Citrus Sinensis ID: 039149

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530------
KKAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPYS
ccHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccHHHHHHHHccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEcccccEEEcHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccccEEEEEEEccccccccccccccccEEEEcccccccccccHHHHcccccccEEEcccccccccccccHHHccccccEEEccccccccccHHHHccccccEEccccccccccccHHHHHccccccEEEccccccccccccccccEEEcccccccccccccccccEEEEEEccHHHHHHHHHccccccccEEEEEEEEcccccHHHHccccccccccEEEEcccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEccccccEEcccccccccccccccccccccccEEEccccccccEEcccccccccccEEEEcccccccccccccccccccEEEEEcccccccccccccHHccccccccccccc
ccHHHHHHHHHHHHHcHHcccccccccHHHHHccHcccccHHHHHHEEEEEcccccccEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccEEEEEEcccccccccccccccccEEEEEccccccccccHHHHHHccccEEEEccccccHHHHcccccccccccEEEEccccccccccHHHccccccEEEEEcccccHccccHHHHHHHHcccEEEEEccccccccccccccccccccHccHHHHHccccccEEEEEcccccHHHHHHHHHccccHcEEEEEcccccccccccHccccccccccEEEEEcccccccccHcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccHHccccccccccHHHccccccccccccEEEEcccccHHcccccccccccccEEEEcccccHcccccccccHHHcEEEEcccHHHHHHcccccHHHHHHHcccccccc
KKAEHWRRAIEELRRSASEFaglgkevyPLLKFSYDSLQNETIRSCFLYCclypedygilkwdlidcwigegflgesdrfgaenqgydILDTLVRACLLeeveddevkMHDVVRDMALWITCEIEKEKRNFLVCAgeglkeapdvkrweNVRRLSLMQNQIetlsevptcphlLTLFLDFNENLNMIADGFFQLMpslkvlkmsncvnltlklplgmsklgslelldvshtGIRELPEELKLLVNLKCLTLRWtfelnkiprqlisnsSRLRVLRMLGTGLLnfhqasedsvlfgGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNElyinkgfeleelKIDYTEIVRKrrepfvfrslhHVTIWrcaklkdstflvfapnlksLVLRNCHAMEEIisvgkfsevpemmrhmspfenlqrlhvedlpdlksihwkplpfthlkemgvracdqleklpldsssakERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPYS
KKAEHWRRAIEELrrsasefaglgkEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEveddevkmhDVVRDMALWITCEIEKEKRNFLVCAgeglkeapdvkrwenVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEELKLLVNLKCLTLRWtfelnkiprqlisnssrLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELyinkgfeleeLKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISvgkfsevpEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEklpldsssakerkFVIRGEADWWNRLQWEDEATQIAFRSCFQPYS
KKAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEElkllvnlkcltlRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQellglkylevleltlGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPYS
******************EFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKL*********RKFVIRGEADWWNRLQWEDEATQIAFRSCF****
KKAEHWRRAIEELRRS*S***GLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQIL*S**KLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVR*RR**FVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKF**********SPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPY*
KKAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPYS
*KAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQ***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGIRELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPYS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query536 2.2.26 [Sep-21-2011]
Q8RXS5888 Probable disease resistan yes no 0.947 0.572 0.380 6e-86
O64973889 Disease resistance protei no no 0.940 0.566 0.398 3e-81
P60838894 Probable disease resistan no no 0.947 0.568 0.394 1e-80
O82484892 Putative disease resistan no no 0.938 0.563 0.373 1e-79
Q9C8T9898 Putative disease resistan no no 0.938 0.560 0.381 1e-76
Q9SH22884 Probable disease resistan no no 0.923 0.559 0.382 2e-76
Q9SI85893 Probable disease resistan no no 0.923 0.554 0.379 4e-75
Q8L3R3885 Disease resistance protei no no 0.932 0.564 0.395 4e-75
P60839884 Probable disease resistan no no 0.932 0.565 0.383 2e-73
O64790762 Probable disease resistan no no 0.927 0.652 0.371 4e-72
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function desciption
 Score =  318 bits (815), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 205/539 (38%), Positives = 311/539 (57%), Gaps = 31/539 (5%)

Query: 1   KKAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGIL 60
           +  + WR AI+ L  SA+EF+G+  E+ P+LK+SYD+L++E ++ CF YC L+PED+ I 
Sbjct: 364 RTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIE 423

Query: 61  KWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWI 120
           K DL+D WIGEGF+ + ++  AENQGY+I+  LVR+CLL E   + VKMHDVVR+MALWI
Sbjct: 424 KNDLVDYWIGEGFI-DRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWI 482

Query: 121 TCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDF 180
             +  K+K NF+V AG   +  P++++W+  RR+SLM N IE++ + P  P L+TL L  
Sbjct: 483 ASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRK 542

Query: 181 NENLNMIADGFFQLMPSLKVLKMSNCVNLTLK-LPLGMSKLGSLELLDVSHTGIRELPEE 239
           N  L  I+  FF+LMP L VL +S  +N  L+ LP  +S+  SL+ L +S T IR  P  
Sbjct: 543 N-FLGHISSSFFRLMPMLVVLDLS--MNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAG 599

Query: 240 LKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEV 299
           L  L  L  L L +T  +  I    IS  + L+VLR+  +G             F     
Sbjct: 600 LVELRKLLYLNLEYTRMVESICG--ISGLTSLKVLRLFVSG-------------FPEDPC 644

Query: 300 LIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADL 359
           ++ EL  L+ L+ L +TLG    L+  LS+ +L SC R+L ++     +S++   A  D 
Sbjct: 645 VLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMD- 703

Query: 360 NHLNELYINKGFELEELKIDYTEIVRKRREPFV---FRSLHHVTIWRCAKLKDSTFLVFA 416
             L EL+     ++ E+K+   E V     P     F +L  V++  C +L+D T+L+FA
Sbjct: 704 -SLQELHFADS-DIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFA 761

Query: 417 PNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPF 476
           PNL  L + +   ++E+I+  K  +     +++ PF+ L+ L +E++  LK IH  PLPF
Sbjct: 762 PNLTVLRVISASDLKEVINKEKAEQ-----QNLIPFQELKELRLENVQMLKHIHRGPLPF 816

Query: 477 THLKEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPY 535
             L+++ V  C +L KLPL+ +S      VI     W   L+WEDEAT+  F    + +
Sbjct: 817 PCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKAF 875
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|O64790|DRL17_ARATH Probable disease resistance protein At1g61300 OS=Arabidopsis thaliana GN=At1g61300 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query536
24461863 889 NBS-LRR type disease resistance protein 0.988 0.596 0.768 0.0
24461866 890 NBS-LRR type disease resistance protein 0.977 0.588 0.625 1e-178
24461865 892 NBS-LRR type disease resistance protein 0.979 0.588 0.617 1e-170
24461861 890 NBS-LRR type disease resistance protein 0.972 0.585 0.592 1e-159
24461864 899 NBS-LRR type disease resistance protein 0.975 0.581 0.538 1e-150
359482672 905 PREDICTED: probable disease resistance p 0.985 0.583 0.493 1e-127
225442867 893 PREDICTED: probable disease resistance p 0.964 0.578 0.476 1e-123
359482674 991 PREDICTED: probable disease resistance p 0.949 0.513 0.476 1e-121
225443158 903 PREDICTED: probable disease resistance p 0.983 0.583 0.492 1e-121
147852651 882 hypothetical protein VITISV_017542 [Viti 0.927 0.563 0.463 1e-120
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/536 (76%), Positives = 446/536 (83%), Gaps = 6/536 (1%)

Query: 1   KKAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGIL 60
           K  E WR AIE LRRSASEF G    V  + KFSYDSL ++T RSCFLYCCLYP+DYGIL
Sbjct: 358 KTVEEWRHAIEVLRRSASEFPGF-DNVLRVFKFSYDSLPDDTTRSCFLYCCLYPKDYGIL 416

Query: 61  KWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWI 120
           KWDLIDCWIGEGFL ES RF AENQGY I+ TLV ACLLEE+EDD+VKMHDVVR MALWI
Sbjct: 417 KWDLIDCWIGEGFLEESARFVAENQGYCIVGTLVDACLLEEIEDDKVKMHDVVRYMALWI 476

Query: 121 TCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDF 180
            CEIE+EKRNFLV AG GL++AP VK WENVRRLSLMQN I+ LSEVPTCP L TLFL  
Sbjct: 477 VCEIEEEKRNFLVRAGAGLEQAPAVKEWENVRRLSLMQNDIKILSEVPTCPDLHTLFLAS 536

Query: 181 NENLNMIADGFFQLMPSLKVLKMSNCVNL-TLKLPLGMSKLGSLELLDVSHTGIRELPEE 239
           N NL  I DGFF+ MPSLKVLKMS+C +L  LKLPLGMS LGSLELLD+S T I ELPEE
Sbjct: 537 NNNLQRITDGFFKFMPSLKVLKMSHCGDLKVLKLPLGMSMLGSLELLDISQTSIGELPEE 596

Query: 240 LKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEV 299
           LKLLVNLKCL LRW   L+KIPRQLISNSSRL VLRM  TG  +  +ASEDSVLFGGGEV
Sbjct: 597 LKLLVNLKCLNLRWATWLSKIPRQLISNSSRLHVLRMFATGC-SHSEASEDSVLFGGGEV 655

Query: 300 LIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADL 359
           LIQELLGLKYLEVLELTL S HALQ+  SSNKLKSCIRSL L       SI+DATAFADL
Sbjct: 656 LIQELLGLKYLEVLELTLRSSHALQLFFSSNKLKSCIRSLLLDEVRGTKSIIDATAFADL 715

Query: 360 NHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNL 419
           NHLNEL I+   E+EELKIDYTEIVRKRREPFVF SLH VT+ +C KLKD TFLVFAPNL
Sbjct: 716 NHLNELRIDSVAEVEELKIDYTEIVRKRREPFVFGSLHRVTLGQCLKLKDLTFLVFAPNL 775

Query: 420 KSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHL 479
           KSL L NC AMEEIISVGKF+EVPE+M H+SPFENLQRLH+ DLP LKSI+WKPLPFTHL
Sbjct: 776 KSLQLLNCRAMEEIISVGKFAEVPEVMGHISPFENLQRLHLFDLPRLKSIYWKPLPFTHL 835

Query: 480 KEMGVRACDQLEKLPLDSSSAKERKFVIRGEADWWNRLQWEDEATQIAFRSCFQPY 535
           KEM V  C+QL+KLPLDS+SA   KFVIRGEA+ WNRLQWED+ATQIAFRSCFQPY
Sbjct: 836 KEMRVHGCNQLKKLPLDSNSA---KFVIRGEAEGWNRLQWEDDATQIAFRSCFQPY 888

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query536
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.511 0.308 0.434 2.8e-80
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.440 0.264 0.497 7.7e-78
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.434 0.262 0.481 1.8e-77
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.526 0.318 0.457 4.7e-77
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.440 0.266 0.462 4.3e-76
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.507 0.356 0.447 1.2e-73
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.513 0.306 0.422 5e-73
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.513 0.311 0.415 5.7e-72
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.507 0.302 0.436 1e-69
TAIR|locus:2203881893 AT1G62630 [Arabidopsis thalian 0.513 0.307 0.422 1.2e-69
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 561 (202.5 bits), Expect = 2.8e-80, Sum P(2) = 2.8e-80
 Identities = 122/281 (43%), Positives = 177/281 (62%)

Query:     1 KKAEHWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGIL 60
             +  + WR AI+ L  SA+EF+G+  E+ P+LK+SYD+L++E ++ CF YC L+PED+ I 
Sbjct:   364 RTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIE 423

Query:    61 KWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEVKMHDVVRDMALWI 120
             K DL+D WIGEGF+ + ++  AENQGY+I+  LVR+CLL E   + VKMHDVVR+MALWI
Sbjct:   424 KNDLVDYWIGEGFI-DRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWI 482

Query:   121 TCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDF 180
               +  K+K NF+V AG   +  P++++W+  RR+SLM N IE++ + P  P L+TL L  
Sbjct:   483 ASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRK 542

Query:   181 NENLNMIADGFFQLMPSLKVLKMSNCVNLTLK-LPLGMSKLGSLELLDVSHTGIRELPEE 239
             N  L  I+  FF+LMP L VL +S  +N  L+ LP  +S+  SL+ L +S T IR  P  
Sbjct:   543 NF-LGHISSSFFRLMPMLVVLDLS--MNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAG 599

Query:   240 XXXXXXXXXXXXRWTFELNKIPRQLISNSSRLRVLRMLGTG 280
                          +T  +  I    IS  + L+VLR+  +G
Sbjct:   600 LVELRKLLYLNLEYTRMVESICG--ISGLTSLKVLRLFVSG 638
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query536
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 4e-14
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 72.7 bits (179), Expect = 4e-14
 Identities = 32/73 (43%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 6   WRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLI 65
           W   +E+L    +   GL  EV  +L  SYD+L    ++ CFLY  L+PEDY I K  LI
Sbjct: 214 WEHVLEQLNNELAGRDGL-NEVLSILSLSYDNL-PMHLKRCFLYLALFPEDYNIRKEQLI 271

Query: 66  DCWIGEGFLGESD 78
             WI EGF+  SD
Sbjct: 272 KLWIAEGFVIPSD 284

Length = 285
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 536
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.78
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.73
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.65
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.55
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
KOG4237498 consensus Extracellular matrix protein slit, conta 99.31
KOG4237498 consensus Extracellular matrix protein slit, conta 99.26
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.15
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.99
KOG4341483 consensus F-box protein containing LRR [General fu 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
KOG4341483 consensus F-box protein containing LRR [General fu 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.76
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.69
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.68
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.66
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.62
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.59
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.47
PLN03150623 hypothetical protein; Provisional 98.44
PLN03150623 hypothetical protein; Provisional 98.3
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
PRK15386426 type III secretion protein GogB; Provisional 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.13
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.07
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.05
PRK15386426 type III secretion protein GogB; Provisional 98.05
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.0
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.98
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.86
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.68
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.59
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.58
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.46
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.41
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.22
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.06
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.96
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.83
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.78
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.63
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.58
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.75
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.64
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.09
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.4
smart0037026 LRR Leucine-rich repeats, outliers. 91.06
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.06
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.0
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.43
smart0037026 LRR Leucine-rich repeats, outliers. 89.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.22
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.77
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-58  Score=488.35  Aligned_cols=502  Identities=40%  Similarity=0.658  Sum_probs=410.4

Q ss_pred             CCchhHHHHHHHHHcc-ccccCCchhhhHHHHHHhhcCCCchhHhHHHhhcccCCCCcccCHHHHHHHHHHhCCCCC-Cc
Q 039149            1 KKAEHWRRAIEELRRS-ASEFAGLGKEVYPLLKFSYDSLQNETIRSCFLYCCLYPEDYGILKWDLIDCWIGEGFLGE-SD   78 (536)
Q Consensus         1 k~~~~W~~~~~~l~~~-~~~~~~~~~~i~~~L~lSY~~L~~~~lk~cFl~~a~fp~~~~i~~~~Li~~Wia~g~i~~-~~   78 (536)
                      +++.+|++|.+.+.+. ..+.+++++.|+++|++|||+||+ ++|.||+|||+||+||+|++++||.+||||||+.+ +.
T Consensus       370 ~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~  448 (889)
T KOG4658|consen  370 KTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDG  448 (889)
T ss_pred             CcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCcccc
Confidence            3567999999999998 666677788999999999999996 99999999999999999999999999999999999 77


Q ss_pred             hhcHHHHHHHHHHHHHhcCccccc----CCCeEEehHHHHHHHHHHhcccccccceEEEecCCCcccCccccccccceEE
Q 039149           79 RFGAENQGYDILDTLVRACLLEEV----EDDEVKMHDVVRDMALWITCEIEKEKRNFLVCAGEGLKEAPDVKRWENVRRL  154 (536)
Q Consensus        79 ~~~~~~~~~~~~~~L~~~sl~~~~----~~~~~~mhdli~dl~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L  154 (536)
                      +..++++|+.|+.+|+++++++..    ...+|+|||+|||+|.++|++.+..++++++..+.+....|....|..+|++
T Consensus       449 ~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~  528 (889)
T KOG4658|consen  449 GETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRM  528 (889)
T ss_pred             ccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEE
Confidence            899999999999999999999886    3479999999999999999987777778777776677778889999999999


Q ss_pred             EeecCCcccccCCCCCCCcceEecccccc-hhcchhHHhcCCCcccEEEeeccccccccCcccccCCCCCceEeeccCCC
Q 039149          155 SLMQNQIETLSEVPTCPHLLTLFLDFNEN-LNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLELLDVSHTGI  233 (536)
Q Consensus       155 ~l~~~~~~~l~~~~~~~~Lr~L~l~~~~~-l~~~~~~~~~~l~~Lr~L~L~~~~~i~~~lp~~i~~L~~L~~L~L~~~~i  233 (536)
                      +++++.+..++....++.|++|.+.++.. +..++..||..|+.||+|||++|..+. ++|++|++|.|||||+++++.+
T Consensus       529 s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~-~LP~~I~~Li~LryL~L~~t~I  607 (889)
T KOG4658|consen  529 SLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLS-KLPSSIGELVHLRYLDLSDTGI  607 (889)
T ss_pred             EEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccC-cCChHHhhhhhhhcccccCCCc
Confidence            99999999999999999999999998753 788999999999999999999987788 9999999999999999999999


Q ss_pred             cccchhccCCCCCcEEeccCCCCCCccchHHhhcCccCcEEEeccCcccccccccccccccCCcccccccccCccCCceE
Q 039149          234 RELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVL  313 (536)
Q Consensus       234 ~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L  313 (536)
                      +.+|.++++|.+|.+|++..+..+..+|. +...|++||+|.+.......             +...+.++..+++|+.+
T Consensus       608 ~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~-i~~~L~~Lr~L~l~~s~~~~-------------~~~~l~el~~Le~L~~l  673 (889)
T KOG4658|consen  608 SHLPSGLGNLKKLIYLNLEVTGRLESIPG-ILLELQSLRVLRLPRSALSN-------------DKLLLKELENLEHLENL  673 (889)
T ss_pred             cccchHHHHHHhhheeccccccccccccc-hhhhcccccEEEeecccccc-------------chhhHHhhhcccchhhh
Confidence            99999999999999999999877777765 36679999999998765332             45678888889999988


Q ss_pred             EEEecCchhhHHHhcCccccccceeEeecccCCcceecccccccccccccceecccccccceeecccccccccccCCcc-
Q 039149          314 ELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFV-  392 (536)
Q Consensus       314 ~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~-  392 (536)
                      ++.......+..+.....+.+..+.+.+.++... ...  +.+..+.+|+.|.+.+|...+... .+..   ..... . 
T Consensus       674 s~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~-~~~--~~~~~l~~L~~L~i~~~~~~e~~~-~~~~---~~~~~-~~  745 (889)
T KOG4658|consen  674 SITISSVLLLEDLLGMTRLRSLLQSLSIEGCSKR-TLI--SSLGSLGNLEELSILDCGISEIVI-EWEE---SLIVL-LC  745 (889)
T ss_pred             eeecchhHhHhhhhhhHHHHHHhHhhhhcccccc-eee--cccccccCcceEEEEcCCCchhhc-cccc---ccchh-hh
Confidence            8876665444555555554445555655443222 222  278889999999999996643322 1110   00000 3 


Q ss_pred             cCCccEEEeecCCCCcCCcccccCCCccEEEEecCchhhhhhccCCcCCccccccCCCCCCcccee-ccccccccccccC
Q 039149          393 FRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRL-HVEDLPDLKSIHW  471 (536)
Q Consensus       393 ~~~L~~L~l~~c~~l~~l~~l~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~l~~~~~L~~~~~  471 (536)
                      |+++.++.+.+|.....+.|....|+|+.|.+..|..++++++......  ........|.++..+ .+.+.+.++++..
T Consensus       746 f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~--~l~~~i~~f~~~~~l~~~~~l~~l~~i~~  823 (889)
T KOG4658|consen  746 FPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALL--ELKELILPFNKLEGLRMLCSLGGLPQLYW  823 (889)
T ss_pred             HHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhh--hcccEEecccccccceeeecCCCCceeEe
Confidence            7789999999999999999998999999999999999988876332211  111124557777777 5777888888888


Q ss_pred             CCcCCCccceEeeccCCCCCCCCCCCccccCC--ceEE-EehHhhhhccccCchhhhhhh
Q 039149          472 KPLPFTHLKEMGVRACDQLEKLPLDSSSAKER--KFVI-RGEADWWNRLQWEDEATQIAF  528 (536)
Q Consensus       472 ~~~~~~~L~~L~i~~C~~L~~lp~~~~~~~~~--l~~i-~~~~~~~~~~~~~~~~~~~~~  528 (536)
                      ....++.|+.+.+..||++..+|.........  -+.+ ..+.+|.+.+.|.++..+..+
T Consensus       824 ~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  824 LPLSFLKLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             cccCccchhheehhcCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence            88888999999999999999999987665522  2333 345678999999999888777

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query536
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-17
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score = 83.7 bits (207), Expect = 4e-17
 Identities = 21/141 (14%), Positives = 43/141 (30%), Gaps = 21/141 (14%)

Query: 1   KKAEHWRRAIEELRRSASEFAGLGK-----EVYPLLKFSYDSLQNETIRSCFLYCCLYPE 55
                W   +++L+    +            +   +  S + L  E I+  +    +  +
Sbjct: 333 DFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEML-REDIKDYYTDLSILQK 391

Query: 56  DYGILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDEV---KMHDV 112
           D  +    L   W  E    E           DIL   V   LL    + +     +HD+
Sbjct: 392 DVKVPTKVLCILWDMETEEVE-----------DILQEFVNKSLLFCDRNGKSFRYYLHDL 440

Query: 113 VRDMALWITC-EIEKEKRNFL 132
             D      C +++   +  +
Sbjct: 441 QVDFLTEKNCSQLQDLHKKII 461
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query536
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.9
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.87
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.69
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.61
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.61
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.6
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.57
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.5
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.5
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.5
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.47
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.35
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.27
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.1
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.1
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.89
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.84
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.77
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.73
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.21
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.93
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.76
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.59
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.57
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.45
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.14
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.51
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.94  E-value=1.8e-25  Score=220.99  Aligned_cols=282  Identities=17%  Similarity=0.203  Sum_probs=145.2

Q ss_pred             cccccceEEEeecCCcccccCCCCCCCcceEecccccchhcchhHHhcCCCcccEEEeeccccccccCcccccCCCCCce
Q 039149          146 KRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLEL  225 (536)
Q Consensus       146 ~~~~~l~~L~l~~~~~~~l~~~~~~~~Lr~L~l~~~~~l~~~~~~~~~~l~~Lr~L~L~~~~~i~~~lp~~i~~L~~L~~  225 (536)
                      ..++++++|++.++.+..++....+++|++|++++| .++.++.  +..+++|++|+++++ .++ .+| .++.+++|++
T Consensus        41 ~~l~~L~~L~l~~~~i~~~~~~~~~~~L~~L~l~~n-~i~~~~~--~~~l~~L~~L~L~~n-~i~-~~~-~~~~l~~L~~  114 (347)
T 4fmz_A           41 EELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGN-QITDISP--LSNLVKLTNLYIGTN-KIT-DIS-ALQNLTNLRE  114 (347)
T ss_dssp             HHHTTCSEEECCSSCCCCCTTGGGCTTCCEEECCSS-CCCCCGG--GTTCTTCCEEECCSS-CCC-CCG-GGTTCTTCSE
T ss_pred             hhcccccEEEEeCCccccchhhhhcCCccEEEccCC-ccccchh--hhcCCcCCEEEccCC-ccc-Cch-HHcCCCcCCE
Confidence            344556666666666666655555666666666655 4555554  566666666666666 565 544 3666666666


Q ss_pred             EeeccCCCcccchhccCCCCCcEEeccCCCCCCccchHHhhcCccCcEEEeccCcccccccccccccccCCccccccccc
Q 039149          226 LDVSHTGIRELPEELKLLVNLKCLTLRWTFELNKIPRQLISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELL  305 (536)
Q Consensus       226 L~L~~~~i~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  305 (536)
                      |++++|.+..+|. +..+++|++|++++|..+..++.  +..+++|++|++.+|....                 ...+.
T Consensus       115 L~l~~n~i~~~~~-~~~l~~L~~L~l~~n~~~~~~~~--~~~l~~L~~L~l~~~~~~~-----------------~~~~~  174 (347)
T 4fmz_A          115 LYLNEDNISDISP-LANLTKMYSLNLGANHNLSDLSP--LSNMTGLNYLTVTESKVKD-----------------VTPIA  174 (347)
T ss_dssp             EECTTSCCCCCGG-GTTCTTCCEEECTTCTTCCCCGG--GTTCTTCCEEECCSSCCCC-----------------CGGGG
T ss_pred             EECcCCcccCchh-hccCCceeEEECCCCCCcccccc--hhhCCCCcEEEecCCCcCC-----------------chhhc
Confidence            6666666666554 56666666666666644444444  5666666666666655432                 11244


Q ss_pred             CccCCceEEEEecCchhhHHHhcCccccccceeEeecccCCcceecccccccccccccceecccccccceeecccccccc
Q 039149          306 GLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLAGDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVR  385 (536)
Q Consensus       306 ~l~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~l~~l~~~~~~~~~  385 (536)
                      .+++|+.|+++.+....+..+..    .++|+.|.++++.-. ...   .+..+++|++|++++| .+..++.  .    
T Consensus       175 ~l~~L~~L~l~~n~l~~~~~~~~----l~~L~~L~l~~n~l~-~~~---~~~~~~~L~~L~l~~n-~l~~~~~--~----  239 (347)
T 4fmz_A          175 NLTDLYSLSLNYNQIEDISPLAS----LTSLHYFTAYVNQIT-DIT---PVANMTRLNSLKIGNN-KITDLSP--L----  239 (347)
T ss_dssp             GCTTCSEEECTTSCCCCCGGGGG----CTTCCEEECCSSCCC-CCG---GGGGCTTCCEEECCSS-CCCCCGG--G----
T ss_pred             cCCCCCEEEccCCcccccccccC----CCccceeecccCCCC-CCc---hhhcCCcCCEEEccCC-ccCCCcc--h----
Confidence            55555555555544443333111    125555555543221 111   2445555555555555 2222221  0    


Q ss_pred             cccCCcccCCccEEEeecCCCCcCCcccccCCCccEEEEecCchhhhhhccCCcCCccccccCCCCCCccceeccccccc
Q 039149          386 KRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVLRNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPD  465 (536)
Q Consensus       386 ~~~~~~~~~~L~~L~l~~c~~l~~l~~l~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~  465 (536)
                           ..+++|+.|++++| .++.++.+..+++|+.|++++| .+..++             ....+++|+.|++++|.-
T Consensus       240 -----~~l~~L~~L~l~~n-~l~~~~~~~~l~~L~~L~l~~n-~l~~~~-------------~~~~l~~L~~L~L~~n~l  299 (347)
T 4fmz_A          240 -----ANLSQLTWLEIGTN-QISDINAVKDLTKLKMLNVGSN-QISDIS-------------VLNNLSQLNSLFLNNNQL  299 (347)
T ss_dssp             -----TTCTTCCEEECCSS-CCCCCGGGTTCTTCCEEECCSS-CCCCCG-------------GGGGCTTCSEEECCSSCC
T ss_pred             -----hcCCCCCEEECCCC-ccCCChhHhcCCCcCEEEccCC-ccCCCh-------------hhcCCCCCCEEECcCCcC
Confidence                 14555555555555 4455555555555555555554 222221             233455555555555532


Q ss_pred             cccccCCCcCCCccceEeeccCC
Q 039149          466 LKSIHWKPLPFTHLKEMGVRACD  488 (536)
Q Consensus       466 L~~~~~~~~~~~~L~~L~i~~C~  488 (536)
                      -...+.....+++|+.|++++|+
T Consensus       300 ~~~~~~~l~~l~~L~~L~L~~n~  322 (347)
T 4fmz_A          300 GNEDMEVIGGLTNLTTLFLSQNH  322 (347)
T ss_dssp             CGGGHHHHHTCTTCSEEECCSSS
T ss_pred             CCcChhHhhccccCCEEEccCCc
Confidence            22222223345555555555553
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 536
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 38.9 bits (90), Expect = 2e-04
 Identities = 21/127 (16%), Positives = 43/127 (33%), Gaps = 9/127 (7%)

Query: 152 RRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTL 211
           R L L    +  L  +     +  L L  N  L  +      L      L++    +  L
Sbjct: 1   RVLHLAHKDLTVLCHLEQLLLVTHLDLSHN-RLRALPPALAALR----CLEVLQASDNAL 55

Query: 212 KLPLGMSKLGSLELLDVSHTGIRELP--EELKLLVNLKCLTLRWTF--ELNKIPRQLISN 267
           +   G++ L  L+ L + +  +++    + L     L  L L+     +   I  +L   
Sbjct: 56  ENVDGVANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEM 115

Query: 268 SSRLRVL 274
              +  +
Sbjct: 116 LPSVSSI 122
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query536
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.57
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.61
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.76
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.76
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.97
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.4
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.24
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.17
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.86  E-value=1.2e-20  Score=186.35  Aligned_cols=286  Identities=19%  Similarity=0.206  Sum_probs=160.5

Q ss_pred             cccccceEEEeecCCcccccCCCCCCCcceEecccccchhcchhHHhcCCCcccEEEeeccccccccCcccccCCCCCce
Q 039149          146 KRWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNENLNMIADGFFQLMPSLKVLKMSNCVNLTLKLPLGMSKLGSLEL  225 (536)
Q Consensus       146 ~~~~~l~~L~l~~~~~~~l~~~~~~~~Lr~L~l~~~~~l~~~~~~~~~~l~~Lr~L~L~~~~~i~~~lp~~i~~L~~L~~  225 (536)
                      ..+.+++.|++.++.++.+.....+++|++|++++| .++.+++  ++++++|++|+++++ .+. .+++ ++++.+|++
T Consensus        41 ~~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N-~l~~l~~--l~~L~~L~~L~L~~n-~i~-~i~~-l~~l~~L~~  114 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNN-QLTDITP--LKNLTKLVDILMNNN-QIA-DITP-LANLTNLTG  114 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSS-CCCCCGG--GTTCTTCCEEECCSS-CCC-CCGG-GTTCTTCCE
T ss_pred             HHhCCCCEEECCCCCCCCccccccCCCCCEEeCcCC-cCCCCcc--ccCCccccccccccc-ccc-cccc-ccccccccc
Confidence            344678888888888888776678888888888876 7877776  788888888888888 787 6654 788888888


Q ss_pred             EeeccCCCcccchhccCCCCCcEEeccCC-----------------------------------------CCCCccchHH
Q 039149          226 LDVSHTGIRELPEELKLLVNLKCLTLRWT-----------------------------------------FELNKIPRQL  264 (536)
Q Consensus       226 L~L~~~~i~~lp~~i~~L~~L~~L~l~~~-----------------------------------------~~l~~lp~~~  264 (536)
                      |+++++.+..++.. .....+..+....+                                         ......+.. 
T Consensus       115 L~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  192 (384)
T d2omza2         115 LTLFNNQITDIDPL-KNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISV-  192 (384)
T ss_dssp             EECCSSCCCCCGGG-TTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGG-
T ss_pred             cccccccccccccc-cccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccc-
Confidence            88887766544321 11122222211110                                         000111122 


Q ss_pred             hhcCccCcEEEeccCcccccccccccccccCCcccccccccCccCCceEEEEecCchhhHHHhcCccccccceeEeeccc
Q 039149          265 ISNSSRLRVLRMLGTGLLNFHQASEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLFLQLA  344 (536)
Q Consensus       265 i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~  344 (536)
                      ...+++++.+.+.++....                 +......++|+.|.++.+....++.+..    .++++.|++.++
T Consensus       193 ~~~l~~~~~l~l~~n~i~~-----------------~~~~~~~~~L~~L~l~~n~l~~~~~l~~----l~~L~~L~l~~n  251 (384)
T d2omza2         193 LAKLTNLESLIATNNQISD-----------------ITPLGILTNLDELSLNGNQLKDIGTLAS----LTNLTDLDLANN  251 (384)
T ss_dssp             GGGCTTCSEEECCSSCCCC-----------------CGGGGGCTTCCEEECCSSCCCCCGGGGG----CTTCSEEECCSS
T ss_pred             cccccccceeeccCCccCC-----------------CCcccccCCCCEEECCCCCCCCcchhhc----ccccchhccccC
Confidence            4566667777776665432                 2223445566666666555444433222    125666666654


Q ss_pred             CCcceecccccccccccccceecccccccceeecccccccccccCCcccCCccEEEeecCCCCcCCcccccCCCccEEEE
Q 039149          345 GDATSIVDATAFADLNHLNELYINKGFELEELKIDYTEIVRKRREPFVFRSLHHVTIWRCAKLKDSTFLVFAPNLKSLVL  424 (536)
Q Consensus       345 ~~~~~~~~~~~l~~~~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~l~~l~~L~~L~l  424 (536)
                      . +..++   .+..+++|++|+++++ .+..++. .          ..++.++.+.+..+ .++.++.+..+++++.|++
T Consensus       252 ~-l~~~~---~~~~~~~L~~L~l~~~-~l~~~~~-~----------~~~~~l~~l~~~~n-~l~~~~~~~~~~~l~~L~l  314 (384)
T d2omza2         252 Q-ISNLA---PLSGLTKLTELKLGAN-QISNISP-L----------AGLTALTNLELNEN-QLEDISPISNLKNLTYLTL  314 (384)
T ss_dssp             C-CCCCG---GGTTCTTCSEEECCSS-CCCCCGG-G----------TTCTTCSEEECCSS-CCSCCGGGGGCTTCSEEEC
T ss_pred             c-cCCCC---cccccccCCEeeccCc-ccCCCCc-c----------cccccccccccccc-ccccccccchhcccCeEEC
Confidence            3 22221   4556666777776655 2222211 0          04455555555555 4555555555666666666


Q ss_pred             ecCchhhhhhccCCcCCccccccCCCCCCccceeccccccccccccCCCcCCCccceEeeccCCCCCCCC
Q 039149          425 RNCHAMEEIISVGKFSEVPEMMRHMSPFENLQRLHVEDLPDLKSIHWKPLPFTHLKEMGVRACDQLEKLP  494 (536)
Q Consensus       425 ~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~L~~~~~~~~~~~~L~~L~i~~C~~L~~lp  494 (536)
                      +++ .++.++             .+..+|+|++|++++| .++.++ ....+++|+.|++++| +++.+|
T Consensus       315 s~n-~l~~l~-------------~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~  367 (384)
T d2omza2         315 YFN-NISDIS-------------PVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLT  367 (384)
T ss_dssp             CSS-CCSCCG-------------GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCG
T ss_pred             CCC-CCCCCc-------------ccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCCh
Confidence            554 223221             2344566666666655 444444 2334566666666554 455543
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure