Citrus Sinensis ID: 039087

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MGKSWLLALAAFVIFQLIIPTEAASFGVGGGVAIGIGGGGGGGGGVWIGGGINGGPAQTPSGSSPGSGSSLKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCGSLVASLEAKSSP
cccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEccccccccccEEEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccEEEccccEEEEcccccccccccccEEEEcccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHcccHHHHccccccEEEEEcccccccccHEEcccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEccccccccccHHHcccccEEEEEccccccccccHHHHHHcccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccHHHHHcccccccccccccccccccccccccccccc
MGKSWLLALAAFVIFQLiipteaasfgvgggvaigigggggggggvwiggginggpaqtpsgsspgsgssLKTAYTALQAWKsaitddplrildtwvgdnvcsykgifcsdlgaqgpvvagiDLNHANLQGNLVKELSLltdvnllhlntnrfsgtvpetfkdltslqeldlsnnqfsgpfplvtlyipnlvyldlrfnsfsgplpqdlfnkkLDAIFVnnnqfsgelpqnlgnspASVINLAnnrlsgsipasfgitnSKLKEILFLNnqltgcipegvglfseMQVFDVSFNslmghlpdtiscMSDIEILNLAHnqlsgelpDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNvgfdfsancipgrdmqrpqpdcsqipggglsclripalqplvCGSLVAsleakssp
MGKSWLLALAAFVIFQLIIPTEAASFGVGGGVAIGIGGGGGGGGGVWIGGGINGGPAQTPSGSSPGSGSSLKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCGSLvasleakssp
MGKSWLLALAAFVIFQLIIPTEAASFgvgggvaigigggggggggvwiggginggPAQTpsgsspgsgssLKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCGSLVASLEAKSSP
************************************************************************TAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSG***********SVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPG***********QIPGGGLSCLRIPALQPLVCGSLVA********
***SWLLALAAFVIFQLIIPTEA*****************GGGGGVWIGGGINGG******************AYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCG************
MGKSWLLALAAFVIFQLIIPTEAASFGVGGGVAIGIGGGGGGGGGVWIGGGINGGPA*************LKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCGSLVASLEAKSSP
*GKSWLLALAAFVIFQLIIPTEAASFGVGGGVAIGIGGGGGGGGGVWIGGGINGGPAQTPSGSSPGSGSSLKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCGSLVA********
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKSWLLALAAFVIFQLIIPTEAASFGVGGGVAIGIGGGGGGGGGVWIGGGINGGPAQTPSGSSPGSGSSLKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCGSLVASLEAKSSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query414 2.2.26 [Sep-21-2011]
Q9LHF1494 Leucine-rich repeat exten no no 0.739 0.619 0.520 2e-87
Q9T0K5 760 Leucine-rich repeat exten no no 0.770 0.419 0.494 4e-85
Q9SN46 857 Leucine-rich repeat exten no no 0.770 0.372 0.485 1e-82
O48809 786 Leucine-rich repeat exten no no 0.782 0.412 0.487 1e-82
Q9LUI1470 Leucine-rich repeat exten no no 0.775 0.682 0.484 2e-81
Q9LJ64 956 Pollen-specific leucine-r no no 0.772 0.334 0.44 2e-77
O65375 744 Leucine-rich repeat exten no no 0.782 0.435 0.444 7e-76
Q4PSE6433 Leucine-rich repeat exten no no 0.760 0.727 0.436 3e-75
O81765 699 Pollen-specific leucine-r no no 0.785 0.464 0.428 3e-75
Q9XIB6 847 Pollen-specific leucine-r no no 0.775 0.378 0.441 3e-75
>sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=1 SV=1 Back     alignment and function desciption
 Score =  322 bits (826), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 211/313 (67%), Gaps = 7/313 (2%)

Query: 71  LKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDL--GAQGPVVAGIDLNHAN 128
           L++AY ALQAWK AI  DP  I   W+G NVC+Y G+FCS      +   VAGIDLNHA+
Sbjct: 74  LRSAYIALQAWKQAILSDPNNITVNWIGSNVCNYTGVFCSKALDNRKIRTVAGIDLNHAD 133

Query: 129 LQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYI 188
           + G L +EL LLTD+ L H+N+NRF GTVP  FK L  L ELDLSNN+F+G FP V L++
Sbjct: 134 IAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAGKFPTVVLHL 193

Query: 189 PNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLS 248
           P+L +LDLRFN F G +P++LF+K LDAIF+N+N+F  ELP+N G+SP SVI LANN   
Sbjct: 194 PSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPVSVIVLANNHFH 253

Query: 249 GSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMS 308
           G IP S  +    L EI+F+NN L  C+P  +G    + VFDVSFN L+G LP+++  M 
Sbjct: 254 GCIPTSL-VEMKNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGPLPESVGGMV 312

Query: 309 DIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCI 368
           ++E LN+AHN LSG++P  +C L  L N T ++NFF+G +  C RL      FD   NC+
Sbjct: 313 EVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRL----SEFDDRRNCL 368

Query: 369 PGRDMQRPQPDCS 381
           PGR  QR    CS
Sbjct: 369 PGRPAQRSSRQCS 381
Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SN46|LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana GN=LRX5 PE=2 SV=2 Back     alignment and function description
>sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 Back     alignment and function description
>sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 Back     alignment and function description
>sp|Q4PSE6|LRX7_ARATH Leucine-rich repeat extensin-like protein 7 OS=Arabidopsis thaliana GN=LRX7 PE=2 SV=1 Back     alignment and function description
>sp|O81765|PLRX4_ARATH Pollen-specific leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=PEX4 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIB6|PLRX2_ARATH Pollen-specific leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=PEX2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
224088041409 predicted protein [Populus trichocarpa] 0.973 0.985 0.713 1e-160
255546269414 serine-threonine protein kinase, plant-t 0.859 0.859 0.767 1e-160
357500939430 Leucine-rich repeat receptor protein kin 0.818 0.788 0.763 1e-156
225445049414 PREDICTED: leucine-rich repeat extensin- 0.973 0.973 0.689 1e-154
444436402421 LRRK-like protein [Eucalyptus cladocalyx 0.835 0.821 0.732 1e-152
356513183410 PREDICTED: leucine-rich repeat extensin- 0.826 0.834 0.739 1e-152
359806086413 uncharacterized protein LOC100820611 pre 0.847 0.849 0.728 1e-152
357520801402 Leucine-rich repeat receptor protein kin 0.850 0.875 0.740 1e-149
147772837398 hypothetical protein VITISV_004527 [Viti 0.939 0.977 0.653 1e-146
359807293427 leucine-rich repeat extensin-like protei 0.852 0.826 0.729 1e-145
>gi|224088041|ref|XP_002308303.1| predicted protein [Populus trichocarpa] gi|222854279|gb|EEE91826.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  572 bits (1474), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 297/416 (71%), Positives = 344/416 (82%), Gaps = 13/416 (3%)

Query: 1   MGKSWLLALAAFVIFQLIIPTEAASFGVGGGVAIGIGGGGGGGGGVWIGGGINGGPAQTP 60
           M KSWLLA   F +F  IIP EAA    GG        GGG   G  I        +   
Sbjct: 2   MEKSWLLA---FSLFLQIIPREAAFGIGGGVGVGIGNAGGGVWIGGGIRSSPTP--SPGS 56

Query: 61  SGSSPGSGSSLKTAYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGP--V 118
           S S+P S      AY ALQ+WKSAITDDPL++LDTWVG +VC+YKG+FC+D    GP  V
Sbjct: 57  SVSNPNS------AYAALQSWKSAITDDPLKVLDTWVGTDVCAYKGVFCADPQDDGPGSV 110

Query: 119 VAGIDLNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFS 178
           V GIDLNHANLQG LVKE+S+LTD++LLHLN+NRFSGT+P+TFKDL SLQELDLSNN FS
Sbjct: 111 VVGIDLNHANLQGTLVKEISVLTDLSLLHLNSNRFSGTLPDTFKDLISLQELDLSNNHFS 170

Query: 179 GPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPAS 238
           GPFP VTLYIPNL+YLDLRFNSFSGP+P+D+FNKKLDAIF+NNNQF  ++PQNLG+SPAS
Sbjct: 171 GPFPTVTLYIPNLMYLDLRFNSFSGPIPEDVFNKKLDAIFLNNNQFDSQIPQNLGSSPAS 230

Query: 239 VINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMG 298
           VINLANN+LSG+IPASFG+ +SK+KEILFLNNQLTGCIP+GVGLF+EMQV DVSFNSLMG
Sbjct: 231 VINLANNKLSGNIPASFGLMSSKVKEILFLNNQLTGCIPQGVGLFTEMQVLDVSFNSLMG 290

Query: 299 HLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRN 358
           HLPDTISC++ IE+LNLAHN+LSG++P+LVCSLR+L+NLTVA NFFSGFSQ+CA+L  RN
Sbjct: 291 HLPDTISCLNQIEVLNLAHNKLSGQVPELVCSLRSLVNLTVASNFFSGFSQDCAKLFFRN 350

Query: 359 VGFDFSANCIPGRDMQRPQPDCSQIPGGGLSCLRIPALQPLVCGSLVASLEAKSSP 414
           VGFDFS NCIPGRDMQRPQP+CS IPGGGLSCLRIP+ QPL+CGSL  +LEA  SP
Sbjct: 351 VGFDFSLNCIPGRDMQRPQPECSVIPGGGLSCLRIPSAQPLICGSLPKTLEANISP 406

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546269|ref|XP_002514194.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223546650|gb|EEF48148.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357500939|ref|XP_003620758.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] gi|355495773|gb|AES76976.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] Back     alignment and taxonomy information
>gi|225445049|ref|XP_002280245.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|444436402|gb|AGE09569.1| LRRK-like protein [Eucalyptus cladocalyx] Back     alignment and taxonomy information
>gi|356513183|ref|XP_003525293.1| PREDICTED: leucine-rich repeat extensin-like protein 6-like [Glycine max] Back     alignment and taxonomy information
>gi|359806086|ref|NP_001240929.1| uncharacterized protein LOC100820611 precursor [Glycine max] gi|255635658|gb|ACU18178.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357520801|ref|XP_003630689.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] gi|355524711|gb|AET05165.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] Back     alignment and taxonomy information
>gi|147772837|emb|CAN62837.1| hypothetical protein VITISV_004527 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359807293|ref|NP_001240861.1| leucine-rich repeat extensin-like protein 4-like precursor [Glycine max] gi|223452546|gb|ACM89600.1| leucine-rich repeat family protein / extensin family protein [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
TAIR|locus:2051915402 AT2G19780 "AT2G19780" [Arabido 0.801 0.825 0.700 1.9e-131
TAIR|locus:2118279415 AT4G29240 [Arabidopsis thalian 0.806 0.804 0.684 1.5e-129
TAIR|locus:2094854494 AT3G24480 [Arabidopsis thalian 0.739 0.619 0.520 2.4e-83
TAIR|locus:2142105 760 LRX3 "AT4G13340" [Arabidopsis 0.785 0.427 0.494 7.4e-82
TAIR|locus:2094389470 AT3G22800 "AT3G22800" [Arabido 0.760 0.670 0.490 7.6e-80
TAIR|locus:2124142 857 AT4G18670 "AT4G18670" [Arabido 0.768 0.371 0.486 2.6e-79
TAIR|locus:2085889 956 AT3G19020 [Arabidopsis thalian 0.768 0.332 0.442 2.7e-75
TAIR|locus:2118949 699 AT4G33970 [Arabidopsis thalian 0.768 0.454 0.441 6.7e-75
TAIR|locus:2121348391 AT4G28380 [Arabidopsis thalian 0.801 0.849 0.443 7.3e-75
TAIR|locus:2010247 847 AT1G49490 [Arabidopsis thalian 0.763 0.373 0.458 1.9e-74
TAIR|locus:2051915 AT2G19780 "AT2G19780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1289 (458.8 bits), Expect = 1.9e-131, P = 1.9e-131
 Identities = 239/341 (70%), Positives = 290/341 (85%)

Query:    74 AYTALQAWKSAITDDPLRILDTWVGDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNL 133
             AY ALQ+WKSAIT+DP  +L TWVG++VCSY+G+FCS     G  +  IDLN ANL+G +
Sbjct:    71 AYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCS-----GSSITSIDLNKANLKGTI 125

Query:   134 VKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVY 193
             VK+LSLL+D+ +LHLN+NRFSG +P++FK+L SLQELDLSNN+FSG FP VTLYIPNLVY
Sbjct:   126 VKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYIPNLVY 185

Query:   194 LDLRFNSFSGPLPQDLFNKKLDAIFVNNNQFSGELPQNLGNSPASVINLANNRLSGSIPA 253
             LDLRFN+F+G +P++LFNK+LDAI +NNNQF+GE+P NLG S ASVINLANN+LSG IP 
Sbjct:   186 LDLRFNNFTGSIPENLFNKQLDAILLNNNQFTGEIPGNLGYSTASVINLANNKLSGEIPT 245

Query:   254 SFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEIL 313
             SFGIT SKLKE+LFLNNQLTGCIPE VGLFS+++VFDVSFNSLMGH+PDTISC+S+IE+L
Sbjct:   246 SFGITGSKLKEVLFLNNQLTGCIPESVGLFSDIEVFDVSFNSLMGHVPDTISCLSEIEVL 305

Query:   314 NLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIPGRDM 373
             NL HN+ SG+LPDLVC+LR L+NLTV+FNFFSGFS +C+ L   +VGFDF+ NCIPG+  
Sbjct:   306 NLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSGFSSQCSSL---SVGFDFTGNCIPGKGY 362

Query:   374 QRPQPDCSQIPGGGLSCLRIPALQPLVCGSLVASLEAKSSP 414
             QRPQPDCS IPGG LSC RIPA QPL C ++   L+  SSP
Sbjct:   363 QRPQPDCSAIPGGQLSCFRIPA-QPLTCAAISLGLKVASSP 402
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2118279 AT4G29240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094854 AT3G24480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142105 LRX3 "AT4G13340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094389 AT3G22800 "AT3G22800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124142 AT4G18670 "AT4G18670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085889 AT3G19020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118949 AT4G33970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121348 AT4G28380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010247 AT1G49490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.VI.2172.1
hypothetical protein (315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_1082000001
hypothetical protein (367 aa)
  •     0.499
eugene3.162250001
hypothetical protein (262 aa)
  •     0.439
fgenesh4_pg.C_scaffold_1268000001
hypothetical protein (327 aa)
  •     0.437
eugene3.01250001
hypothetical protein (467 aa)
  •     0.437

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
PRK07772186 PRK07772, PRK07772, single-stranded DNA-binding pr 8e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  136 bits (344), Expect = 9e-35
 Identities = 92/273 (33%), Positives = 149/273 (54%), Gaps = 12/273 (4%)

Query: 78  LQAWKSAITDDPLRILDTWVGDN-VCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKE 136
           L ++KS+I +DPL+ L  W     VC ++GI C++       V  IDL+  N+ G +   
Sbjct: 34  LLSFKSSI-NDPLKYLSNWNSSADVCLWQGITCNNSSR----VVSIDLSGKNISGKISSA 88

Query: 137 LSLLTDVNLLHLNTNRFSGTVPET-FKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLD 195
           +  L  +  ++L+ N+ SG +P+  F   +SL+ L+LSNN F+G  P     IPNL  LD
Sbjct: 89  IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIP--RGSIPNLETLD 146

Query: 196 LRFNSFSGPLPQDL-FNKKLDAIFVNNNQFSGELPQNLGN-SPASVINLANNRLSGSIPA 253
           L  N  SG +P D+     L  + +  N   G++P +L N +    + LA+N+L G IP 
Sbjct: 147 LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPR 206

Query: 254 SFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCMSDIEIL 313
             G   S LK I    N L+G IP  +G  + +   D+ +N+L G +P ++  + +++ L
Sbjct: 207 ELGQMKS-LKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYL 265

Query: 314 NLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSG 346
            L  N+LSG +P  + SL+ L++L ++ N  SG
Sbjct: 266 FLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG 298

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|236092 PRK07772, PRK07772, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.89
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.7
PLN03150623 hypothetical protein; Provisional 99.64
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.43
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.35
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.35
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
PLN03150623 hypothetical protein; Provisional 99.24
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.81
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.44
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.36
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.24
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.2
PRK15386 426 type III secretion protein GogB; Provisional 98.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.18
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.14
PRK15386 426 type III secretion protein GogB; Provisional 97.98
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.01
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.88
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.74
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.57
KOG4308 478 consensus LRR-containing protein [Function unknown 96.16
KOG4308478 consensus LRR-containing protein [Function unknown 95.5
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.39
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.2
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.15
KOG4341483 consensus F-box protein containing LRR [General fu 94.44
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.07
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.42
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.32
smart0037026 LRR Leucine-rich repeats, outliers. 93.3
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.6
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.37
smart0037026 LRR Leucine-rich repeats, outliers. 92.37
KOG4341483 consensus F-box protein containing LRR [General fu 91.45
KOG1947 482 consensus Leucine rich repeat proteins, some prote 87.01
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.3
KOG3915 641 consensus Transcription regulator dachshund, conta 83.19
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.8e-36  Score=328.49  Aligned_cols=290  Identities=32%  Similarity=0.540  Sum_probs=175.5

Q ss_pred             HHHHHHHHHHHHhCCCCCcccCCCCC-CCCCCCCCceeeCCCCCCCCcEEEEEcCCCCCCCccccccCCCCCCCEEECCC
Q 039087           72 KTAYTALQAWKSAITDDPLRILDTWV-GDNVCSYKGIFCSDLGAQGPVVAGIDLNHANLQGNLVKELSLLTDVNLLHLNT  150 (414)
Q Consensus        72 ~~~~~~L~~~~~~~~~~~~~~l~~w~-~~~~c~~~gv~c~~~~~~~~~l~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~  150 (414)
                      +.|+.+|++||+.+. +|...+.+|. ..++|.|.||.|+.    ..+++.|||++|++.+.++..|..+++|+.|+|++
T Consensus        28 ~~~~~~l~~~~~~~~-~~~~~~~~w~~~~~~c~w~gv~c~~----~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~  102 (968)
T PLN00113         28 AEELELLLSFKSSIN-DPLKYLSNWNSSADVCLWQGITCNN----SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSN  102 (968)
T ss_pred             HHHHHHHHHHHHhCC-CCcccCCCCCCCCCCCcCcceecCC----CCcEEEEEecCCCccccCChHHhCCCCCCEEECCC
Confidence            478899999999984 6777789997 46899999999975    45799999999999888888888899999999999


Q ss_pred             CcCCccCccccC-CCCCCCEEeCcCccCCCCCchhccCCCCCCEEecccccCCCCCCchhcccc-ccccccccccccccc
Q 039087          151 NRFSGTVPETFK-DLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKK-LDAIFVNNNQFSGEL  228 (414)
Q Consensus       151 n~l~~~~p~~~~-~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~i~~~~p~~~~~~~-L~~L~l~~n~l~~~~  228 (414)
                      |++++.+|..+. .+++|++|+|++|.+++.+|.  ..+++|++|+|++|.+++.+|..+.... |++|++++|.+.+.+
T Consensus       103 n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~  180 (968)
T PLN00113        103 NQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKI  180 (968)
T ss_pred             CccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccC
Confidence            988877776543 677777777777777655553  2345555555555555555555544433 555555555555455


Q ss_pred             CcccCC-CCCCEEEcccCcCCCCCchhhhhcccCCcEEEccCCcCcccCccccCCCCCCCEEEccCCCCCCCCcccccCC
Q 039087          229 PQNLGN-SPASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHLPDTISCM  307 (414)
Q Consensus       229 ~~~~~~-~~L~~L~ls~N~l~~~~p~~~~~~~~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l  307 (414)
                      |..+.. .+|++|++++|.+.+.+|..+..+ ++|++|++++|++.+.+|..+..+++|++|++++|.+++.+|..+..+
T Consensus       181 p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  259 (968)
T PLN00113        181 PNSLTNLTSLEFLTLASNQLVGQIPRELGQM-KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL  259 (968)
T ss_pred             ChhhhhCcCCCeeeccCCCCcCcCChHHcCc-CCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCC
Confidence            544433 335555555555554444444432 445555555555544444444444455555555544444444444444


Q ss_pred             CCCcEEEcccCCCCCCCchhhhCCCCCCeEecccccCcccchhhhhhcccCcEEEecCCCCC
Q 039087          308 SDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANCIP  369 (414)
Q Consensus       308 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~~L~~L~ls~N~l~  369 (414)
                      ++|++|++++|++++.+|..+..+++|++|+|++|.+.+.+|..+..+++|++|++++|.++
T Consensus       260 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~  321 (968)
T PLN00113        260 KNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT  321 (968)
T ss_pred             CCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccC
Confidence            44444444444444444444444444444444444444444444444444444444444443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3915 consensus Transcription regulator dachshund, contains SKI/SNO domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-22
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-15
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 118/275 (42%), Gaps = 38/275 (13%)
Query: 124 LNHANLQGNLVKELSLLTDVNLLHLNTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPL 183
           L+  +L G +   LS  T++N + L+ NR +G +P+    L +L  L LSNN FSG  P 
Sbjct: 473 LDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA 532
Query: 184 VTLYIPNLVYLDLRFNSFSGPLPQDLFNK--KLDAIFVNNNQFSGELPQNLGNSPASVIN 241
                 +L++LDL  N F+G +P  +F +  K+ A F+   ++       +        N
Sbjct: 533 ELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGN 592
Query: 242 LAN---------NRLSGSIPAS-----FGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQ 287
           L           NRLS   P +     +G   S      F NN               M 
Sbjct: 593 LLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSP----TFDNN-------------GSMM 635
Query: 288 VFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGF 347
             D+S+N L G++P  I  M  + ILNL HN +SG +PD V  LR L  L ++ N   G 
Sbjct: 636 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGR 695
Query: 348 SQECARLLIRNVGFDFSANCIPGRDMQRPQPDCSQ 382
             +    L      D S N + G     P P+  Q
Sbjct: 696 IPQAMSALTMLTEIDLSNNNLSG-----PIPEMGQ 725
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.39
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.09
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.93
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.67
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.53
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.45
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.14
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.07
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=3.9e-43  Score=333.35  Aligned_cols=297  Identities=27%  Similarity=0.397  Sum_probs=268.1

Q ss_pred             CChHHHHHHHHHHHHhCCCCCcccCCCCC-CCCCCC--CCceeeCCCCCCCCcEEEEEcCCCCCCC--ccccccCCCCCC
Q 039087           69 SSLKTAYTALQAWKSAITDDPLRILDTWV-GDNVCS--YKGIFCSDLGAQGPVVAGIDLNHANLQG--NLVKELSLLTDV  143 (414)
Q Consensus        69 ~~~~~~~~~L~~~~~~~~~~~~~~l~~w~-~~~~c~--~~gv~c~~~~~~~~~l~~L~L~~n~l~~--~~~~~l~~l~~L  143 (414)
                      .|.+.|..||++||+++. +|. .+.+|. +.++|.  |.||.|+... ...+|++|+|++|++.+  .+|..|..+++|
T Consensus         2 ~c~~~~~~aL~~~k~~~~-~~~-~l~~W~~~~~~C~~~w~gv~C~~~~-~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L   78 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLG-NPT-TLSSWLPTTDCCNRTWLGVLCDTDT-QTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT-CCG-GGTTCCTTSCTTTTCSTTEEECCSS-SCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCCHHHHHHHHHHHHhcC-Ccc-cccCCCCCCCCCcCCCcceEeCCCC-CCceEEEEECCCCCccCCcccChhHhCCCCC
Confidence            357889999999999995 565 789997 468898  9999997521 12689999999999998  899999999999


Q ss_pred             CEEECCC-CcCCccCccccCCCCCCCEEeCcCccCCCCCchhccCCCCCCEEecccccCCCCCCchhcccc-cccccccc
Q 039087          144 NLLHLNT-NRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKK-LDAIFVNN  221 (414)
Q Consensus       144 ~~L~Ls~-n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~i~~~~p~~~~~~~-L~~L~l~~  221 (414)
                      ++|+|++ |.+++.+|..|.++++|++|+|++|++++.+|..|..+++|++|++++|.+++.+|..+.... |++|++++
T Consensus        79 ~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~  158 (313)
T 1ogq_A           79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG  158 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCS
T ss_pred             CeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcC
Confidence            9999995 999999999999999999999999999999999999999999999999999989998888765 99999999


Q ss_pred             cccccccCcccCCC--CCCEEEcccCcCCCCCchhhhhcccCCcEEEccCCcCcccCccccCCCCCCCEEEccCCCCCCC
Q 039087          222 NQFSGELPQNLGNS--PASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGH  299 (414)
Q Consensus       222 n~l~~~~~~~~~~~--~L~~L~ls~N~l~~~~p~~~~~~~~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~  299 (414)
                      |.+++.+|..+...  .|++|++++|++++.+|..+... + |++|++++|++++..|..|..+++|++|++++|.+++.
T Consensus       159 N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l-~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~  236 (313)
T 1ogq_A          159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL-N-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD  236 (313)
T ss_dssp             SCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC-C-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred             CcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCC-c-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeee
Confidence            99998899888763  69999999999998999988875 4 99999999999989999999999999999999999866


Q ss_pred             CcccccCCCCCcEEEcccCCCCCCCchhhhCCCCCCeEecccccCcccchhhhhhcccCcEEEecCCC-CCCCC
Q 039087          300 LPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANC-IPGRD  372 (414)
Q Consensus       300 ~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~~L~~L~ls~N~-l~~~~  372 (414)
                      ++. +..+++|++|+|++|+|++.+|..+..+++|++|+|++|++++.+|.. ..+++|+.+++++|+ +.+.|
T Consensus       237 ~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~~lc~~p  308 (313)
T 1ogq_A          237 LGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             GGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEESTT
T ss_pred             cCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCC-ccccccChHHhcCCCCccCCC
Confidence            665 888999999999999999999999999999999999999999888876 677889999999998 66654
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 414
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 79.8 bits (195), Expect = 3e-17
 Identities = 69/298 (23%), Positives = 115/298 (38%), Gaps = 34/298 (11%)

Query: 77  ALQAWKSAITDDPLRILDTWV-GDNVC--SYKGIFCSDLGAQGPVVAGIDLNHANLQGN- 132
           AL   K  + +     L +W+   + C  ++ G+ C        V   +DL+  NL    
Sbjct: 10  ALLQIKKDLGNPT--TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVN-NLDLSGLNLPKPY 66

Query: 133 -LVKELSLLTDVNLLHL-NTNRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPN 190
            +   L+ L  +N L++   N   G +P     LT L  L +++   SG  P     I  
Sbjct: 67  PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKT 126

Query: 191 LVYLDLRFNSFSGPLPQDLFNKKLDAIF-VNNNQFSGELPQNLGNSPASVINLA--NNRL 247
           LV LD  +N+ SG LP  + +         + N+ SG +P + G+      ++    NRL
Sbjct: 127 LVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL 186

Query: 248 SGSIPASFGITNSKLK---------------------EILFLNNQLTGCIPEGVGLFSEM 286
           +G IP +F   N                         + + L           VGL   +
Sbjct: 187 TGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNL 246

Query: 287 QVFDVSFNSLMGHLPDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFF 344
              D+  N + G LP  ++ +  +  LN++ N L GE+P    +L+       A N  
Sbjct: 247 NGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKC 303
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.58
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.21
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=6.3e-41  Score=315.77  Aligned_cols=296  Identities=27%  Similarity=0.403  Sum_probs=263.0

Q ss_pred             ChHHHHHHHHHHHHhCCCCCcccCCCCC-CCCCCC--CCceeeCCCCCCCCcEEEEEcCCCCCCC--ccccccCCCCCCC
Q 039087           70 SLKTAYTALQAWKSAITDDPLRILDTWV-GDNVCS--YKGIFCSDLGAQGPVVAGIDLNHANLQG--NLVKELSLLTDVN  144 (414)
Q Consensus        70 ~~~~~~~~L~~~~~~~~~~~~~~l~~w~-~~~~c~--~~gv~c~~~~~~~~~l~~L~L~~n~l~~--~~~~~l~~l~~L~  144 (414)
                      |.++|++||++||+.+.+ | ..+++|. ++|||.  |.||+|+..+ ...+|++|||+++++.+  .+|..+.++++|+
T Consensus         3 c~~~e~~aLl~~k~~~~~-~-~~l~sW~~~~d~C~~~w~gv~C~~~~-~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~   79 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGN-P-TTLSSWLPTTDCCNRTWLGVLCDTDT-QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTC-C-GGGTTCCTTSCTTTTCSTTEEECCSS-SCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             CCHHHHHHHHHHHHHCCC-C-CcCCCCCCCCCCCCCcCCCeEEeCCC-CcEEEEEEECCCCCCCCCCCCChHHhcCcccc
Confidence            678999999999999964 4 3689996 679994  9999998632 24589999999999987  4789999999999


Q ss_pred             EEECCC-CcCCccCccccCCCCCCCEEeCcCccCCCCCchhccCCCCCCEEecccccCCCCCCchhcccc-ccccccccc
Q 039087          145 LLHLNT-NRFSGTVPETFKDLTSLQELDLSNNQFSGPFPLVTLYIPNLVYLDLRFNSFSGPLPQDLFNKK-LDAIFVNNN  222 (414)
Q Consensus       145 ~L~Ls~-n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~i~~~~p~~~~~~~-L~~L~l~~n  222 (414)
                      +|+|++ |++++.+|..|.++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..+.... ++.+++++|
T Consensus        80 ~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n  159 (313)
T d1ogqa_          80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccc
Confidence            999997 899999999999999999999999999988999999999999999999999999999988866 999999999


Q ss_pred             ccccccCcccCCC-C-CCEEEcccCcCCCCCchhhhhcccCCcEEEccCCcCcccCccccCCCCCCCEEEccCCCCCCCC
Q 039087          223 QFSGELPQNLGNS-P-ASVINLANNRLSGSIPASFGITNSKLKEILFLNNQLTGCIPEGVGLFSEMQVFDVSFNSLMGHL  300 (414)
Q Consensus       223 ~l~~~~~~~~~~~-~-L~~L~ls~N~l~~~~p~~~~~~~~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~  300 (414)
                      .+.+.+|..+... + ++.+++++|++++..|..+...  ...+++++++.+.+.+|..+..+++++.+++++|.+.+.+
T Consensus       160 ~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l--~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~  237 (313)
T d1ogqa_         160 RISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL--NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL  237 (313)
T ss_dssp             CCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC--CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG
T ss_pred             cccccccccccccccccccccccccccccccccccccc--cccccccccccccccccccccccccccccccccccccccc
Confidence            9999999877663 3 5899999999998888887753  5668999999999999999999999999999999998655


Q ss_pred             cccccCCCCCcEEEcccCCCCCCCchhhhCCCCCCeEecccccCcccchhhhhhcccCcEEEecCCC-CCCCC
Q 039087          301 PDTISCMSDIEILNLAHNQLSGELPDLVCSLRTLMNLTVAFNFFSGFSQECARLLIRNVGFDFSANC-IPGRD  372 (414)
Q Consensus       301 p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~~L~~L~ls~N~-l~~~~  372 (414)
                      + .+..+++|++|+|++|+|++.+|..|..+++|++|+|++|+|+|.+|+. ..+.+|+.+++++|+ +.|.|
T Consensus       238 ~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         238 G-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             G-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEESTT
T ss_pred             c-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-ccCCCCCHHHhCCCccccCCC
Confidence            4 6888999999999999999999999999999999999999999888764 566789999999997 66654
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure