Citrus Sinensis ID: 039152


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVKVGSSQLKYL
cccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHcccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccHHHHHHHHHccccccccccc
cccccccccHHHHHHHHHHHHHHHHHHcccccccccEcHHHHHHHHHHHHHHcccccEEEccEEEEccccHHHHccccccEccHHHHHHccccEEEEccccccccccccHHHHHHHHHEEHcccccccHHHHHHHHHHcEEEcccccHHHccHHHHHHHccEEEEcccccccEEcccccccccccEEEEEEccccccccccEHHHHHHHcccccccEEccccEEEEEEEccccHHHHHHHHHHHHHHHHccccHHHccc
LGLFQGIKNIKEARARVHTLVNKLKAFCMLldddenifmHDVACDVAISITSREQNMFTATDELvsgwewsdegrknsffaIPQNLLRSMLQVRVLDLtdmnllslpssiglltnLHTLCLYSCILKDMAVISDLKKLEILCLhgssiyqlpvevgqltqlrsldlrhcsnlqviplnkhlpnltslelevndantlprgglflekperidldanvrlkdqdtvqlWGIEELSLAELLDHIKNFVNKLVKVgssqlkyl
LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVkvgssqlkyl
LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVKVGSSQLKYL
***FQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVKV********
LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTA*DE**SGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVKVGSSQLKYL
LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVKVGSSQLKYL
LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVKVGSSQL**L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDENIFMHDVACDVAISITSREQNMFTATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKDQDTVQLWGIEELSLAELLDHIKNFVNKLVKVGSSQLKYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query259 2.2.26 [Sep-21-2011]
O81825 919 Probable disease resistan yes no 0.710 0.200 0.315 2e-06
Q9T048 985 Disease resistance protei no no 0.652 0.171 0.285 2e-06
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.440 0.111 0.309 4e-06
O61967 699 Protein lap1 OS=Caenorhab yes no 0.532 0.197 0.306 6e-06
Q6DHL5238 Leucine-rich repeat-conta yes no 0.328 0.357 0.348 1e-05
Q7XBQ9 970 Disease resistance protei N/A no 0.451 0.120 0.290 1e-05
Q14160 1630 Protein scribble homolog yes no 0.528 0.084 0.319 3e-05
Q80U72 1612 Protein scribble homolog yes no 0.528 0.084 0.319 4e-05
Q01631 2300 Adenylate cyclase OS=Neur N/A no 0.320 0.036 0.364 8e-05
B0W6M9 628 Leucine-rich repeat prote N/A no 0.590 0.243 0.298 0.0001
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 92/206 (44%), Gaps = 22/206 (10%)

Query: 2   GLFQGIKNIKEARARVHTLVNKLKAFCMLLDDD--ENIFMHDVACDVAISITSREQNMFT 59
           GL  G  + ++      TLV +LK  C+L D D  + + MHDV  D AI   S +   F 
Sbjct: 392 GLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFH 451

Query: 60  ATDELVSGWEWSDEGRKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTL 119
           +   LV        GR       PQ+   S +Q RV  L    L  LP+++  +  + TL
Sbjct: 452 S---LVMA------GR--GLIEFPQDKFVSSVQ-RV-SLMANKLERLPNNV--IEGVETL 496

Query: 120 CLY---SCILKDM--AVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQV 174
            L    +  +K++    +     L IL L G  I  LP     L  LRSL LR+C  L+ 
Sbjct: 497 VLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRN 556

Query: 175 IPLNKHLPNLTSLELEVNDANTLPRG 200
           +P  + L  L  L+L  +    LPRG
Sbjct: 557 LPSLESLVKLQFLDLHESAIRELPRG 582




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function description
>sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description
>sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=3 SV=2 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.783 0.151 0.386 1e-31
255563252 1603 Disease resistance protein RPS5, putativ 0.992 0.160 0.326 1e-30
302143655 1224 unnamed protein product [Vitis vinifera] 0.783 0.165 0.394 3e-30
296087872 1152 unnamed protein product [Vitis vinifera] 0.992 0.223 0.332 8e-30
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.783 0.119 0.360 8e-30
359488027 1520 PREDICTED: disease resistance protein At 0.992 0.169 0.329 1e-29
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.988 0.194 0.325 3e-29
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.779 0.176 0.345 8e-29
147844589 1849 hypothetical protein VITISV_039838 [Viti 0.722 0.101 0.430 5e-28
359487926 2087 PREDICTED: uncharacterized protein LOC10 0.818 0.101 0.342 7e-28
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 100/259 (38%), Positives = 135/259 (52%), Gaps = 56/259 (21%)

Query: 1   LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDDEN-IF-MHDVACDVAISITSREQNMF 58
           L LFQG   ++EA+ R+ TLV+ LKA  +LL+   N +F MHDV  +VAI I S+E ++F
Sbjct: 427 LRLFQGTNTLEEAKNRIETLVDNLKASNLLLETRYNAVFRMHDVVQNVAIEIASKEHHVF 486

Query: 59  T-ATDELVSGWEWSDEGRK--------------------NSFFAIPQNLLRSMLQVRVLD 97
           T  T   +  W   DE +K                    NS   IP      M Q++VLD
Sbjct: 487 TFQTGVRMEEWPNMDELQKFTMIYLDCCDIRELPEGLNHNSSLKIPNTFFEGMKQLKVLD 546

Query: 98  LTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQ 157
            T+M+L SLPSS+  L NL TLCL +C L D+ +I++LKKLEIL L  S I QLP E+ Q
Sbjct: 547 FTNMHLPSLPSSLHCLANLRTLCLDACKLGDITIIAELKKLEILSLMDSDIEQLPRELSQ 606

Query: 158 LTQLRSLDLRHCSNLQVIPLN---------------------------------KHLPNL 184
           LT LR LDL+  S L+VIP +                                 KHL  L
Sbjct: 607 LTHLRLLDLKGSSKLKVIPPDVISSLSQLEDLCMENSYTQWEVEGKSNAYLAELKHLSYL 666

Query: 185 TSLELEVNDANTLPRGGLF 203
           T+L++++ DA   P+  +F
Sbjct: 667 TTLDIQIPDAKLFPKDVVF 685




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302143655|emb|CBI22408.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147844589|emb|CAN80585.1| hypothetical protein VITISV_039838 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487926|ref|XP_002270338.2| PREDICTED: uncharacterized protein LOC100248775 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
MGI|MGI:1927197 582 Shoc2 "soc-2 (suppressor of cl 0.679 0.302 0.312 6.5e-09
TAIR|locus:2088807471 PIRL2 "AT3G26500" [Arabidopsis 0.579 0.318 0.322 2.4e-08
UNIPROTKB|E1BRU6 728 LRSAM1 "Uncharacterized protei 0.444 0.157 0.366 6.2e-08
ZFIN|ZDB-GENE-050208-523 561 shoc2 "soc-2 suppressor of cle 0.594 0.274 0.315 7.4e-08
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.849 0.239 0.302 1.1e-07
UNIPROTKB|E2R260 582 SHOC2 "Uncharacterized protein 0.625 0.278 0.305 1.8e-07
TAIR|locus:2076043 1194 RPP1 "recognition of peronospo 0.718 0.155 0.283 2e-07
TAIR|locus:2010326464 PIRL3 "AT1G12970" [Arabidopsis 0.532 0.297 0.314 2.1e-07
UNIPROTKB|A6QLV3 582 SHOC2 "Leucine-rich repeat pro 0.625 0.278 0.305 3e-07
UNIPROTKB|Q9UQ13 582 SHOC2 "Leucine-rich repeat pro 0.625 0.278 0.305 3e-07
MGI|MGI:1927197 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 158 (60.7 bits), Expect = 6.5e-09, P = 6.5e-09
 Identities = 59/189 (31%), Positives = 100/189 (52%)

Query:    76 KNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCL-YSCILKDMAVISD 134
             +NS  ++P +L  ++ ++R+LDL    L  +PS +  L +L TL L ++ I      I +
Sbjct:   155 ENSLTSLPDSL-DNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKN 213

Query:   135 LKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLNKHLPN---LTSLELEV 191
             L KL +L +  + I QLP E+G+L  L +LD+ H + L+ +P  K + N   +T+L+L+ 
Sbjct:   214 LPKLSMLSIRENKIKQLPAEIGELCNLITLDVAH-NQLEHLP--KEIGNCTQITNLDLQH 270

Query:   192 NDANTLPRGGLFLEKPERIDLDANVRLK--DQDTVQLWGIEELSLAE--LLDHIKNFVNK 247
             ND   LP     L    R+ L  N RL    +   +   +EEL+L    +    ++ ++ 
Sbjct:   271 NDLLDLPDTIGNLSSLNRLGLRYN-RLSAIPRSLAKCSALEELNLENNNISTLPESLLSS 329

Query:   248 LVKVGSSQL 256
             LVK+ S  L
Sbjct:   330 LVKLNSLTL 338


GO:0000164 "protein phosphatase type 1 complex" evidence=ISO
GO:0005634 "nucleus" evidence=ISO
GO:0005737 "cytoplasm" evidence=ISO
GO:0019903 "protein phosphatase binding" evidence=ISO
GO:0046579 "positive regulation of Ras protein signal transduction" evidence=ISO
TAIR|locus:2088807 PIRL2 "AT3G26500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BRU6 LRSAM1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-523 shoc2 "soc-2 suppressor of clear homolog (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2R260 SHOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2076043 RPP1 "recognition of peronospora parasitica 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010326 PIRL3 "AT1G12970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 40.3 bits (94), Expect = 7e-04
 Identities = 39/122 (31%), Positives = 56/122 (45%), Gaps = 2/122 (1%)

Query: 96  LDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVISDL--KKLEILCLHGSSIYQLPV 153
           LDL    L S  S +  LTNL +L L +  + D+  +  L    L+ L L  + I  LP 
Sbjct: 98  LDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKSNLKELDLSDNKIESLPS 157

Query: 154 EVGQLTQLRSLDLRHCSNLQVIPLNKHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLD 213
            +  L  L++LDL       +  L  +L NL +L+L  N  + LP     L   E +DL 
Sbjct: 158 PLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEELDLS 217

Query: 214 AN 215
            N
Sbjct: 218 NN 219


Length = 394

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 259
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.73
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.71
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.59
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.59
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.51
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.48
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.45
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.31
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.31
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.25
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.22
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.22
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.21
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.18
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.16
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.13
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.07
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.07
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.04
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.03
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.0
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.99
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
PLN03150623 hypothetical protein; Provisional 98.93
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
PLN03150623 hypothetical protein; Provisional 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.65
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.49
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.35
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.33
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.25
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.19
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.12
PRK15386 426 type III secretion protein GogB; Provisional 98.11
PRK15386 426 type III secretion protein GogB; Provisional 98.11
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.09
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.82
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.78
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.71
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.46
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.27
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.12
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.37
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.25
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.84
KOG4341483 consensus F-box protein containing LRR [General fu 95.73
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.46
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.15
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.53
smart0037026 LRR Leucine-rich repeats, outliers. 94.53
KOG4341483 consensus F-box protein containing LRR [General fu 94.19
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.0
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.82
smart0037026 LRR Leucine-rich repeats, outliers. 93.82
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.36
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.14
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.15
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 84.34
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.92
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.89  E-value=4.5e-24  Score=197.88  Aligned_cols=232  Identities=24%  Similarity=0.322  Sum_probs=143.7

Q ss_pred             CCCCCCCCcHHHHHHHHHHHHHHHHhcCccccCC-----CcEEccHHHHHHHHHHhh-----cccceEEec---CCCccc
Q 039152            1 LGLFQGIKNIKEARARVHTLVNKLKAFCMLLDDD-----ENIFMHDVACDVAISITS-----REQNMFTAT---DELVSG   67 (259)
Q Consensus         1 eG~i~~~~~~e~~~~~~~~~i~~L~~~~l~~~~~-----~~~~mHdli~dl~~~~~~-----~e~~~~~~~---~~~~~~   67 (259)
                      ||||++.+..+.+++.|++||++|+.++|++..+     .+|+|||+|||||.++|+     +|+..+...   ...+..
T Consensus       440 EGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~  519 (889)
T KOG4658|consen  440 EGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQV  519 (889)
T ss_pred             ccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccc
Confidence            8999997777889999999999999999999875     599999999999999999     676333222   013344


Q ss_pred             cccCccC-------------------ccccc---------ccccHHHHhCCCCccEEEcCCC-CCCCCchhhcCCCCCcE
Q 039152           68 WEWSDEG-------------------RKNSF---------FAIPQNLLRSMLQVRVLDLTDM-NLLSLPSSIGLLTNLHT  118 (259)
Q Consensus        68 ~~~~~~~-------------------~lr~l---------~~l~~~~~~~l~~L~~L~l~~~-~~~~lp~~i~~l~~L~~  118 (259)
                      ..|...+                   +++++         ..++.++|..++.|++||+++| .+.++|..|+.+.+|||
T Consensus       520 ~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~Lry  599 (889)
T KOG4658|consen  520 KSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRY  599 (889)
T ss_pred             cchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhc
Confidence            5565544                   23333         3455666677777777777765 34467777777777777


Q ss_pred             EEecCCCCCC-chhhhCCCCCcEEEecCCCCc-ccchhhccCCcCCEEecCCCCCceeeCCC-------CCCCCCcEEEe
Q 039152          119 LCLYSCILKD-MAVISDLKKLEILCLHGSSIY-QLPVEVGQLTQLRSLDLRHCSNLQVIPLN-------KHLPNLTSLEL  189 (259)
Q Consensus       119 L~l~~~~~~~-~~~~~~l~~L~~L~l~~~~i~-~lp~~i~~l~~L~~L~l~~~~~~~~lp~~-------~~l~~L~~L~l  189 (259)
                      |+++++.+.. |.+++.+..|.+|++..+.-. .+|.....+++|++|.+....    ....       .++.+|+.+..
T Consensus       600 L~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~----~~~~~~~l~el~~Le~L~~ls~  675 (889)
T KOG4658|consen  600 LDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA----LSNDKLLLKELENLEHLENLSI  675 (889)
T ss_pred             ccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc----cccchhhHHhhhcccchhhhee
Confidence            7777777777 677777777777777766433 334444557777777765522    1111       34444444444


Q ss_pred             eccCCCccCCCCcCCCCCCeEEee----cccccCC-cccccccccceeecccc
Q 039152          190 EVNDANTLPRGGLFLEKPERIDLD----ANVRLKD-QDTVQLWGIEELSLAEL  237 (259)
Q Consensus       190 ~~~~~~~~p~~~~~l~~L~~L~l~----~~~~~~~-~~~~~l~~L~~L~l~~~  237 (259)
                      ..... .+-..+..++.|..+...    ++..... .....+++|+.|.+.+|
T Consensus       676 ~~~s~-~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~  727 (889)
T KOG4658|consen  676 TISSV-LLLEDLLGMTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDC  727 (889)
T ss_pred             ecchh-HhHhhhhhhHHHHHHhHhhhhcccccceeecccccccCcceEEEEcC
Confidence            32222 111111233333322221    2211111 22333999999999998



>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
3t6q_A 606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 2e-04
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-04
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 60/195 (30%), Positives = 93/195 (47%), Gaps = 25/195 (12%) Query: 75 RKNSFFAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDMAVI-- 132 +K+ FF I N ++ LDLT +L LPS + L+ L L L + +++ I Sbjct: 262 QKHYFFNISSNTFHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISA 321 Query: 133 SDLKKLEILCLHGSSIYQLPVEVG---QLTQLRSLDLRH-------CSNLQVIPLNKHLP 182 S+ L L + G++ +L + G L LR LDL H C NLQ+ ++L Sbjct: 322 SNFPSLTHLSIKGNT-KRLELGTGCLENLENLRELDLSHDDIETSDCCNLQL----RNLS 376 Query: 183 NLTSLELEVNDANTLPRGGLFLEKPERIDLD-ANVRLKDQDTVQLWGIEELSLAELLDHI 241 +L SL L N+ +L + F E P+ LD A RLK +D + + L L ++L Sbjct: 377 HLQSLNLSYNEPLSL-KTEAFKECPQLELLDLAFTRLKVKDAQSPF--QNLHLLKVL--- 430 Query: 242 KNFVNKLVKVGSSQL 256 N + L+ + S QL Sbjct: 431 -NLSHSLLDISSEQL 444
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 76.9 bits (190), Expect = 1e-16
 Identities = 32/134 (23%), Positives = 52/134 (38%), Gaps = 12/134 (8%)

Query: 77  NSFFAIPQNLLR-SMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKDM-AVISD 134
            +  A    L   +      L+L  + L   P     L++L  + + +  L ++   +  
Sbjct: 66  RALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQ 125

Query: 135 LKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNLQVIPLN----------KHLPNL 184
              LE L L  + +  LP  +  L +LR L +R C  L  +P            + L NL
Sbjct: 126 FAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNL 185

Query: 185 TSLELEVNDANTLP 198
            SL LE     +LP
Sbjct: 186 QSLRLEWTGIRSLP 199


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.77
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.76
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.76
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.76
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.74
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.73
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.73
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.72
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.72
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.72
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.7
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.69
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.69
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.67
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.67
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.67
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.66
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.66
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.65
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.65
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.62
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.62
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.61
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.61
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.61
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.6
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.58
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.55
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.52
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.38
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.38
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.36
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.28
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.24
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.03
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.02
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.95
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.83
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.81
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.11
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.52
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.01
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.24
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 91.32
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 87.69
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.87  E-value=7.1e-22  Score=166.07  Aligned_cols=173  Identities=22%  Similarity=0.342  Sum_probs=105.7

Q ss_pred             cccHHHHhCCCCccEEEcCCCCCCCCchhhcCCCCCcEEEecCCCCCC-chhhhCCCCCcEEEecCCC-Ccccchhhcc-
Q 039152           81 AIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKD-MAVISDLKKLEILCLHGSS-IYQLPVEVGQ-  157 (259)
Q Consensus        81 ~l~~~~~~~l~~L~~L~l~~~~~~~lp~~i~~l~~L~~L~l~~~~~~~-~~~~~~l~~L~~L~l~~~~-i~~lp~~i~~-  157 (259)
                      .+|+.++ ++++|++|++++|.+..+|..++.+++|++|++++|.+.. |..++.+++|++|++++|. +..+|..++. 
T Consensus        95 ~lp~~l~-~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~  173 (328)
T 4fcg_A           95 QFPDQAF-RLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLAST  173 (328)
T ss_dssp             SCCSCGG-GGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEE
T ss_pred             hcChhhh-hCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEECCCCCCccccChhHhhc
Confidence            4555543 4666666666666666666666666666666666666666 5566666666666666643 3355555443 


Q ss_pred             --------CCcCCEEecCCCCCceeeCCC-CCCCCCcEEEeeccCCCccCCCCcCCCCCCeEEeecccccCC-ccccc-c
Q 039152          158 --------LTQLRSLDLRHCSNLQVIPLN-KHLPNLTSLELEVNDANTLPRGGLFLEKPERIDLDANVRLKD-QDTVQ-L  226 (259)
Q Consensus       158 --------l~~L~~L~l~~~~~~~~lp~~-~~l~~L~~L~l~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~~-~~~~~-l  226 (259)
                              +++|++|++++| .+..+|.. +++++|++|++++|.++.+|..++.+++|+.|++++|..... +..+. +
T Consensus       174 ~~~~~~~~l~~L~~L~L~~n-~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l  252 (328)
T 4fcg_A          174 DASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR  252 (328)
T ss_dssp             C-CCCEEESTTCCEEEEEEE-CCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCC
T ss_pred             cchhhhccCCCCCEEECcCC-CcCcchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCC
Confidence                    666666666664 33355543 566677777777777766666666677777777776533322 33333 7


Q ss_pred             cccceeeccccchhhhhhhhhhhhcccccccC
Q 039152          227 WGIEELSLAELLDHIKNFVNKLVKVGSSQLKY  258 (259)
Q Consensus       227 ~~L~~L~l~~~~~~~~~~~~~l~~~~l~~L~~  258 (259)
                      ++|+.|++++| .....+|..+  ..+++|++
T Consensus       253 ~~L~~L~L~~n-~~~~~~p~~~--~~l~~L~~  281 (328)
T 4fcg_A          253 APLKRLILKDC-SNLLTLPLDI--HRLTQLEK  281 (328)
T ss_dssp             CCCCEEECTTC-TTCCBCCTTG--GGCTTCCE
T ss_pred             CCCCEEECCCC-Cchhhcchhh--hcCCCCCE
Confidence            77777777776 4556666543  35666654



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 259
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 46.1 bits (108), Expect = 1e-06
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 113 LTNLHTLCLYSCILKDMAVISDLKKLEILCLHGSSIYQLPVEVGQLTQLRSLDLRHCSNL 172
           L NL  L LY   + D++ +S L KL+ L    + +  +   +  LT +  L   H    
Sbjct: 306 LKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQIS 364

Query: 173 QVIPLNKHLPNLTSLELEVN 192
            + PL  +L  +T L L   
Sbjct: 365 DLTPL-ANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.47
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.26
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.74
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.15
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.17
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.37
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=9.2e-19  Score=140.81  Aligned_cols=156  Identities=23%  Similarity=0.215  Sum_probs=97.0

Q ss_pred             ccccHHHHhCCCCccEEEcCCCCCCCCchhhcCCCCCcEEEecCCCCCC-chhhhCCCCCcEEEecCCCCcccchh-hcc
Q 039152           80 FAIPQNLLRSMLQVRVLDLTDMNLLSLPSSIGLLTNLHTLCLYSCILKD-MAVISDLKKLEILCLHGSSIYQLPVE-VGQ  157 (259)
Q Consensus        80 ~~l~~~~~~~l~~L~~L~l~~~~~~~lp~~i~~l~~L~~L~l~~~~~~~-~~~~~~l~~L~~L~l~~~~i~~lp~~-i~~  157 (259)
                      ..+|++.|.++++|++|++++|.++.+|. ++.+++|++|++++|.++. +..+..+++|++|+++++.+..++.. +..
T Consensus        44 ~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~  122 (266)
T d1p9ag_          44 YTFSLATLMPYTRLTQLNLDRAELTKLQV-DGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRG  122 (266)
T ss_dssp             SEEEGGGGTTCTTCCEEECTTSCCCEEEC-CSCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTT
T ss_pred             CCcCHHHhhcccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccccceeecccccc
Confidence            34555556666666666666666665554 4556666666666666666 55566666666666666666654433 556


Q ss_pred             CCcCCEEecCCCCCceeeCCC--CCCCCCcEEEeeccCCCccCCC-CcCCCCCCeEEeecccccCCccccc-ccccceee
Q 039152          158 LTQLRSLDLRHCSNLQVIPLN--KHLPNLTSLELEVNDANTLPRG-GLFLEKPERIDLDANVRLKDQDTVQ-LWGIEELS  233 (259)
Q Consensus       158 l~~L~~L~l~~~~~~~~lp~~--~~l~~L~~L~l~~~~~~~~p~~-~~~l~~L~~L~l~~~~~~~~~~~~~-l~~L~~L~  233 (259)
                      +.+++.|++.+| .+..+|..  ..+++++.+++++|.++.+|.. +..+++|++|++++|.....+..+. +++|+.|+
T Consensus       123 l~~l~~L~l~~n-~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~~~~~L~~L~  201 (266)
T d1p9ag_         123 LGELQELYLKGN-ELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAF  201 (266)
T ss_dssp             CTTCCEEECTTS-CCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCCCSEEE
T ss_pred             cccccccccccc-ccceeccccccccccchhcccccccccccCccccccccccceeecccCCCcccChhHCCCCCCCEEE
Confidence            666666666663 34444443  5566777777777777666543 4567777777777774444444333 77777777


Q ss_pred             cccc
Q 039152          234 LAEL  237 (259)
Q Consensus       234 l~~~  237 (259)
                      |+++
T Consensus       202 L~~N  205 (266)
T d1p9ag_         202 LHGN  205 (266)
T ss_dssp             CCSC
T ss_pred             ecCC
Confidence            7654



>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure