304)
                      ++|++|++++|..+..++....       ...+++|+.|+++++ +++.+|.
T Consensus       150 ~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n-~l~~lp~  200 (328)
T 4fcg_A          150 NRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWT-GIRSLPA  200 (328)
T ss_dssp             TTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEE-CCCCCCG
T ss_pred             cCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCC-CcCcchH
Confidence            7888888888776666665321       113788888888887 4666653
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.33
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.31
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.31
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.28
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.19
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.17
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.15
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.15
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.15
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.11
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.11
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.07
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.04
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.01
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.97
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.91
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.87
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.52
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.52
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.08
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.07
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.57
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.32
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 94.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 87.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 85.51
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.42  E-value=3.6e-14  Score=121.85  Aligned_cols=90  Identities=16%  Similarity=0.119  Sum_probs=53.1

Q ss_pred             cccccEEEeccccccccccccCccccccCccccc--ccCCCCcccchhhhhhccCccccccccccccceeecccccCccc
Q 039067          192 VSNFKELSLSGKDVKMILQADFPQHLFGSLKQLE--IVGDDSTCFPIWNVFSEEGSLEKHVGKLAMIKELKLYRPYHLKQ  269 (304)
Q Consensus       192 ~~~L~~L~l~~c~~~~~~~~~~~~~~l~~L~~L~--~c~~~~~~~p~~~~~~l~~~~~~~~~~l~~L~~L~l~~c~~L~~  269 (304)
                      +|+|++|++++|....... ......+++|+.|.  .|..+.+...            ..+..+|+|++|++++|-    
T Consensus       174 ~~~L~~L~L~~~~~itd~~-~~~l~~~~~L~~L~L~~C~~i~~~~l------------~~L~~~~~L~~L~l~~~~----  236 (284)
T d2astb2         174 CPNLVHLDLSDSVMLKNDC-FQEFFQLNYLQHLSLSRCYDIIPETL------------LELGEIPTLKTLQVFGIV----  236 (284)
T ss_dssp             CTTCSEEECTTCTTCCGGG-GGGGGGCTTCCEEECTTCTTCCGGGG------------GGGGGCTTCCEEECTTSS----
T ss_pred             cccccccccccccCCCchh-hhhhcccCcCCEEECCCCCCCChHHH------------HHHhcCCCCCEEeeeCCC----
Confidence            6889999999887522110 01234577888887  6766654322            123467889999998872    


Q ss_pred             ccCCCCc-CCCCCCcccEEEEecCCCceeccCCCC
Q 039067          270 LGKQDSK-LGPIFQYLEILEVYYCARNAESSTPNN  303 (304)
Q Consensus       270 i~~~~~~-~~~~~~~L~~L~i~~C~~L~~l~~~~~  303 (304)
                       ..++.. ....+|+|+   + +|..++.+.-|..
T Consensus       237 -~d~~l~~l~~~lp~L~---i-~~~~ls~~~~~~~  266 (284)
T d2astb2         237 -PDGTLQLLKEALPHLQ---I-NCSHFTTIARPTI  266 (284)
T ss_dssp             -CTTCHHHHHHHSTTSE---E-SCCCSCCTTCSSC
T ss_pred             -CHHHHHHHHHhCcccc---c-cCccCCCCCCCcc
Confidence             122111 112455654   3 7888887765554
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure