Citrus Sinensis ID: 039088


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MSSIVSSSSYWCYRCSRFVRVFSRDDVVSCPDCDGGFVEEIENTPRGIHSTDIHRGPGPGPGRMRFPAAAMYMIGSSNNNSNNIINSSNRSNRDPNNSAGPVLRRSRRTGGDRSPFNPVIVLRGPVNGDVDNNGNGYELYYDDGEGSGLRPLPRSMTEFLLGSGFERLLEQLSQIDMNGIGGFENPPASKAAIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHELPADNNSNQSNVDESDNGENGQANEDEAVGLTIWRLPGGGFAVGRFSGGRRGGERELPVVYTEMDGGFNNGGLPRRVSWGSRGSRGRERGGGFVGRFVRSLFGCFGGGSGSSSTSGSSDSRIRRRGTSRAVSLFNVSSRRSAWDVDVSSEGRRW
cccccccccEEEccccccEEEcccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHccccEEEccccccccccccEEccccccccEEEEEccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccEEEEEcccEEEccccccccEccccccccEEEcccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHcccccccccccccccccccccccccccHHccccHHHHHHHHHHHcccccccccccccccHHHHHcccEEEEEHHHccccccccccHHHccccHHHcccccccccccccEHHHHHHccccccEcccccccccccccccccccccccccccccccccEEEEEccccccEEEEcccccccccccccEEEEEEcccccccccccEEEEEcccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEccccccc
mssivssssywcyrcsrfvrvfsrddvvscpdcdggfveeientprgihstdihrgpgpgpgrmrfpAAAMYMIGssnnnsnniinssnrsnrdpnnsagpvlrrsrrtggdrspfnpvivlrgpvngdvdnngngyelyyddgegsglrplprsmTEFLLGSGFERLLEQLSQIdmngiggfenppaskaaienmpsilidssYVELESHCAVCKEAFELgsearempckhiyhsdcilpwlslrnscpvcrhelpadnnsnqsnvdesdngengqanedeAVGLTiwrlpgggfavgrfsggrrggerelpvvytemdggfnngglprrvswgsrgsrgrergggfVGRFVRSLfgcfgggsgssstsgssdsrirrrgtsRAVSLFNVSsrrsawdvdvssegrrw
mssivssssywCYRCSRFVRVFSRDDVVSCPDCDGGFVEEientprgihstdihrgpgpGPGRMRFPAAAMYMIGSSNNNSNNIInssnrsnrdpnnsagpvlrrsrrtggdrspfnpvivlrgpvngdvdnNGNGYELYYDDGEGSGLRPLPRSMTEFLLGSGFERLLEQLSQIDMNGIGGFENPPASKAAIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHElpadnnsnqsnvDESDNGENGQANEDEAVGLTIWRLPGGGFAvgrfsggrrggeRELPVVytemdggfnngglprrvswgsrgsrgrergggfVGRFVRSLFGCfgggsgssstsgssdsrirrrgtsravslfnvssrrsawdvdvssegrrw
MssivssssywcyrcsrfvrvfsrddvvsCPDCDGGFVEEIENTPRGIHSTDIHrgpgpgpgrmrfpaaaMYMIGssnnnsnniinssnrsnrdpnnsAGPVLRRSRRTGGDRSPFNPVIVLRgpvngdvdnngngYELYYDDGEGSGLRPLPRSMTEFLLGSGFERLLEQLSQIDMNGIGGFENPPASKAAIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHELPADNNSNQSNVDESDNGENGQANEDEAVGLTIWRLPgggfavgrfsggrrggereLPVVYTEMDGGFNNGGLPrrvswgsrgsrgrergggfvgrfvrslfgCFgggsgssstsgssdsrirrrgtsrAVSLFNVSSRRSAWDVDVSSEGRRW
********SYWCYRCSRFVRVFSRDDVVSCPDCDGGFVEEIE***************************************************************************PVIVLRGPVNGDVDNNGNGYELYYDDGE*********SMTEFLLGSGFERLLEQLSQIDMNGIGGF********AIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRH****************************AVGLTIWRLPGGGFAVGRFSGGRRGGERELPVVYTEMDGGF************************FVGRFVRSLFGCFG************************************************
******S***WCYRCSRFVRVFSRDDVVSCPDCDGGFVEE*****************************************************************************************************************RSMTEFLLGSGFERLLEQ*********************IENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHEL***************************************************************************************************************************************************S*****
********SYWCYRCSRFVRVFSRDDVVSCPDCDGGFVEEIENTPRGIHSTDIHRGPGPGPGRMRFPAAAMYMIGSSNNNSNNIINSSNRSNRDPNNSAGPVLRRSRRTGGDRSPFNPVIVLRGPVNGDVDNNGNGYELYYDDGEGSGLRPLPRSMTEFLLGSGFERLLEQLSQIDMNGIGGFENPPASKAAIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHELPADNNSNQ***********GQANEDEAVGLTIWRLPGGGFAVGRFSGGRRGGERELPVVYTEMDGGFNNGGLPRRVSWGSRGSRGRERGGGFVGRFVRSLFGCFGG*******************TSRAVSLFNVSS****************
*******SSYWCYRCSRFVRVFSRDDVVSCPDCDGGFVEEIEN**********************FPAAAMYMIG***************************************PFNPVIVLRGPVNGDVDNNGNGYELYYDDGEGSGLRPLPRSMTEFLLGSGFERLLEQLSQIDMNGIGGFENPPASKAAIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHEL*************************EAVGLTIWRLPGGGFAVGRFSGGRRGGERELPVVYTEMDGGFNNGGLPRRVSWGSRG********GFVGRFVRSLFGCF*************************************W****S******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSIVSSSSYWCYRCSRFVRVFSRDDVVSCPDCDGGFVEEIENTPRGIHSTDIHRGPGPGPGRMRFPAAAMYMIGSSNNNSNNIINSSNRSNRDPNNSAGPVLRRSRRTGGDRSPFNPVIVLRGPVNGDVDNNGNGYELYYDDGEGSGLRPLPRSMTEFLLGSGFERLLEQLSQIDMNGIGGFENPPASKAAIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHELPADNNSNQSNVDESDNGENGQANEDEAVGLTIWRLPGGGFAVGRFSGGRRGGERELPVVYTEMDGGFNNGGLPRRVSWGSRGSRGRERGGGFVGRFVRSLFGCFGGGSGSSSTSGSSDSRIRRRGTSRAVSLFNVSSRRSAWDVDVSSEGRRW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query409 2.2.26 [Sep-21-2011]
P0CH30338 E3 ubiquitin-protein liga N/A no 0.594 0.718 0.376 7e-36
Q8LPN7328 E3 ubiquitin-protein liga no no 0.569 0.710 0.320 2e-31
Q9CY62165 E3 ubiquitin-protein liga yes no 0.237 0.587 0.431 7e-19
Q6IRP0312 RING finger protein 126-B N/A no 0.594 0.778 0.265 5e-18
Q6AXU4165 E3 ubiquitin-protein liga yes no 0.237 0.587 0.450 6e-18
Q3T0W3153 E3 ubiquitin-protein liga yes no 0.193 0.516 0.530 7e-18
Q9Y4L5304 E3 ubiquitin-protein liga yes no 0.242 0.325 0.382 8e-18
Q9D0C1305 E3 ubiquitin-protein liga no no 0.542 0.727 0.263 9e-18
Q8RXD3310 E3 ubiquitin-protein liga no no 0.193 0.254 0.426 1e-17
Q9SPL2334 E3 ubiquitin-protein liga no no 0.242 0.296 0.46 2e-17
>sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=2 SV=1 Back     alignment and function desciption
 Score =  151 bits (382), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 154/268 (57%), Gaps = 25/268 (9%)

Query: 5   VSSSSYWCYRCSRFVRVF----SRDDVVSCPDCDGGFVEEIENTPRGIHSTDIHRGPGPG 60
           V++  ++CY+C+R V V     S D   +CP C+ GF+EE +N      S  ++  P   
Sbjct: 18  VTNKPFFCYQCNRTVNVTISPPSSD--PTCPICNEGFLEEYDNPNPNQGSGFLNPNPNSI 75

Query: 61  PGRMRF-----PAAAMYMIGSSNNNSNNIINSSNRSNRDPNNSAGPVLRRSRRTG-GDRS 114
           P    F     P A++  +   +++S     +S+ ++ DPNN   P L    R+G GD  
Sbjct: 76  PFHDLFLTLSDPFASLLPLLFPSSSSTT---TSSSASIDPNN---PSLSGPTRSGRGDPF 129

Query: 115 PFNPVIVLRGPVNGDVDNNGNGYELYYDDGEG-SGLRPLPRSMTEFLLGSGFERLLEQLS 173
            F+P   ++  +N D+ ++G   E    +     G R LP ++ ++ +G G E+L++QL+
Sbjct: 130 AFDPFTFIQNHLN-DLRSSGAQIEFVIQNNPSDQGFR-LPANIGDYFIGPGLEQLIQQLA 187

Query: 174 QIDMNGIGGFENPPASKAAIENMPSILIDSSYVELE-SHCAVCKEAFELGSEAREMPCKH 232
           + D N  G    PPASK+AIE +P + I  S +  E + CAVC + FE G+EA++MPCKH
Sbjct: 188 ENDPNRYG---TPPASKSAIEALPLVNITKSNLNSEFNQCAVCMDDFEEGTEAKQMPCKH 244

Query: 233 IYHSDCILPWLSLRNSCPVCRHELPADN 260
           +YH DC+LPWL L NSCPVCRHELP D+
Sbjct: 245 LYHKDCLLPWLELHNSCPVCRHELPTDD 272




E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Promotes polyubiquitination of target proteins.
Gossypium hirsutum (taxid: 3635)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=2 SV=1 Back     alignment and function description
>sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=2 SV=1 Back     alignment and function description
>sp|Q6IRP0|R126B_XENLA RING finger protein 126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 Back     alignment and function description
>sp|Q6AXU4|RN181_RAT E3 ubiquitin-protein ligase RNF181 OS=Rattus norvegicus GN=Rnf181 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0W3|RN181_BOVIN E3 ubiquitin-protein ligase RNF181 OS=Bos taurus GN=RNF181 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 Back     alignment and function description
>sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 Back     alignment and function description
>sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPL2|CIP8_ARATH E3 ubiquitin-protein ligase CIP8 OS=Arabidopsis thaliana GN=CIP8 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query409
356537930393 PREDICTED: E3 ubiquitin-protein ligase R 0.911 0.949 0.592 1e-119
449459896383 PREDICTED: E3 ubiquitin-protein ligase R 0.914 0.976 0.610 1e-119
449503271380 PREDICTED: E3 ubiquitin-protein ligase R 0.907 0.976 0.607 1e-118
147806280 1218 hypothetical protein VITISV_022309 [Viti 0.731 0.245 0.636 1e-111
225434879388 PREDICTED: E3 ubiquitin-protein ligase R 0.731 0.770 0.636 1e-110
225449444361 PREDICTED: E3 ubiquitin-protein ligase R 0.875 0.991 0.598 1e-104
224109492388 predicted protein [Populus trichocarpa] 0.865 0.912 0.535 1e-102
147821994365 hypothetical protein VITISV_016758 [Viti 0.860 0.964 0.594 1e-100
224101017474 predicted protein [Populus trichocarpa] 0.887 0.765 0.525 1e-100
147861903364 hypothetical protein VITISV_000345 [Viti 0.777 0.873 0.551 1e-98
>gi|356537930|ref|XP_003537459.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max] Back     alignment and taxonomy information
 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 247/417 (59%), Positives = 295/417 (70%), Gaps = 44/417 (10%)

Query: 7   SSSYWCYRCSRFVRVFSRDDVVSCPDCDGGFVEEIENTPRGIHSTDIHRGPGPGPGRMRF 66
           +SSYWCYRCSRFVRV+    VV CPDCDGGF+EEIE+ PR +H         P   R RF
Sbjct: 7   TSSYWCYRCSRFVRVWPHHTVV-CPDCDGGFIEEIEHPPRSVHLD-------PRRHRHRF 58

Query: 67  PAAAMYMIGSSNNNSNNIINSSNRSNRDPNNSAGPVLRRSRRTGGDRSPFNPVIVLRGPV 126
           PAAAMYMIG              R + DP  ++   LRR+RR GGDRSPFNPVIVLRG  
Sbjct: 59  PAAAMYMIG-------------QRPSSDPRPASS--LRRTRRNGGDRSPFNPVIVLRG-- 101

Query: 127 NGDVDNNGNGYELYYDDGEGSGLRPLPRSMTEFLLGSGFERLLEQLSQIDMNGIGGFENP 186
               ++   G+EL+YDDG GSGLRPLP SM+EFLLGSGF+RLLEQLSQI++NGIG +E+P
Sbjct: 102 --GAEDESRGFELFYDDGTGSGLRPLPPSMSEFLLGSGFDRLLEQLSQIEINGIGRYEHP 159

Query: 187 PASKAAIENMPSILIDSSYVELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLR 246
           PASKAAI+++P+I ID +++ +ESHCAVCKEAFE  +  REMPCKHIYH +CILPWL+L 
Sbjct: 160 PASKAAIDSLPTIEIDDTHLAMESHCAVCKEAFETSTAVREMPCKHIYHPECILPWLALH 219

Query: 247 NSCPVCRHELPADNNSNQSNVDESDNGENGQA-----NEDEAVGLTIWRLPGGGFAVGRF 301
           NSCPVCRHELPAD  +   N + + N     +     NE+E VGLTIWRLPGGGFAVGRF
Sbjct: 220 NSCPVCRHELPADTPNPNPNPNSNSNSNQNPSQNVGLNEEENVGLTIWRLPGGGFAVGRF 279

Query: 302 SGGRRGGERELPVVYTEMDGGFNN-GGLPRRVSWGSRGSRGRERGGGFVGRFVRSLFGCF 360
           SGGRRG +RELPVVYTEMDGGFNN GG PRR+SW SRG+RGRE GG  + RF R+LFGCF
Sbjct: 280 SGGRRGADRELPVVYTEMDGGFNNGGGEPRRISW-SRGNRGRESGG--LNRFFRNLFGCF 336

Query: 361 -------GGGSGSSSTSGSSDSRIRRRGTSRAVSLFNVSSR-RSAWDVDVSSEGRRW 409
                      G+S+T  S+ SR   R +S   S  ++S R R  W +DV+S  R W
Sbjct: 337 RGGSSNTSSSGGASATQRSASSRESMRASSSRSSTMDLSPRSRRTWSMDVNSGMRAW 393




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449459896|ref|XP_004147682.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449503271|ref|XP_004161919.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147806280|emb|CAN72193.1| hypothetical protein VITISV_022309 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225434879|ref|XP_002283212.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449444|ref|XP_002283100.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224109492|ref|XP_002315214.1| predicted protein [Populus trichocarpa] gi|222864254|gb|EEF01385.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147821994|emb|CAN70319.1| hypothetical protein VITISV_016758 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101017|ref|XP_002312107.1| predicted protein [Populus trichocarpa] gi|222851927|gb|EEE89474.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147861903|emb|CAN82964.1| hypothetical protein VITISV_000345 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query409
TAIR|locus:2063912401 RHC2A "RING-H2 finger C2A" [Ar 0.523 0.533 0.517 7.8e-60
TAIR|locus:2148318407 RDUF2 "RING and Domain of Unkn 0.508 0.511 0.519 1.1e-58
TAIR|locus:2075175395 RDUF1 "RING and Domain of Unkn 0.496 0.513 0.508 1.1e-56
TAIR|locus:2092231328 AT3G19950 [Arabidopsis thalian 0.430 0.536 0.336 1.8e-31
TAIR|locus:2102569320 RZF1 "AT3G56580" [Arabidopsis 0.283 0.362 0.491 2.3e-31
TAIR|locus:2092895315 AT3G13430 [Arabidopsis thalian 0.288 0.374 0.445 6.8e-30
TAIR|locus:2193874351 AT1G55530 [Arabidopsis thalian 0.300 0.350 0.419 1.1e-29
TAIR|locus:2058465328 RHC1A "RING-H2 finger C1A" [Ar 0.288 0.359 0.464 6.6e-28
TAIR|locus:2177684334 CIP8 "COP1-interacting protein 0.239 0.293 0.464 6.4e-26
TAIR|locus:2195573327 AT1G60360 [Arabidopsis thalian 0.264 0.330 0.452 1.7e-25
TAIR|locus:2063912 RHC2A "RING-H2 finger C2A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 567 (204.7 bits), Expect = 7.8e-60, Sum P(2) = 7.8e-60
 Identities = 117/226 (51%), Positives = 146/226 (64%)

Query:   108 RTGGDRSPFNPVIVLRXXXXXXXXXXXX------XYELYYDDGEGSGLRPLPRSMTEFLL 161
             RT  +RSP NPVIVLR                   +++YYDDG  SGLRPLP SMTEFLL
Sbjct:    87 RTRSNRSP-NPVIVLRGSAAAPSSDVVSEGLDRSAFQMYYDDGTDSGLRPLPPSMTEFLL 145

Query:   162 GSGFERLLEQLSQIDMN---GIGGFENPPASKAAIENMPSILIDSSYV--ELESHCAVCK 216
             GSGF+RLL+Q+SQI++N    +   E+PPASK+AIE +P I ID +++  + +SHCAVCK
Sbjct:   146 GSGFDRLLDQISQIELNTNRNLRSCEHPPASKSAIEALPLIEIDPTHLLSDSQSHCAVCK 205

Query:   217 EAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHELPADNNSNQSNVDESDNGENG 276
             E F L S AREMPC HIYH DCILPWL++RNSCPVCRHELPA++ ++ +    +      
Sbjct:   206 ENFVLKSSAREMPCNHIYHPDCILPWLAIRNSCPVCRHELPAEDLTDGTGAALTAVTATA 265

Query:   277 QANEDEAVGLTIWRLPXXXXXXXXXXXXXXXXXXXLPVVYTEMDGG 322
             +  ED A GLTIWRLP                   +PVVYTE+DGG
Sbjct:   266 EEEEDSAAGLTIWRLPGGGFAVGRIPGGWRGGDRMMPVVYTEVDGG 311


GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2148318 RDUF2 "RING and Domain of Unknown Function 1117 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075175 RDUF1 "RING and Domain of Unknown Function 1117 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092231 AT3G19950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102569 RZF1 "AT3G56580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092895 AT3G13430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2193874 AT1G55530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058465 RHC1A "RING-H2 finger C1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177684 CIP8 "COP1-interacting protein 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195573 AT1G60360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_VIII000482
hypothetical protein (474 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
pfam06547115 pfam06547, DUF1117, Protein of unknown function (D 2e-39
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 6e-16
pfam1436934 pfam14369, zf-RING_3, zinc-finger 2e-13
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-11
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 3e-09
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 4e-09
smart0018440 smart00184, RING, Ring finger 6e-09
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 4e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 8e-08
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-05
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 3e-05
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 1e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 6e-04
>gnl|CDD|219082 pfam06547, DUF1117, Protein of unknown function (DUF1117) Back     alignment and domain information
 Score =  136 bits (345), Expect = 2e-39
 Identities = 77/115 (66%), Positives = 87/115 (75%), Gaps = 3/115 (2%)

Query: 283 AVGLTIWRLPGGGFAVGRFSGGRRGGERELPVVYTEMDGGFNNGGLPRRVSWGSRGSRGR 342
            VGLTIWRLPGGGFAVGRF+GGRR GERELPVVYTEMDGGFN  G PRR+SWGSRG+R R
Sbjct: 1   TVGLTIWRLPGGGFAVGRFAGGRRAGERELPVVYTEMDGGFNGNGAPRRISWGSRGNRSR 60

Query: 343 ERGGGFVGRFVRSLFGCFGGGSGSSSTSGSSDSR--IRRRGTSRAVSLFNVSSRR 395
           ER GG + R  R++F CFG    S S+S SS SR   R R +S   S+F+ SSRR
Sbjct: 61  ER-GGIIRRIFRNMFSCFGRVHSSRSSSSSSSSRSGSRDRSSSSRSSVFSRSSRR 114


This family represents the C-terminus of a number of hypothetical plant proteins. Length = 115

>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|222714 pfam14369, zf-RING_3, zinc-finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 409
PF06547117 DUF1117: Protein of unknown function (DUF1117); In 100.0
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.63
PF1436935 zf-RING_3: zinc-finger 99.57
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.45
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.2
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.19
PHA02929238 N1R/p28-like protein; Provisional 99.18
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.17
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.92
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.86
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.83
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.82
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.82
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.76
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.73
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.65
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.59
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.59
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.58
PF1463444 zf-RING_5: zinc-RING finger domain 98.56
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.53
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.51
PHA02926242 zinc finger-like protein; Provisional 98.49
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.43
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.34
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.19
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.15
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.12
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.09
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.05
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.01
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.0
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.97
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.94
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.91
COG52191525 Uncharacterized conserved protein, contains RING Z 97.89
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.8
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.71
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.68
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.68
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
KOG4445368 consensus Uncharacterized conserved protein, conta 97.57
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.53
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.53
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.35
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.35
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.1
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.93
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.92
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.79
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 96.78
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.7
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.63
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.54
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.34
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.26
KOG1941518 consensus Acetylcholine receptor-associated protei 96.22
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.13
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.08
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.01
COG5152259 Uncharacterized conserved protein, contains RING a 95.98
KOG2660 331 consensus Locus-specific chromosome binding protei 95.72
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.66
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.55
PHA02862156 5L protein; Provisional 95.45
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.38
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.18
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.08
PHA02825162 LAP/PHD finger-like protein; Provisional 95.05
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.03
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.97
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.71
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 94.59
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.33
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.3
COG5222427 Uncharacterized conserved protein, contains RING Z 94.05
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.81
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.76
PF04641260 Rtf2: Rtf2 RING-finger 93.6
PHA03096284 p28-like protein; Provisional 93.52
KOG4739233 consensus Uncharacterized protein involved in syna 93.47
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 92.95
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.82
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.33
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.22
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.9
COG0375115 HybF Zn finger protein HypA/HybF (possibly regulat 91.78
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 91.7
KOG1940276 consensus Zn-finger protein [General function pred 91.69
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.21
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.0
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 89.36
KOG3053293 consensus Uncharacterized conserved protein [Funct 89.11
KOG02981394 consensus DEAD box-containing helicase-like transc 89.1
COG209364 DNA-directed RNA polymerase, subunit E'' [Transcri 89.03
KOG1001674 consensus Helicase-like transcription factor HLTF/ 88.7
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.51
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 86.77
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 86.51
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 85.15
COG5175 480 MOT2 Transcriptional repressor [Transcription] 84.91
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 84.4
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 84.27
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 84.14
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 84.12
KOG1609323 consensus Protein involved in mRNA turnover and st 83.9
KOG03091081 consensus Conserved WD40 repeat-containing protein 83.43
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 83.29
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 83.28
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 83.14
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 82.53
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 82.48
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 82.31
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 81.98
KOG3002299 consensus Zn finger protein [General function pred 81.76
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 80.88
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 80.7
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 80.63
>PF06547 DUF1117: Protein of unknown function (DUF1117); InterPro: IPR010543 This entry represents the C terminus of a number of hypothetical plant proteins Back     alignment and domain information
Probab=100.00  E-value=4.9e-35  Score=243.51  Aligned_cols=113  Identities=72%  Similarity=1.157  Sum_probs=96.5

Q ss_pred             cccceeeecCCCccccccccCCCCCCccccCceeecCCCCCCCC-CCCccccCCCCCCCCcccCCcchHHhhhhhhcccc
Q 039088          283 AVGLTIWRLPGGGFAVGRFSGGRRGGERELPVVYTEMDGGFNNG-GLPRRVSWGSRGSRGRERGGGFVGRFVRSLFGCFG  361 (409)
Q Consensus       283 ~~g~ti~~lPggg~avgr~~g~rr~~er~~Pv~~~e~dg~~n~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  361 (409)
                      ++|||||+||+||||||||+|++|++|++|||||||||||+||+ ++||+|||++++.+++++.||.|+|+|||||+||+
T Consensus         1 avGLTIWRLPGGGFAVGRF~GgrR~gErelPvVyTEmDGgfn~~~g~PRRisW~~r~~r~~~~~gg~~~R~frn~fs~f~   80 (117)
T PF06547_consen    1 AVGLTIWRLPGGGFAVGRFSGGRRAGERELPVVYTEMDGGFNNGGGAPRRISWSSRGGRSRERRGGGFRRVFRNLFSCFG   80 (117)
T ss_pred             CcceEEEEcCCCceEEeeecCCCcCCcccCCEEEEEecCCccCCCCCceeeeecccCCcccccccchHHHHHHHHHHHhc
Confidence            47999999999999999999999999999999999999999988 99999999999999999966669999999999999


Q ss_pred             CCCCCCCCCCCCCc--ccccCCCCCcceeeecCCcc
Q 039088          362 GGSGSSSTSGSSDS--RIRRRGTSRAVSLFNVSSRR  395 (409)
Q Consensus       362 ~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~  395 (409)
                      +++.++++++.+..  ....+..++.+++|++++++
T Consensus        81 ~~~~~~s~ss~~~s~~~s~~~~~~~~~s~~s~s~rr  116 (117)
T PF06547_consen   81 RIGSSSSSSSSSSSRSGSRSRSSSSRSSRFSRSSRR  116 (117)
T ss_pred             CCCCCccccccccccccccccchhhhhhhhcccccc
Confidence            98888876653322  11222356667888888765



>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14369 zf-RING_3: zinc-finger Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-11
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 4e-11
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 9e-07
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 2e-06
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 1e-04
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 2e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 25/52 (48%), Positives = 33/52 (63%) Query: 212 CAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHELPADNNSN 263 C VCKE + LG R++PC H++H CI+PWL +SCPVCR L N + Sbjct: 18 CPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTAT 69
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 8e-41
2ect_A78 Ring finger protein 126; metal binding protein, st 1e-28
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-23
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 4e-23
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-22
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-17
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-16
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 8e-16
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 9e-15
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 8e-13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 4e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-11
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-11
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 8e-10
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 9e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 3e-08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 4e-07
3nw0_A238 Non-structural maintenance of chromosomes element 4e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 8e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-06
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 2e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 8e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 4e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 5e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 7e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 3e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-04
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
 Score =  139 bits (351), Expect = 8e-41
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 169 LEQLSQIDMNGIGGFENPPASKAAIENMPSILIDSSYVEL--ESHCAVCKEAFELGSEAR 226
           +        + +    NPPASK +I+ +P IL+   +  +  E  C +C   +  G  A 
Sbjct: 1   MGHHHHHHSHMVA---NPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVAT 57

Query: 227 EMPCKHIYHSDCILPWLSLRNSCPVCRHELP 257
           E+PC H +H  C+  WL    +CPVCR   P
Sbjct: 58  ELPCHHYFHKPCVSIWLQKSGTCPVCRCMFP 88


>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query409
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.67
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.59
2ect_A78 Ring finger protein 126; metal binding protein, st 99.49
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.48
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.48
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.47
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.36
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.36
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.35
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.33
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.32
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.31
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.28
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.27
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.26
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.26
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.25
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.25
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.21
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.18
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.17
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.16
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.16
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.16
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.14
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.11
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.11
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.09
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.08
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.06
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.02
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.01
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.0
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.98
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.97
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.97
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.95
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.95
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.94
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.92
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.87
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.86
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.84
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.83
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.82
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.81
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.81
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.8
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.8
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.8
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.76
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.74
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.71
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.58
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.57
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.54
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.51
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.5
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.45
2ea5_A68 Cell growth regulator with ring finger domain prot 98.44
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.41
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.32
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.24
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.23
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.21
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.82
3nw0_A238 Non-structural maintenance of chromosomes element 97.71
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.01
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.1
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.78
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.52
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 87.96
1wil_A89 KIAA1045 protein; ring finger domain, structural g 87.36
1we9_A64 PHD finger family protein; structural genomics, PH 87.17
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 86.69
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.29
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 86.07
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 85.79
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 85.61
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 85.24
2k16_A75 Transcription initiation factor TFIID subunit 3; p 84.78
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 83.24
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 82.45
2yt5_A66 Metal-response element-binding transcription facto 82.31
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 81.24
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 80.14
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 80.05
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.67  E-value=6.1e-17  Score=131.95  Aligned_cols=77  Identities=39%  Similarity=0.867  Sum_probs=68.4

Q ss_pred             CCCCCCCCHHHHHcCCceeecccC--cccCccccccccccccCCCceeecccceeChhhhHHHhhcCCCCCCCCccCCC
Q 039088          182 GFENPPASKAAIENMPSILIDSSY--VELESHCAVCKEAFELGSEAREMPCKHIYHSDCILPWLSLRNSCPVCRHELPA  258 (409)
Q Consensus       182 ~~~~ppas~~~i~~lp~~~~~~~~--~~~~~~C~ICle~f~~g~~~~~lPC~H~FH~~CI~~WL~~~~sCPvCR~~l~~  258 (409)
                      .....+++++.|+.||.+++....  ...+..|+||++.|..++.++.|||+|.||..||.+||+.+.+||+||+.+..
T Consensus        11 ~~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           11 MVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             SSCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CcCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            456888999999999999887654  33457899999999988889999999999999999999999999999998865



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 409
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-17
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-15
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-13
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-12
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-10
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-09
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-07
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 4e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-07
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 2e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.001
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 72.6 bits (178), Expect = 4e-17
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 206 VELESHCAVCKEAFELGSEAREMP-CKHIYHSDCILPWLSLRNSCPVCRHEL 256
           ++    CAVC    E G EAR +P C H +H++C+  WL   ++CP+CR  +
Sbjct: 2   MDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV 53


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query409
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.6
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.42
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.33
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.32
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.32
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.22
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.1
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.08
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.03
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.01
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.89
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.86
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.84
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.82
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.58
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.2
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.37
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 91.72
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 89.77
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 87.23
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 85.89
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 80.67
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.60  E-value=2.3e-16  Score=115.98  Aligned_cols=51  Identities=39%  Similarity=0.909  Sum_probs=46.3

Q ss_pred             ccCccccccccccccCCCceeec-ccceeChhhhHHHhhcCCCCCCCCccCC
Q 039088          207 ELESHCAVCKEAFELGSEAREMP-CKHIYHSDCILPWLSLRNSCPVCRHELP  257 (409)
Q Consensus       207 ~~~~~C~ICle~f~~g~~~~~lP-C~H~FH~~CI~~WL~~~~sCPvCR~~l~  257 (409)
                      +++.+|+||+++|..++.+..++ |+|.||..||.+||+.+++||+||++|.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            34568999999999999998886 9999999999999999999999999874



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure